The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
148
|
structure length |
134
|
Chain Sequence |
DPTIRKYVQSWQKLDVDEQLALFWFIYKEMSPAIAEGLFNQVKELNHEQQLQLQRDLIRRVDNQLSREYGSLGDTTKLLFWYLLSQGMDNATIVPFPADYKLSSESQELLEGIKGLGFEQQITLFRDYVSPMGA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure, Diversity, and Evolution of a New Family of Soluble Carotenoid-Binding Proteins in Cyanobacteria.
pubmed doi rcsb |
| molecule tags |
Cartenoid binding protein
|
| source organism |
Nostoc sp. (strain pcc 7120 / utex 2576)
|
| molecule keywords |
Red carotenoid protein (RCP)
|
| total genus |
53
|
| structure length |
134
|
| sequence length |
148
|
| ec nomenclature | |
| pdb deposition date | 2015-12-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09150 | Carot_N | Orange carotenoid protein, N-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | orange carotenoid protein, domain 2 | Orange carotenoid-binding protein, N-terminal domain |
#chains in the Genus database with same CATH superfamily 3MG1 A; 5FCX A; 4XB5 A; 3MG2 A; 5FCY A; 3MG3 A; 5HGR A; 4XB4 A; #chains in the Genus database with same CATH topology 3MG1 A; 5FCX A; 4XB5 A; 3MG2 A; 5FCY A; 3MG3 A; 5HGR A; 4XB4 A; #chains in the Genus database with same CATH homology 3MG1 A; 5FCX A; 4XB5 A; 3MG2 A; 5FCY A; 3MG3 A; 5HGR A; 4XB4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
