5HGRA

Structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
ITIDSARRIFPNTLQADAVPALTARFNQLSAEDQLAWTWFAFLEMGKTITVAAPGAASMQFAEGILKQIKEMTFEEQTQVMCDLANHTDTPICRTYATWSPNIKLGFWNQLGEWMEQGAVAPIPAGYQLSANANAVLETLKSLDQGQQITVLRSSVVDMGFDAAKLDGYTRVAEPLVAPKDISQRVQVTIEGINNSTVLNYMNNLNANDFDELIKLFVEDGALQPPFQRPIVGKDAILRFFREECQNLNLLPERGVAEPADDGYTQVKVTGKVQTPWFGAAVGMNMAWRFLLNPQGKIFFVAIDLLASPKELLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carotenoid binding protein
molecule keywords Orange Carotenoid Protein (OCP)
publication title Different Functions of the Paralogs to the N-Terminal Domain of the Orange Carotenoid Protein in the Cyanobacterium Anabaena sp. PCC 7120.
pubmed doi rcsb
source organism Nostoc sp. (strain pcc 7120 / utex 2576)
total genus 101
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
A PF09150 Carot_N Orange carotenoid protein, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.2090.10 Mainly Alpha Orthogonal Bundle orange carotenoid protein, domain 2 Orange carotenoid-binding protein, N-terminal domain 5hgrA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5hgrA02
2OWPA 1UUWB 4IIAA 4L8PA 1O7GB 1O7PB 1JN5B 1W01A 2B24B 3NM2A 3T8NA 1A2KA 3EHCA 3FH1A 3I0YA 1O7NB 1GY7A 3HK4A 3F7XA 3BB9A 2CHCA 5BXQA 3KSPA 5AIFA 3MG2A 2XR8B 1OUNA 4X2OA 1O7WB 2GBWB 3VSYA 4X2HA 5STDA 3CNMA 1UUVB 1NWWA 5BVBA 3SOAA 3GZXB 4STDA 5D83A 3FGYA 1JB2A 3ROBA 3F40A 2A15A 4HM8B 4GB5A 1S5AA 3EQQB 4HM6B 2BMRB 5FW5A 1E97A 3F9SA 3K7CA 3CPOA 1IDPA 1OGXA 3OX9A 4I4KA 3OXAA 3G16A 4K1VA 2BNGA 3RGAA 1BUQA 3H51A 3OWSA 2HMMB 2STDA 1STDA 3E99A 5D81A 5KP3A 4HM7B 1Q40B 2F99A 5IEOA 1WQLB 4HKVB 4J8TA 3JUMA 2HMNB 3EN8A 3DZLA 3A76A 3EF8A 3EX9A 4WYKA 3OWUA 3UJMA 2HMJB 5CF2A 4J9AA 1OCVA 1ZX2A 1GS3A 1Q42A 4WYKB 4R9KA 3VGNA 3FKAA 3DXOA 3FSDA 1C7HA 4ORLA 1ASKA 5IG5A 3LYGA 1K41A 3LZAA 5AIHA 3NXJA 1W00A 3KE7A 1OPYA 4MJDA 1OF5A 2K54A 5TGNA 5AIIA 5KP4A 3FLJA 2UX0A 2QIYA 4HZ9B 1JB4A 3JUNA 5IENA 1OF5B 2BMQB 3FZWA 3EC9A 5CLKA 2GEXA 4XDWA 5IG4A 4L8OA 3STDA 1OHPA 4U13A 3CNXA 4HM0B 3MG3A 3GZYB 4HM2B 3BLZA 2HMOB 3Q90A 1W02A 4OUQA 5IEPA 4XB4A 3RGRA 3B8LA 2IMJA 1W6YA 5AIGA 1GY6A 3OWYA 3B4PA 1EG9B 1OHSA 3HX8A 1JKGA 2RGQA 5IG3A 5KP1A 3F8HA 3MYTA 4N3VA 4L7KA 4Q53A 4FCMA 3F8XA 4CDLA 3GZBA 3MSOA 3D9RA 6STDA 1O7MB 4XDVA 5IERA 3CU3A 3GWRA 2RCDA 4KVHA 2CKFB 4HM3B 3G0KA 3HZPA 4LMIA 3H3HA 2YFLB 2JQ5A 2B1XB 5FCXA 4HVNA 3B7CA 1ISKA 2BMOB 2GBXB 2XSOB 1ULJB 1NDOB 1JB5A 4XB5A 3NUVA 3ER7A 4WWUC 1NU3A 3WMDA 3GZRA 1AR0A 3JUPA 1SJWA 3JUOA 4PEJA 3SEDA 4K1UA 3M8CA 1TP6A 2YFJB 1GY5A 2GXFA 4XBYA 1OH0A 4H3UA 4R9LA 1ZO2A 3DUKA 5CXOA 2HMKB 2W2CA 1JN5A 3F7SA 1OGZA 1QMAA 3EBYA 1EA2A 1DMQA 1O7HB 1E3RA 3F14A 5AEUB 2PZVA 3K0ZA 4WP5A 3NHXA 3B4OA 1Z1SA 3EJVA 1CQSA 4XBTA 3FF0A 2YFIB 3OV4A 2HMLB 1OHOA 1DMMA 3EBTA 1VZZA 3G8ZA 4HM4B 4LGQA 4HM1B 5D82A 3NV0A 5CK6A 5EVHA 3GRDA 4OVMA 3S5CA 3EN1B 2XRXB 3NV0B 1JKGB 1QJGA 4HM5B 3T8UA 3FF2A 4RZMA 3DMCA 5CF1A 2Z77A 3NBRA 5AI1A 1DMNA 5G2GA 1TUHA 1ULIB 2RFRA 4XM4A 4HZBB 5JPPA 3KKGA 1HKXA 3JUQA 1E3VA 2I9WA 2Z7AA 5IF6A 5AEWB 2QGUA 4FCJA 4LEHA 4HJLB 3SOYA 4XBXA 5FCYA 3IPTA 5DREA 2F98A 3KZTA 5IG0A 3MKIA 3MG1A 3ECFA 2INXA 3UNLA 1Q40A 2R4IA 7STDA 1GYBA 4R1KA 5DRVA 5JPUA 5HGRA 8CHOA 2XSHB 2GEYA 3DM8A 2F86B 2Z76A 3MHEA 1U5OA
chains in the Genus database with same CATH superfamily
2OWPA 1CYVA 4BL2A 1UUWB 1CH0A 2OQEC 2KF3A 1BSCA 1W7CA 1SPUA 3MWZA 4IIAA 1IQYA 1A2PA 1V57A 4L8PA 1O7GB 2OTL3 1SIHA 1M904 2BT3A 1UCJA 1VQN3 1O7PB 2AAEA 1JN5B 4ILFA 1W01A 1RRLA 2B24B 3NM2A 3CCR3 2KF4A 3T8NA 4LSOA 1YGEA 2FGTA 1DETA 3LTAA 1A2KA 3KIIA 2ZA4A 3N9HA 4O8SA 1KQS2 1AVKA 1JRQA 5A0OB 2XFSA 3BNCA 1RGGA 1BRJA 3EHCA 2CWTA 3SYUA 3ZFZA 2CFGA 3FH1A 5BIRA 1T3BA 1I8VA 3AMOA 2CH9A 3IMAB 1CEWI 3I0YA 1UCKA 1O7NB 2XF3A 2XGLA 1W6GA 3Q1CA 1GY7A 3HK4A 3F7XA 3BB9A 1ZGXA 1DVDA 1I3IA 2CIUA 1CYUA 1IVVA 3PXMA 2RNTA 4KFDA 4G1MB 2CHCA 3SLUA 3I563 5BXQA 3CCJ3 2WO0A 4FMBA 1VQ93 4IPBA 3KSPA 5M1AA 5AIFA 3Q2PA 4JF8A 5EEOA 3OW22 3MG2A 2XFTA 2XR8B 1T2IA 3HI7A 3K9MC 3QK9A 1OUNA 1SARA 4CCVA 4I5QA 1Q7HA 1HU9A 2Y73A 4X2OA 1O7WB 2GBWB 3VSYA 5I97A 1TU5A 1RJOA 4X2HA 2K3DA 3WOFB 1G02A 1X1WA 4EXRA 2F56A 2XEPA 3Q3FA 5STDA 3CNMA 1UUVB 1NWWA 5EQLA 3TDGA 4GL6A 1TIJA 4NREA 3DY5A 5BVBA 4EW5A 1MOLA 3NX0A 1B2MA 3SOAA 4MMYB 3GZXB 4STDA 1GMQA 1FZUA 4K90B 5D83A 3FGYA 1Y4KA 1JB2A 3KN4A 3UL5A 1YVSA 3ROBA 3F40A 4N6LA 4OK0A 1VQ43 1TFKA 2A15A 1N9JA 1W4NA 1IU7A 4EBGA 4HM8B 1BOXA 1EUIC 7GSPA 2WGQA 4GB5A 2BU4A 5LC7A 1VQL3 1S5AA 1Q864 3CCM3 1B2SA 3EQQB 3I553 1GOUA 3SX1A 4HM6B 2BMRB 1BU4A 7RNTA 1HZ1A 1N8QA 4FCZA 3AHSA 4NPBA 5FW5A 2AADA 1WMPA 1E97A 1W5ZA 2LQVA 1IV9A 1YVBI 3F9SA 4GSPA 3K7CA 3CPOA 1RGFA 1IDPA 1OGXA 3CME3 1QVG2 1N5HA 2HOHA 1IT8A 1LNHA 2W9PA 3OX9A 4I4KA 3OXAA 1FGMA 3G16A 4K1VA 4N6V0 3URPA 5ELUA 1RDSA 4EC6A 3LTDA 2BNGA 1PFPA 1B3SA 2C4BA 2RSXA 1EQKA 4GHOA 1I0VA 3RGAA 1BUQA 4FMCA 3DGOA 2CWUA 3CPW2 3H51A 2KCDA 2RBIA 1GMPA 2E2TA 1T2HA 1MWTA 3OWSA 3V92A 3D5IA 3X42A 1IVUA 2HMMB 4RNZA 3SXXA 3WHOA 1F8NA 5AYRB 4FMAA 1BIRA 1M9GA 4O02B 3D3LA 2STDA 3S27A 1STDA 1TTOA 3NM7A 1YIJ3 3E99A 4JRFA 1BRHA 1QAFA 1Q7Y4 5D81A 2M7OA 2F4YA 1YGWA 5KP3A 3LMLA 4HM7B 2WGOA 1Q40B 2F99A 5IEOA 2CG1A 1WQLB 4J5GA 2OOVA 1RCLA 1FUTA 3G713 1MWSA 4HKVB 3JUMA 4J8TA 1MGWA 1YNVX 3CCU3 1NB5I 1LXEA 2HMNB 1RLSA 1OACA 3DZLA 3EN8A 3A76A 1I70A 2E2VA 3CCV3 2GU3A 1YIT3 3EF8A 1FUWA 4N6OB 1UGIA 4MMXB 3UB1A 3EX9A 3PS8A 4WYKA 1RGLA 3SVAA 1VQQA 4HBRA 4BIRA 1I2EA 3OWUA 1M1K4 5BU4A 3UJMA 1KC84 2HMJB 5CF2A 2F5MA 4J9AA 1OCVA 4HAAA 1ZX2A 3L0RA 1LOXA 3CCL3 1GS3A 5ELJA 1NNVA 1BRSA 2P05A 3GSPA 1Q42A 3LT8A 4WYKB 5IW9A 4R9KA 2H0HA 4KT3B 1JNQA 3VGNA 2CG0A 3FKAA 3DXOA 3FSDA 1C7HA 2W9QA 4ORLA 1ASKA 1BSBA 1RGEA 1RHLA 5IG5A 3LYGA 3FG4A 3D79A 3GAXA 1K41A 3LZAA 3CMA3 2SARA 5AIHA 3NXJA 2ZDJA 2J8XB 4KFEA 1W00A 3KE7A 1OPYA 3T0UA 4MJDA 1OF5A 3CXC2 2K54A 1Q814 1DVCA 5TGNA 1MNLA 5AIIA 5KP4A 3FLJA 2UX0A 3RNTA 1M1XB 2QIYA 4R80A 3KFQC 2P0XA 3KSED 8RNTA 1LVNA 2KXGA 3LH4A 4HZ9B 1W2B2 3JVCA 1B20A 1JB4A 3JUNA 5IENA 1OF5B 2BMQB 3WDGB 3FZWA 1EEJA 1WNHA 3WOEB 3AMOB 3EC9A 1RNBA 2D42A 1MWUA 4LYLB 3BIRA 1JV2B 2GEXA 3PYJA 4XDWA 5CLKA 5IG4A 4L8OA 3STDA 1OHPA 2JDIH 4U13A 3CNXA 4HM0B 3MG3A 3GZYB 4HM2B 3J7Yd 3BLZA 2HMOB 1RRHA 3Q90A 1B2UA 3NBJA 1BRIA 1W02A 3AGOA 4OUQA 3S28A 1WMOA 3WR2A 5IEPA 2CK3H 2E2UA 4XB4A 4RNTA 2IYJA 3PGBA 3RGRA 2QA43 3B8LA 1B21A 2UUGC 2MC8A 2IMJA 4KFFA 1W6YA 3X3ZA 5AIGA 1JBRA 3LTBA 3U97A 3V98A 2L1SA 1GY6A 2FNQA 3OWYA 3N54B 1RGAA 1JBSA 1IYYA 3B4PA 1RNTA 1EG9B 2ZL8A 4NHFA 2W04A 1OHSA 3HX8A 2BHMA 1R4YA 1RCKA 1D6YA 1GD3A 1JKGA 2RGQA 5IG3A 1A2VA 2O3OA 5KP1A 3F8HA 1I2GA 3MYTA 2OQEA 2XH9A 2KF5A 4N3VA 1LOWA 1RN4A 4L7KA 4Q53A 4FCMA 4BL3A 3F8XA 1UI8A 1UCIA 1YJW3 1FA3A 4CDLA 3DGLA 3GZBA 3MSOA 1TRPA 3D9RA 1BAOA 6STDA 1MWRA 1O7MB 4N6MA 4CPKA 4HYZA 3N8BA 4XDVA 1BSDA 1VQM3 2OCTA 3CU3A 1GSPA 1I0XA 3GWRA 2RCDA 5IERA 2UGIA 1K28A 4KVHA 2OTJ3 1RMSA 2CKFB 4HM3B 3G0KA 2H0IA 1FYSA 3HZPA 1BRNL 1G0TA 3H3HA 4LMIA 4WFOA 2YFLB 1WMNA 4BTXA 4BTWA 2W6JH 4RNYA 1TRQA 2JQ5A 5JBSA 1FGOA 2B1XB 5FCXA 4HVNA 3B7CA 1X1XA 1KD14 5G1KA 1ISKA 3RDEA 2BMOB 5M18A 3HIGA 2GBXB 4AEQA 2XSOB 1BVIA 1RN7A 1ULJB 1G96A 1QAKA 1AVLA 4R4KA 1UI7A 1NDOB 1JB5A 2ZHXB 1LNIA 1NJI4 1UW1A 3DH2A 4XB5A 3NUVA 3ER7A 1LOYA 1MGRA 1V58A 2XGNA 4H61A 4WWUC 4HOHA 4IT7A 1IVXA 1A90A 3CD63 2IY2A 3CCQ3 4N6TA 2CFKA 1NU3A 1UUGB 1FGRA 3WMDA 2IUKA 1JJ22 3FG3A 1AY7A 3GZRA 3EB8A 2H0GA 4EV5A 3AGNA 5FGOA 1Q9EA 1AR0A 3JUPA 1SJWA 1LOVA 2WOFA 3JUOA 4PEJA 1HYFA 3SEDA 1VQ83 3MPHA 4K1UA 3M8CA 3HOHA 1R4CA 1TP6A 1QVF2 2KRTA 2FXTA 2YFJB 1GY5A 1YJN3 2CFWA 1EKMA 2GXFA 3D4AA 4XBYA 6GSPA 1OH0A 4H3UA 4LZIA 4R9LA 3CCE3 3WA3A 1ZO2A 3DUKA 5CXOA 2HMKB 1GMRA 2K0MA 1VQ73 1LQMB 3PZWA 1UCLA 2W2CA 1DE3A 1JN5A 3F7SA 1OGZA 1D6UA 1QMAA 1W2ZA 3EBYA 1EA2A 1ZS7A 2BO9B 1DMQA 1BNGA 1O7HB 4KZ1A 1C54A 2W03A 2WOHA 3DGYA 4BU4A 1E3RA 1X1UA 1VQO3 1B2ZA 3F14A 1LQGC 1I2FA 1N8R4 3WA2X 4ZM8A 1X1YA 5RNTA 4DKIA 4FR9A 5AEUB 2PZVA 3K0ZA 3QRDA 4WHAA 1V74A 4WP5A 3NHXA 3S67A 1RGKA 2P09A 3B4OA 3ZG0A 3X3YA 3K5TA 1Z1SA 1JZDA 3BNEA 3FCSB 1N5PA 1UGHI 2ML5A 1NO3A 1IK3A 3EJVA 1UDII 1CQSA 1J2BA 4XBTA 2BIRA 2L4VA 1PYLA 1LRAA 3FF0A 1U8CB 4AKZA 1SIIA 1VQ63 2YFIB 1RSNA 1AV4A 2W56A 3NQZA 3OV4A 2HMLB 1OHOA 1DMMA 3HIIA 3LOYA 1BNFA 3EBTA 3IJEB 3PCRA 1VZZA 1SQWA 2C11A 3G8ZA 4HM4B 4LGQA 4N6NB 3CCS3 1BRGA 1N9EA 2CX0A 2ML6A 2W56B 3PCSA 3VF1A 4HM1B 2OOVC 5D82A 1AQZA 3NV0A 4O2HA 9RNTA 1BANA 5CK6A 2YX9A 5EVHA 5GSPA 2GU1A 3GRDA 3BU4A 3UL6A 1FW7A 3NBBA 2W0QA 3NQYA 3LT9A 4OVMA 3S5CA 2O9UX 1D6ZA 1QALA 3EN1B 1BNIA 2XRXB 3NV0B 3CC43 2KAAA 1B27A 3G6E3 1JKGB 1QJGA 4HM5B 1BGSA 5HOHA 3T8UA 3FF2A 3G4S3 2R41A 1RGHA 4RZMA 3FG1A 1TFOA 3EE1A 1TJDA 1PY3A 1JZOA 1A67A 3BNDA 2LYXA 1ROAA 3DMCA 2KF6A 2Z77A 3NBRA 4K61A 1DMNA 4O3VA 5AI1A 4BTYA 5CF1A 5G2GA 1ULIB 1TUHA 2RFRA 3D5GA 1JBTA 1KWIA 2PNCA 4RBNA 4XM4A 1GD4A 4HZBB 5JPPA 1RGCA 3KKGA 5G1LA 3CC73 1HKXA 4TX4A 3V99A 3JUQA 1GOYA 1IQ8A 1E3VA 1VQP3 5LC6A 1US1A 3X41A 2IA7A 3DGNA 4EV2A 1PU4A 1FGTA 2GSPA 2V1LA 1B2XA 1BSAA 1I3FA 3U1WA 1FUSA 1S723 2I9WA 4FMDA 4QWTA 1RKYA 2Y74A 2Z7AA 3LXUX 1DYUA 1NB3I 2CX1A 1IVWA 5IF6A 2Q07A 1YI23 1WTHA 1GOVA 5AEWB 1BSEA 2P0MA 2CW9A 1BNEA 1IQXA 1K8A4 4CJNA 1BNJA 2QGUA 5AYSC 4FCJA 1YJ93 4LEHA 4HJLB 3SOYA 1RTUA 2CFLA 4XBXA 3ZG5A 1VQK3 5FCYA 3IPTA 4EYCA 1BUJA 5DREA 3S29A 2CWVA 2F98A 1K9M4 3KZTA 1KSIA 4MEIA 2QEX3 5IG0A 3MKIA 2D1WA 1IV7A 2C10A 3MG1A 6RNTA 1FGQA 3ECFA 3BNBA 4J5KA 1BNSA 3DGMA 2INXA 3LTCA 3O8YA 3ALAA 2F5WA 3UNLA 1Q40A 3WODG 2R4IA 1T5YA 3A5EA 4N6UA 7STDA 1BNRA 3KCHA 1GYBA 2CFDA 4R1KA 5DRVA 1IT7A 1Q824 2Z6BA 1RN1A 3X3XA 3X40A 1BRKA 2P38A 5JPUA 2CC3A 5HGRA 1YHQ3 8CHOA 1K734 2XSHB 2MF7A 1STFI 3CC23 2SBLA 4AKYA 1W6CA 1VQ53 2GEYA 4MMZB 5M19A 3DM8A 2F86B 2Z76A 3MHEA 1U5OA 2IUJA 1L5GB 1ROVA 3K63A 3AHWA
chains in the Genus database with same CATH topology
2OWPA 1CYVA 1UUWB 2OQEC 1W7CA 1SPUA 3MWZA 4IIAA 1IQYA 4L8PA 1O7GB 2OTL3 1SIHA 1M904 2BT3A 1VQN3 1O7PB 1JN5B 1W01A 1RRLA 2B24B 3NM2A 3CCR3 3T8NA 4LSOA 1YGEA 2FGTA 3LTAA 3N9HA 1A2KA 3KIIA 4O8SA 1KQS2 1AVKA 1JRQA 5A0OB 2XFSA 3BNCA 3EHCA 2CWTA 2CFGA 3FH1A 3AMOA 2CH9A 3IMAB 1CEWI 3I0YA 1O7NB 2XF3A 2XGLA 1W6GA 3Q1CA 1GY7A 3HK4A 3F7XA 3BB9A 1DVDA 2CIUA 1CYUA 1IVVA 3PXMA 4KFDA 4G1MB 2CHCA 3SLUA 3I563 5BXQA 3CCJ3 2WO0A 4FMBA 1VQ93 4IPBA 3KSPA 5AIFA 3Q2PA 4JF8A 5EEOA 3OW22 3MG2A 2XFTA 2XR8B 3HI7A 3K9MC 3QK9A 1OUNA 4CCVA 1HU9A 2Y73A 4X2OA 1O7WB 2GBWB 3VSYA 5I97A 1TU5A 1RJOA 4X2HA 3WOFB 4EXRA 2XEPA 5STDA 3CNMA 1UUVB 1NWWA 5EQLA 3TDGA 4GL6A 1TIJA 4NREA 3DY5A 5BVBA 1MOLA 3NX0A 3SOAA 4MMYB 3GZXB 4STDA 5D83A 4K90B 3FGYA 1Y4KA 1JB2A 3KN4A 3UL5A 3ROBA 3F40A 4N6LA 4OK0A 1VQ43 1TFKA 2A15A 1N9JA 1W4NA 1IU7A 4EBGA 4HM8B 2WGQA 4GB5A 5LC7A 1VQL3 1S5AA 3CCM3 3I553 3EQQB 3SX1A 4HM6B 2BMRB 1N8QA 4FCZA 5FW5A 1WMPA 1E97A 1W5ZA 2LQVA 1IV9A 1YVBI 3F9SA 3K7CA 3CPOA 1IDPA 1OGXA 3CME3 1QVG2 1N5HA 2W9PA 1IT8A 1LNHA 3OX9A 4I4KA 3OXAA 1FGMA 3G16A 4K1VA 4N6V0 5ELUA 4EC6A 3LTDA 2BNGA 1PFPA 2RSXA 1EQKA 3RGAA 1BUQA 4FMCA 3DGOA 2CWUA 3CPW2 3H51A 2KCDA 2E2TA 3OWSA 3V92A 3X42A 1IVUA 2HMMB 4RNZA 3SXXA 1F8NA 5AYRB 4FMAA 1M9GA 4O02B 3D3LA 2STDA 3S27A 1STDA 3NM7A 1YIJ3 3E99A 4JRFA 1QAFA 1Q7Y4 5D81A 2M7OA 5KP3A 3LMLA 4HM7B 2WGOA 1Q40B 2F99A 5IEOA 2CG1A 1WQLB 2OOVA 3G713 4HKVB 4J8TA 3JUMA 3CCU3 1NB5I 1LXEA 2HMNB 3EN8A 1OACA 3DZLA 3A76A 2E2VA 3CCV3 2GU3A 1YIT3 3EF8A 1FUWA 4N6OB 4MMXB 3UB1A 3EX9A 3PS8A 4WYKA 3SVAA 4HBRA 3OWUA 1M1K4 3UJMA 1KC84 2HMJB 5CF2A 4J9AA 1OCVA 1ZX2A 3L0RA 1LOXA 3CCL3 1GS3A 5ELJA 2P05A 3LT8A 1Q42A 4WYKB 5IW9A 4R9KA 1JNQA 3VGNA 2CG0A 3FKAA 3DXOA 3FSDA 1C7HA 2W9QA 4ORLA 1ASKA 1Q864 5IG5A 3LYGA 3FG4A 3GAXA 1K41A 3LZAA 3CMA3 5AIHA 3NXJA 2ZDJA 4KFEA 1W00A 3KE7A 1OPYA 3T0UA 4MJDA 1OF5A 3CXC2 2K54A 1Q814 1DVCA 5TGNA 1MNLA 5AIIA 5KP4A 3FLJA 2UX0A 1M1XB 2QIYA 4R80A 3KFQC 2P0XA 3KSED 1LVNA 2KXGA 3LH4A 4HZ9B 1W2B2 3JVCA 1JB4A 3JUNA 5IENA 1OF5B 2BMQB 3WDGB 3FZWA 1WNHA 3WOEB 3AMOB 3EC9A 2D42A 1JV2B 2GEXA 3PYJA 4XDWA 5CLKA 5IG4A 4L8OA 3STDA 1OHPA 2JDIH 4U13A 3CNXA 4HM0B 3MG3A 3GZYB 4HM2B 3J7Yd 3BLZA 2HMOB 1RRHA 3Q90A 3NBJA 1W02A 4OUQA 3S28A 1WMOA 5IEPA 2CK3H 2E2UA 4XB4A 3RGRA 3PGBA 2QA43 3B8LA 2MC8A 2IMJA 4KFFA 1W6YA 3X3ZA 5AIGA 3LTBA 3U97A 3V98A 1GY6A 2FNQA 3OWYA 3N54B 3B4PA 2ZL8A 1EG9B 4NHFA 2W04A 1OHSA 3HX8A 2BHMA 1D6YA 1GD3A 1JKGA 2RGQA 5IG3A 1A2VA 2O3OA 5KP1A 3F8HA 3MYTA 2OQEA 2XH9A 4N3VA 4L7KA 4Q53A 4FCMA 3F8XA 1UI8A 1YJW3 1FA3A 4CDLA 3DGLA 3GZBA 3MSOA 3D9RA 6STDA 4N6MA 1O7MB 4HYZA 3N8BA 4XDVA 1VQM3 2OCTA 3CU3A 3GWRA 5IERA 2RCDA 1K28A 4KVHA 2OTJ3 2CKFB 4HM3B 3G0KA 3HZPA 4LMIA 3H3HA 4WFOA 2YFLB 1WMNA 4BTXA 4BTWA 2W6JH 4RNYA 2JQ5A 5JBSA 1FGOA 2B1XB 5FCXA 4HVNA 3B7CA 1KD14 1ISKA 3RDEA 2BMOB 3HIGA 2GBXB 4AEQA 2XSOB 1RN7A 1ULJB 1G96A 1QAKA 1AVLA 4R4KA 1UI7A 1NDOB 1JB5A 1NJI4 1UW1A 4XB5A 3NUVA 3ER7A 4H61A 4WWUC 2XGNA 4IT7A 1IVXA 1A90A 3CD63 3CCQ3 4N6TA 2CFKA 1NU3A 1FGRA 3WMDA 2IUKA 1JJ22 3FG3A 3GZRA 3EB8A 4EV5A 5FGOA 1AR0A 3JUPA 1SJWA 2WOFA 3JUOA 4PEJA 3SEDA 1VQ83 3MPHA 4K1UA 3M8CA 1R4CA 1TP6A 1QVF2 2KRTA 2FXTA 2YFJB 1GY5A 1YJN3 2CFWA 1EKMA 2GXFA 4XBYA 1OH0A 4H3UA 4LZIA 4R9LA 3CCE3 3WA3A 1ZO2A 3DUKA 5CXOA 2HMKB 2K0MA 1VQ73 3PZWA 2W2CA 1JN5A 3F7SA 1OGZA 1D6UA 1QMAA 1W2ZA 3EBYA 1EA2A 2BO9B 1DMQA 1O7HB 4KZ1A 2W03A 2WOHA 1E3RA 1VQO3 3F14A 1N8R4 3WA2X 4ZM8A 4FR9A 5AEUB 2PZVA 3K0ZA 3QRDA 4WHAA 1V74A 4WP5A 3NHXA 3S67A 2P09A 3B4OA 3X3YA 3K5TA 1Z1SA 3BNEA 3FCSB 1N5PA 2ML5A 1NO3A 1IK3A 3EJVA 1CQSA 1J2BA 4XBTA 2L4VA 3FF0A 4AKZA 1VQ63 1U8CB 1SIIA 2YFIB 1AV4A 2W56A 3NQZA 3OV4A 2HMLB 1OHOA 1DMMA 3HIIA 3LOYA 3EBTA 3IJEB 3PCRA 1VZZA 1SQWA 2C11A 3G8ZA 4HM4B 4LGQA 4N6NB 3CCS3 1N9EA 3PCSA 2ML6A 2W56B 3VF1A 4HM1B 2OOVC 5D82A 3NV0A 4O2HA 5CK6A 2YX9A 5EVHA 2GU1A 3GRDA 3UL6A 3NBBA 2W0QA 3NQYA 3LT9A 4OVMA 3S5CA 2O9UX 1D6ZA 1QALA 3EN1B 2XRXB 3NV0B 3CC43 3G6E3 1JKGB 1QJGA 4HM5B 3T8UA 3FF2A 3G4S3 4RZMA 3FG1A 1TFOA 3EE1A 1A67A 3BNDA 2LYXA 1ROAA 3DMCA 4O3VA 2Z77A 3NBRA 4K61A 1DMNA 5AI1A 4BTYA 5CF1A 5G2GA 1TUHA 1ULIB 2RFRA 1KWIA 2PNCA 4RBNA 4XM4A 1GD4A 4HZBB 5JPPA 3CC73 3KKGA 1HKXA 4TX4A 3V99A 3JUQA 1IQ8A 1E3VA 1VQP3 5LC6A 1US1A 3X41A 2IA7A 3DGNA 4EV2A 1PU4A 1FGTA 2V1LA 3U1WA 1S723 2I9WA 4FMDA 4QWTA 1RKYA 2Y74A 2Z7AA 3LXUX 1DYUA 1NB3I 1IVWA 5IF6A 2Q07A 1YI23 1WTHA 5AEWB 2P0MA 2CW9A 1IQXA 1K8A4 2QGUA 5AYSC 4FCJA 1YJ93 4LEHA 4HJLB 3SOYA 4XBXA 2CFLA 1VQK3 5FCYA 3IPTA 4EYCA 5DREA 3S29A 2CWVA 2F98A 1K9M4 3KZTA 1KSIA 4MEIA 2QEX3 5IG0A 3MKIA 2D1WA 1IV7A 2C10A 3MG1A 1FGQA 3ECFA 3BNBA 3DGMA 2INXA 3LTCA 3O8YA 3ALAA 3UNLA 1Q40A 3WODG 2R4IA 1T5YA 4N6UA 7STDA 1GYBA 2CFDA 4R1KA 5DRVA 1IT7A 1Q824 2Z6BA 3X3XA 3X40A 2P38A 5JPUA 2CC3A 5HGRA 1YHQ3 8CHOA 1K734 2XSHB 2MF7A 1STFI 3CC23 2SBLA 4AKYA 1W6CA 1VQ53 2GEYA 4MMZB 3DM8A 2F86B 2Z76A 3MHEA 1U5OA 2IUJA 1L5GB 1ROVA 3K63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWP A;  1UUW B;  4IIA A;  4L8P A;  1O7G B;  1O7P B;  1JN5 B;  1W01 A;  2B24 B;  3NM2 A;  3T8N A;  1A2K A;  3EHC A;  3FH1 A;  3I0Y A;  1O7N B;  1GY7 A;  3HK4 A;  3F7X A;  3BB9 A;  2CHC A;  5BXQ A;  3KSP A;  5AIF A;  3MG2 A;  2XR8 B;  1OUN A;  4X2O A;  1O7W B;  2GBW B;  3VSY A;  4X2H A;  5STD A;  3CNM A;  1UUV B;  1NWW A;  5BVB A;  3SOA A;  3GZX B;  4STD A;  5D83 A;  3FGY A;  1JB2 A;  3ROB A;  3F40 A;  2A15 A;  4HM8 B;  4GB5 A;  1S5A A;  3EQQ B;  4HM6 B;  2BMR B;  5FW5 A;  1E97 A;  3F9S A;  3K7C A;  3CPO A;  1IDP A;  1OGX A;  3OX9 A;  4I4K A;  3OXA A;  3G16 A;  4K1V A;  2BNG A;  3RGA A;  1BUQ A;  3H51 A;  3OWS A;  2HMM B;  2STD A;  1STD A;  3E99 A;  5D81 A;  5KP3 A;  4HM7 B;  1Q40 B;  2F99 A;  5IEO A;  1WQL B;  4HKV B;  4J8T A;  3JUM A;  2HMN B;  3EN8 A;  3DZL A;  3A76 A;  3EF8 A;  3EX9 A;  4WYK A;  3OWU A;  3UJM A;  2HMJ B;  5CF2 A;  4J9A A;  1OCV A;  1ZX2 A;  1GS3 A;  1Q42 A;  4WYK B;  4R9K A;  3VGN A;  3FKA A;  3DXO A;  3FSD A;  1C7H A;  4ORL A;  1ASK A;  5IG5 A;  3LYG A;  1K41 A;  3LZA A;  5AIH A;  3NXJ A;  1W00 A;  3KE7 A;  1OPY A;  4MJD A;  1OF5 A;  2K54 A;  5TGN A;  5AII A;  5KP4 A;  3FLJ A;  2UX0 A;  2QIY A;  4HZ9 B;  1JB4 A;  3JUN A;  5IEN A;  1OF5 B;  2BMQ B;  3FZW A;  3EC9 A;  5CLK A;  2GEX A;  4XDW A;  5IG4 A;  4L8O A;  3STD A;  1OHP A;  4U13 A;  3CNX A;  4HM0 B;  3MG3 A;  3GZY B;  4HM2 B;  3BLZ A;  2HMO B;  3Q90 A;  1W02 A;  4OUQ A;  5IEP A;  4XB4 A;  3RGR A;  3B8L A;  2IMJ A;  1W6Y A;  5AIG A;  1GY6 A;  3OWY A;  3B4P A;  1EG9 B;  1OHS A;  3HX8 A;  1JKG A;  2RGQ A;  5IG3 A;  5KP1 A;  3F8H A;  3MYT A;  4N3V A;  4L7K A;  4Q53 A;  4FCM A;  3F8X A;  4CDL A;  3GZB A;  3MSO A;  3D9R A;  6STD A;  1O7M B;  4XDV A;  5IER A;  3CU3 A;  3GWR A;  2RCD A;  4KVH A;  2CKF B;  4HM3 B;  3G0K A;  3HZP A;  4LMI A;  3H3H A;  2YFL B;  2JQ5 A;  2B1X B;  5FCX A;  4HVN A;  3B7C A;  1ISK A;  2BMO B;  2GBX B;  2XSO B;  1ULJ B;  1NDO B;  1JB5 A;  4XB5 A;  3NUV A;  3ER7 A;  4WWU C;  1NU3 A;  3WMD A;  3GZR A;  1AR0 A;  3JUP A;  1SJW A;  3JUO A;  4PEJ A;  3SED A;  4K1U A;  3M8C A;  1TP6 A;  2YFJ B;  1GY5 A;  2GXF A;  4XBY A;  1OH0 A;  4H3U A;  4R9L A;  1ZO2 A;  3DUK A;  5CXO A;  2HMK B;  2W2C A;  1JN5 A;  3F7S A;  1OGZ A;  1QMA A;  3EBY A;  1EA2 A;  1DMQ A;  1O7H B;  1E3R A;  3F14 A;  5AEU B;  2PZV A;  3K0Z A;  4WP5 A;  3NHX A;  3B4O A;  1Z1S A;  3EJV A;  1CQS A;  4XBT A;  3FF0 A;  2YFI B;  3OV4 A;  2HML B;  1OHO A;  1DMM A;  3EBT A;  1VZZ A;  3G8Z A;  4HM4 B;  4LGQ A;  4HM1 B;  5D82 A;  3NV0 A;  5CK6 A;  5EVH A;  3GRD A;  4OVM A;  3S5C A;  3EN1 B;  2XRX B;  3NV0 B;  1JKG B;  1QJG A;  4HM5 B;  3T8U A;  3FF2 A;  4RZM A;  3DMC A;  5CF1 A;  2Z77 A;  3NBR A;  5AI1 A;  1DMN A;  5G2G A;  1TUH A;  1ULI B;  2RFR A;  4XM4 A;  4HZB B;  5JPP A;  3KKG A;  1HKX A;  3JUQ A;  1E3V A;  2I9W A;  2Z7A A;  5IF6 A;  5AEW B;  2QGU A;  4FCJ A;  4LEH A;  4HJL B;  3SOY A;  4XBX A;  5FCY A;  3IPT A;  5DRE A;  2F98 A;  3KZT A;  5IG0 A;  3MKI A;  3MG1 A;  3ECF A;  2INX A;  3UNL A;  1Q40 A;  2R4I A;  7STD A;  1GYB A;  4R1K A;  5DRV A;  5JPU A;  5HGR A;  8CHO A;  2XSH B;  2GEY A;  3DM8 A;  2F86 B;  2Z76 A;  3MHE A;  1U5O A; 
#chains in the Genus database with same CATH topology
 2OWP A;  1CYV A;  4BL2 A;  1UUW B;  1CH0 A;  2OQE C;  2KF3 A;  1BSC A;  1W7C A;  1SPU A;  3MWZ A;  4IIA A;  1IQY A;  1A2P A;  1V57 A;  4L8P A;  1O7G B;  2OTL 3;  1SIH A;  1M90 4;  2BT3 A;  1UCJ A;  1VQN 3;  1O7P B;  2AAE A;  1JN5 B;  4ILF A;  1W01 A;  1RRL A;  2B24 B;  3NM2 A;  3CCR 3;  2KF4 A;  3T8N A;  4LSO A;  1YGE A;  2FGT A;  1DET A;  3LTA A;  1A2K A;  3KII A;  2ZA4 A;  3N9H A;  4O8S A;  1KQS 2;  1AVK A;  1JRQ A;  5A0O B;  2XFS A;  3BNC A;  1RGG A;  1BRJ A;  3EHC A;  2CWT A;  3SYU A;  3ZFZ A;  2CFG A;  3FH1 A;  5BIR A;  1T3B A;  1I8V A;  3AMO A;  2CH9 A;  3IMA B;  1CEW I;  3I0Y A;  1UCK A;  1O7N B;  2XF3 A;  2XGL A;  1W6G A;  3Q1C A;  1GY7 A;  3HK4 A;  3F7X A;  3BB9 A;  1ZGX A;  1DVD A;  1I3I A;  2CIU A;  1CYU A;  1IVV A;  3PXM A;  2RNT A;  4KFD A;  4G1M B;  2CHC A;  3SLU A;  3I56 3;  5BXQ A;  3CCJ 3;  2WO0 A;  4FMB A;  1VQ9 3;  4IPB A;  3KSP A;  5M1A A;  5AIF A;  3Q2P A;  4JF8 A;  5EEO A;  3OW2 2;  3MG2 A;  2XFT A;  2XR8 B;  1T2I A;  3HI7 A;  3K9M C;  3QK9 A;  1OUN A;  1SAR A;  4CCV A;  4I5Q A;  1Q7H A;  1HU9 A;  2Y73 A;  4X2O A;  1O7W B;  2GBW B;  3VSY A;  5I97 A;  1TU5 A;  1RJO A;  4X2H A;  2K3D A;  3WOF B;  1G02 A;  1X1W A;  4EXR A;  2F56 A;  2XEP A;  3Q3F A;  5STD A;  3CNM A;  1UUV B;  1NWW A;  5EQL A;  3TDG A;  4GL6 A;  1TIJ A;  4NRE A;  3DY5 A;  5BVB A;  4EW5 A;  1MOL A;  3NX0 A;  1B2M A;  3SOA A;  4MMY B;  3GZX B;  4STD A;  1GMQ A;  1FZU A;  4K90 B;  5D83 A;  3FGY A;  1Y4K A;  1JB2 A;  3KN4 A;  3UL5 A;  1YVS A;  3ROB A;  3F40 A;  4N6L A;  4OK0 A;  1VQ4 3;  1TFK A;  2A15 A;  1N9J A;  1W4N A;  1IU7 A;  4EBG A;  4HM8 B;  1BOX A;  1EUI C;  7GSP A;  2WGQ A;  4GB5 A;  2BU4 A;  5LC7 A;  1VQL 3;  1S5A A;  1Q86 4;  3CCM 3;  1B2S A;  3EQQ B;  3I55 3;  1GOU A;  3SX1 A;  4HM6 B;  2BMR B;  1BU4 A;  7RNT A;  1HZ1 A;  1N8Q A;  4FCZ A;  3AHS A;  4NPB A;  5FW5 A;  2AAD A;  1WMP A;  1E97 A;  1W5Z A;  2LQV A;  1IV9 A;  1YVB I;  3F9S A;  4GSP A;  3K7C A;  3CPO A;  1RGF A;  1IDP A;  1OGX A;  3CME 3;  1QVG 2;  1N5H A;  2HOH A;  1IT8 A;  1LNH A;  2W9P A;  3OX9 A;  4I4K A;  3OXA A;  1FGM A;  3G16 A;  4K1V A;  4N6V 0;  3URP A;  5ELU A;  1RDS A;  4EC6 A;  3LTD A;  2BNG A;  1PFP A;  1B3S A;  2C4B A;  2RSX A;  1EQK A;  4GHO A;  1I0V A;  3RGA A;  1BUQ A;  4FMC A;  3DGO A;  2CWU A;  3CPW 2;  3H51 A;  2KCD A;  2RBI A;  1GMP A;  2E2T A;  1T2H A;  1MWT A;  3OWS A;  3V92 A;  3D5I A;  3X42 A;  1IVU A;  2HMM B;  4RNZ A;  3SXX A;  3WHO A;  1F8N A;  5AYR B;  4FMA A;  1BIR A;  1M9G A;  4O02 B;  3D3L A;  2STD A;  3S27 A;  1STD A;  1TTO A;  3NM7 A;  1YIJ 3;  3E99 A;  4JRF A;  1BRH A;  1QAF A;  1Q7Y 4;  5D81 A;  2M7O A;  2F4Y A;  1YGW A;  5KP3 A;  3LML A;  4HM7 B;  2WGO A;  1Q40 B;  2F99 A;  5IEO A;  2CG1 A;  1WQL B;  4J5G A;  2OOV A;  1RCL A;  1FUT A;  3G71 3;  1MWS A;  4HKV B;  3JUM A;  4J8T A;  1MGW A;  1YNV X;  3CCU 3;  1NB5 I;  1LXE A;  2HMN B;  1RLS A;  1OAC A;  3DZL A;  3EN8 A;  3A76 A;  1I70 A;  2E2V A;  3CCV 3;  2GU3 A;  1YIT 3;  3EF8 A;  1FUW A;  4N6O B;  1UGI A;  4MMX B;  3UB1 A;  3EX9 A;  3PS8 A;  4WYK A;  1RGL A;  3SVA A;  1VQQ A;  4HBR A;  4BIR A;  1I2E A;  3OWU A;  1M1K 4;  5BU4 A;  3UJM A;  1KC8 4;  2HMJ B;  5CF2 A;  2F5M A;  4J9A A;  1OCV A;  4HAA A;  1ZX2 A;  3L0R A;  1LOX A;  3CCL 3;  1GS3 A;  5ELJ A;  1NNV A;  1BRS A;  2P05 A;  3GSP A;  1Q42 A;  3LT8 A;  4WYK B;  5IW9 A;  4R9K A;  2H0H A;  4KT3 B;  1JNQ A;  3VGN A;  2CG0 A;  3FKA A;  3DXO A;  3FSD A;  1C7H A;  2W9Q A;  4ORL A;  1ASK A;  1BSB A;  1RGE A;  1RHL A;  5IG5 A;  3LYG A;  3FG4 A;  3D79 A;  3GAX A;  1K41 A;  3LZA A;  3CMA 3;  2SAR A;  5AIH A;  3NXJ A;  2ZDJ A;  2J8X B;  4KFE A;  1W00 A;  3KE7 A;  1OPY A;  3T0U A;  4MJD A;  1OF5 A;  3CXC 2;  2K54 A;  1Q81 4;  1DVC A;  5TGN A;  1MNL A;  5AII A;  5KP4 A;  3FLJ A;  2UX0 A;  3RNT A;  1M1X B;  2QIY A;  4R80 A;  3KFQ C;  2P0X A;  3KSE D;  8RNT A;  1LVN A;  2KXG A;  3LH4 A;  4HZ9 B;  1W2B 2;  3JVC A;  1B20 A;  1JB4 A;  3JUN A;  5IEN A;  1OF5 B;  2BMQ B;  3WDG B;  3FZW A;  1EEJ A;  1WNH A;  3WOE B;  3AMO B;  3EC9 A;  1RNB A;  2D42 A;  1MWU A;  4LYL B;  3BIR A;  1JV2 B;  2GEX A;  3PYJ A;  4XDW A;  5CLK A;  5IG4 A;  4L8O A;  3STD A;  1OHP A;  2JDI H;  4U13 A;  3CNX A;  4HM0 B;  3MG3 A;  3GZY B;  4HM2 B;  3J7Y d;  3BLZ A;  2HMO B;  1RRH A;  3Q90 A;  1B2U A;  3NBJ A;  1BRI A;  1W02 A;  3AGO A;  4OUQ A;  3S28 A;  1WMO A;  3WR2 A;  5IEP A;  2CK3 H;  2E2U A;  4XB4 A;  4RNT A;  2IYJ A;  3PGB A;  3RGR A;  2QA4 3;  3B8L A;  1B21 A;  2UUG C;  2MC8 A;  2IMJ A;  4KFF A;  1W6Y A;  3X3Z A;  5AIG A;  1JBR A;  3LTB A;  3U97 A;  3V98 A;  2L1S A;  1GY6 A;  2FNQ A;  3OWY A;  3N54 B;  1RGA A;  1JBS A;  1IYY A;  3B4P A;  1RNT A;  1EG9 B;  2ZL8 A;  4NHF A;  2W04 A;  1OHS A;  3HX8 A;  2BHM A;  1R4Y A;  1RCK A;  1D6Y A;  1GD3 A;  1JKG A;  2RGQ A;  5IG3 A;  1A2V A;  2O3O A;  5KP1 A;  3F8H A;  1I2G A;  3MYT A;  2OQE A;  2XH9 A;  2KF5 A;  4N3V A;  1LOW A;  1RN4 A;  4L7K A;  4Q53 A;  4FCM A;  4BL3 A;  3F8X A;  1UI8 A;  1UCI A;  1YJW 3;  1FA3 A;  4CDL A;  3DGL A;  3GZB A;  3MSO A;  1TRP A;  3D9R A;  1BAO A;  6STD A;  1MWR A;  1O7M B;  4N6M A;  4CPK A;  4HYZ A;  3N8B A;  4XDV A;  1BSD A;  1VQM 3;  2OCT A;  3CU3 A;  1GSP A;  1I0X A;  3GWR A;  2RCD A;  5IER A;  2UGI A;  1K28 A;  4KVH A;  2OTJ 3;  1RMS A;  2CKF B;  4HM3 B;  3G0K A;  2H0I A;  1FYS A;  3HZP A;  1BRN L;  1G0T A;  3H3H A;  4LMI A;  4WFO A;  2YFL B;  1WMN A;  4BTX A;  4BTW A;  2W6J H;  4RNY A;  1TRQ A;  2JQ5 A;  5JBS A;  1FGO A;  2B1X B;  5FCX A;  4HVN A;  3B7C A;  1X1X A;  1KD1 4;  5G1K A;  1ISK A;  3RDE A;  2BMO B;  5M18 A;  3HIG A;  2GBX B;  4AEQ A;  2XSO B;  1BVI A;  1RN7 A;  1ULJ B;  1G96 A;  1QAK A;  1AVL A;  4R4K A;  1UI7 A;  1NDO B;  1JB5 A;  2ZHX B;  1LNI A;  1NJI 4;  1UW1 A;  3DH2 A;  4XB5 A;  3NUV A;  3ER7 A;  1LOY A;  1MGR A;  1V58 A;  2XGN A;  4H61 A;  4WWU C;  4HOH A;  4IT7 A;  1IVX A;  1A90 A;  3CD6 3;  2IY2 A;  3CCQ 3;  4N6T A;  2CFK A;  1NU3 A;  1UUG B;  1FGR A;  3WMD A;  2IUK A;  1JJ2 2;  3FG3 A;  1AY7 A;  3GZR A;  3EB8 A;  2H0G A;  4EV5 A;  3AGN A;  5FGO A;  1Q9E A;  1AR0 A;  3JUP A;  1SJW A;  1LOV A;  2WOF A;  3JUO A;  4PEJ A;  1HYF A;  3SED A;  1VQ8 3;  3MPH A;  4K1U A;  3M8C A;  3HOH A;  1R4C A;  1TP6 A;  1QVF 2;  2KRT A;  2FXT A;  2YFJ B;  1GY5 A;  1YJN 3;  2CFW A;  1EKM A;  2GXF A;  3D4A A;  4XBY A;  6GSP A;  1OH0 A;  4H3U A;  4LZI A;  4R9L A;  3CCE 3;  3WA3 A;  1ZO2 A;  3DUK A;  5CXO A;  2HMK B;  1GMR A;  2K0M A;  1VQ7 3;  1LQM B;  3PZW A;  1UCL A;  2W2C A;  1DE3 A;  1JN5 A;  3F7S A;  1OGZ A;  1D6U A;  1QMA A;  1W2Z A;  3EBY A;  1EA2 A;  1ZS7 A;  2BO9 B;  1DMQ A;  1BNG A;  1O7H B;  4KZ1 A;  1C54 A;  2W03 A;  2WOH A;  3DGY A;  4BU4 A;  1E3R A;  1X1U A;  1VQO 3;  1B2Z A;  3F14 A;  1LQG C;  1I2F A;  1N8R 4;  3WA2 X;  4ZM8 A;  1X1Y A;  5RNT A;  4DKI A;  4FR9 A;  5AEU B;  2PZV A;  3K0Z A;  3QRD A;  4WHA A;  1V74 A;  4WP5 A;  3NHX A;  3S67 A;  1RGK A;  2P09 A;  3B4O A;  3ZG0 A;  3X3Y A;  3K5T A;  1Z1S A;  1JZD A;  3BNE A;  3FCS B;  1N5P A;  1UGH I;  2ML5 A;  1NO3 A;  1IK3 A;  3EJV A;  1UDI I;  1CQS A;  1J2B A;  4XBT A;  2BIR A;  2L4V A;  1PYL A;  1LRA A;  3FF0 A;  1U8C B;  4AKZ A;  1SII A;  1VQ6 3;  2YFI B;  1RSN A;  1AV4 A;  2W56 A;  3NQZ A;  3OV4 A;  2HML B;  1OHO A;  1DMM A;  3HII A;  3LOY A;  1BNF A;  3EBT A;  3IJE B;  3PCR A;  1VZZ A;  1SQW A;  2C11 A;  3G8Z A;  4HM4 B;  4LGQ A;  4N6N B;  3CCS 3;  1BRG A;  1N9E A;  2CX0 A;  2ML6 A;  2W56 B;  3PCS A;  3VF1 A;  4HM1 B;  2OOV C;  5D82 A;  1AQZ A;  3NV0 A;  4O2H A;  9RNT A;  1BAN A;  5CK6 A;  2YX9 A;  5EVH A;  5GSP A;  2GU1 A;  3GRD A;  3BU4 A;  3UL6 A;  1FW7 A;  3NBB A;  2W0Q A;  3NQY A;  3LT9 A;  4OVM A;  3S5C A;  2O9U X;  1D6Z A;  1QAL A;  3EN1 B;  1BNI A;  2XRX B;  3NV0 B;  3CC4 3;  2KAA A;  1B27 A;  3G6E 3;  1JKG B;  1QJG A;  4HM5 B;  1BGS A;  5HOH A;  3T8U A;  3FF2 A;  3G4S 3;  2R41 A;  1RGH A;  4RZM A;  3FG1 A;  1TFO A;  3EE1 A;  1TJD A;  1PY3 A;  1JZO A;  1A67 A;  3BND A;  2LYX A;  1ROA A;  3DMC A;  2KF6 A;  2Z77 A;  3NBR A;  4K61 A;  1DMN A;  4O3V A;  5AI1 A;  4BTY A;  5CF1 A;  5G2G A;  1ULI B;  1TUH A;  2RFR A;  3D5G A;  1JBT A;  1KWI A;  2PNC A;  4RBN A;  4XM4 A;  1GD4 A;  4HZB B;  5JPP A;  1RGC A;  3KKG A;  5G1L A;  3CC7 3;  1HKX A;  4TX4 A;  3V99 A;  3JUQ A;  1GOY A;  1IQ8 A;  1E3V A;  1VQP 3;  5LC6 A;  1US1 A;  3X41 A;  2IA7 A;  3DGN A;  4EV2 A;  1PU4 A;  1FGT A;  2GSP A;  2V1L A;  1B2X A;  1BSA A;  1I3F A;  3U1W A;  1FUS A;  1S72 3;  2I9W A;  4FMD A;  4QWT A;  1RKY A;  2Y74 A;  2Z7A A;  3LXU X;  1DYU A;  1NB3 I;  2CX1 A;  1IVW A;  5IF6 A;  2Q07 A;  1YI2 3;  1WTH A;  1GOV A;  5AEW B;  1BSE A;  2P0M A;  2CW9 A;  1BNE A;  1IQX A;  1K8A 4;  4CJN A;  1BNJ A;  2QGU A;  5AYS C;  4FCJ A;  1YJ9 3;  4LEH A;  4HJL B;  3SOY A;  1RTU A;  2CFL A;  4XBX A;  3ZG5 A;  1VQK 3;  5FCY A;  3IPT A;  4EYC A;  1BUJ A;  5DRE A;  3S29 A;  2CWV A;  2F98 A;  1K9M 4;  3KZT A;  1KSI A;  4MEI A;  2QEX 3;  5IG0 A;  3MKI A;  2D1W A;  1IV7 A;  2C10 A;  3MG1 A;  6RNT A;  1FGQ A;  3ECF A;  3BNB A;  4J5K A;  1BNS A;  3DGM A;  2INX A;  3LTC A;  3O8Y A;  3ALA A;  2F5W A;  3UNL A;  1Q40 A;  3WOD G;  2R4I A;  1T5Y A;  3A5E A;  4N6U A;  7STD A;  1BNR A;  3KCH A;  1GYB A;  2CFD A;  4R1K A;  5DRV A;  1IT7 A;  1Q82 4;  2Z6B A;  1RN1 A;  3X3X A;  3X40 A;  1BRK A;  2P38 A;  5JPU A;  2CC3 A;  5HGR A;  1YHQ 3;  8CHO A;  1K73 4;  2XSH B;  2MF7 A;  1STF I;  3CC2 3;  2SBL A;  4AKY A;  1W6C A;  1VQ5 3;  2GEY A;  4MMZ B;  5M19 A;  3DM8 A;  2F86 B;  2Z76 A;  3MHE A;  1U5O A;  2IUJ A;  1L5G B;  1ROV A;  3K63 A;  3AHW A; 
#chains in the Genus database with same CATH homology
 2OWP A;  1CYV A;  1UUW B;  2OQE C;  1W7C A;  1SPU A;  3MWZ A;  4IIA A;  1IQY A;  4L8P A;  1O7G B;  2OTL 3;  1SIH A;  1M90 4;  2BT3 A;  1VQN 3;  1O7P B;  1JN5 B;  1W01 A;  1RRL A;  2B24 B;  3NM2 A;  3CCR 3;  3T8N A;  4LSO A;  1YGE A;  2FGT A;  3LTA A;  3N9H A;  1A2K A;  3KII A;  4O8S A;  1KQS 2;  1AVK A;  1JRQ A;  5A0O B;  2XFS A;  3BNC A;  3EHC A;  2CWT A;  2CFG A;  3FH1 A;  3AMO A;  2CH9 A;  3IMA B;  1CEW I;  3I0Y A;  1O7N B;  2XF3 A;  2XGL A;  1W6G A;  3Q1C A;  1GY7 A;  3HK4 A;  3F7X A;  3BB9 A;  1DVD A;  2CIU A;  1CYU A;  1IVV A;  3PXM A;  4KFD A;  4G1M B;  2CHC A;  3SLU A;  3I56 3;  5BXQ A;  3CCJ 3;  2WO0 A;  4FMB A;  1VQ9 3;  4IPB A;  3KSP A;  5AIF A;  3Q2P A;  4JF8 A;  5EEO A;  3OW2 2;  3MG2 A;  2XFT A;  2XR8 B;  3HI7 A;  3K9M C;  3QK9 A;  1OUN A;  4CCV A;  1HU9 A;  2Y73 A;  4X2O A;  1O7W B;  2GBW B;  3VSY A;  5I97 A;  1TU5 A;  1RJO A;  4X2H A;  3WOF B;  4EXR A;  2XEP A;  5STD A;  3CNM A;  1UUV B;  1NWW A;  5EQL A;  3TDG A;  4GL6 A;  1TIJ A;  4NRE A;  3DY5 A;  5BVB A;  1MOL A;  3NX0 A;  3SOA A;  4MMY B;  3GZX B;  4STD A;  5D83 A;  4K90 B;  3FGY A;  1Y4K A;  1JB2 A;  3KN4 A;  3UL5 A;  3ROB A;  3F40 A;  4N6L A;  4OK0 A;  1VQ4 3;  1TFK A;  2A15 A;  1N9J A;  1W4N A;  1IU7 A;  4EBG A;  4HM8 B;  2WGQ A;  4GB5 A;  5LC7 A;  1VQL 3;  1S5A A;  3CCM 3;  3I55 3;  3EQQ B;  3SX1 A;  4HM6 B;  2BMR B;  1N8Q A;  4FCZ A;  5FW5 A;  1WMP A;  1E97 A;  1W5Z A;  2LQV A;  1IV9 A;  1YVB I;  3F9S A;  3K7C A;  3CPO A;  1IDP A;  1OGX A;  3CME 3;  1QVG 2;  1N5H A;  2W9P A;  1IT8 A;  1LNH A;  3OX9 A;  4I4K A;  3OXA A;  1FGM A;  3G16 A;  4K1V A;  4N6V 0;  5ELU A;  4EC6 A;  3LTD A;  2BNG A;  1PFP A;  2RSX A;  1EQK A;  3RGA A;  1BUQ A;  4FMC A;  3DGO A;  2CWU A;  3CPW 2;  3H51 A;  2KCD A;  2E2T A;  3OWS A;  3V92 A;  3X42 A;  1IVU A;  2HMM B;  4RNZ A;  3SXX A;  1F8N A;  5AYR B;  4FMA A;  1M9G A;  4O02 B;  3D3L A;  2STD A;  3S27 A;  1STD A;  3NM7 A;  1YIJ 3;  3E99 A;  4JRF A;  1QAF A;  1Q7Y 4;  5D81 A;  2M7O A;  5KP3 A;  3LML A;  4HM7 B;  2WGO A;  1Q40 B;  2F99 A;  5IEO A;  2CG1 A;  1WQL B;  2OOV A;  3G71 3;  4HKV B;  4J8T A;  3JUM A;  3CCU 3;  1NB5 I;  1LXE A;  2HMN B;  3EN8 A;  1OAC A;  3DZL A;  3A76 A;  2E2V A;  3CCV 3;  2GU3 A;  1YIT 3;  3EF8 A;  1FUW A;  4N6O B;  4MMX B;  3UB1 A;  3EX9 A;  3PS8 A;  4WYK A;  3SVA A;  4HBR A;  3OWU A;  1M1K 4;  3UJM A;  1KC8 4;  2HMJ B;  5CF2 A;  4J9A A;  1OCV A;  1ZX2 A;  3L0R A;  1LOX A;  3CCL 3;  1GS3 A;  5ELJ A;  2P05 A;  3LT8 A;  1Q42 A;  4WYK B;  5IW9 A;  4R9K A;  1JNQ A;  3VGN A;  2CG0 A;  3FKA A;  3DXO A;  3FSD A;  1C7H A;  2W9Q A;  4ORL A;  1ASK A;  1Q86 4;  5IG5 A;  3LYG A;  3FG4 A;  3GAX A;  1K41 A;  3LZA A;  3CMA 3;  5AIH A;  3NXJ A;  2ZDJ A;  4KFE A;  1W00 A;  3KE7 A;  1OPY A;  3T0U A;  4MJD A;  1OF5 A;  3CXC 2;  2K54 A;  1Q81 4;  1DVC A;  5TGN A;  1MNL A;  5AII A;  5KP4 A;  3FLJ A;  2UX0 A;  1M1X B;  2QIY A;  4R80 A;  3KFQ C;  2P0X A;  3KSE D;  1LVN A;  2KXG A;  3LH4 A;  4HZ9 B;  1W2B 2;  3JVC A;  1JB4 A;  3JUN A;  5IEN A;  1OF5 B;  2BMQ B;  3WDG B;  3FZW A;  1WNH A;  3WOE B;  3AMO B;  3EC9 A;  2D42 A;  1JV2 B;  2GEX A;  3PYJ A;  4XDW A;  5CLK A;  5IG4 A;  4L8O A;  3STD A;  1OHP A;  2JDI H;  4U13 A;  3CNX A;  4HM0 B;  3MG3 A;  3GZY B;  4HM2 B;  3J7Y d;  3BLZ A;  2HMO B;  1RRH A;  3Q90 A;  3NBJ A;  1W02 A;  4OUQ A;  3S28 A;  1WMO A;  5IEP A;  2CK3 H;  2E2U A;  4XB4 A;  3RGR A;  3PGB A;  2QA4 3;  3B8L A;  2MC8 A;  2IMJ A;  4KFF A;  1W6Y A;  3X3Z A;  5AIG A;  3LTB A;  3U97 A;  3V98 A;  1GY6 A;  2FNQ A;  3OWY A;  3N54 B;  3B4P A;  2ZL8 A;  1EG9 B;  4NHF A;  2W04 A;  1OHS A;  3HX8 A;  2BHM A;  1D6Y A;  1GD3 A;  1JKG A;  2RGQ A;  5IG3 A;  1A2V A;  2O3O A;  5KP1 A;  3F8H A;  3MYT A;  2OQE A;  2XH9 A;  4N3V A;  4L7K A;  4Q53 A;  4FCM A;  3F8X A;  1UI8 A;  1YJW 3;  1FA3 A;  4CDL A;  3DGL A;  3GZB A;  3MSO A;  3D9R A;  6STD A;  4N6M A;  1O7M B;  4HYZ A;  3N8B A;  4XDV A;  1VQM 3;  2OCT A;  3CU3 A;  3GWR A;  5IER A;  2RCD A;  1K28 A;  4KVH A;  2OTJ 3;  2CKF B;  4HM3 B;  3G0K A;  3HZP A;  4LMI A;  3H3H A;  4WFO A;  2YFL B;  1WMN A;  4BTX A;  4BTW A;  2W6J H;  4RNY A;  2JQ5 A;  5JBS A;  1FGO A;  2B1X B;  5FCX A;  4HVN A;  3B7C A;  1KD1 4;  1ISK A;  3RDE A;  2BMO B;  3HIG A;  2GBX B;  4AEQ A;  2XSO B;  1RN7 A;  1ULJ B;  1G96 A;  1QAK A;  1AVL A;  4R4K A;  1UI7 A;  1NDO B;  1JB5 A;  1NJI 4;  1UW1 A;  4XB5 A;  3NUV A;  3ER7 A;  4H61 A;  4WWU C;  2XGN A;  4IT7 A;  1IVX A;  1A90 A;  3CD6 3;  3CCQ 3;  4N6T A;  2CFK A;  1NU3 A;  1FGR A;  3WMD A;  2IUK A;  1JJ2 2;  3FG3 A;  3GZR A;  3EB8 A;  4EV5 A;  5FGO A;  1AR0 A;  3JUP A;  1SJW A;  2WOF A;  3JUO A;  4PEJ A;  3SED A;  1VQ8 3;  3MPH A;  4K1U A;  3M8C A;  1R4C A;  1TP6 A;  1QVF 2;  2KRT A;  2FXT A;  2YFJ B;  1GY5 A;  1YJN 3;  2CFW A;  1EKM A;  2GXF A;  4XBY A;  1OH0 A;  4H3U A;  4LZI A;  4R9L A;  3CCE 3;  3WA3 A;  1ZO2 A;  3DUK A;  5CXO A;  2HMK B;  2K0M A;  1VQ7 3;  3PZW A;  2W2C A;  1JN5 A;  3F7S A;  1OGZ A;  1D6U A;  1QMA A;  1W2Z A;  3EBY A;  1EA2 A;  2BO9 B;  1DMQ A;  1O7H B;  4KZ1 A;  2W03 A;  2WOH A;  1E3R A;  1VQO 3;  3F14 A;  1N8R 4;  3WA2 X;  4ZM8 A;  4FR9 A;  5AEU B;  2PZV A;  3K0Z A;  3QRD A;  4WHA A;  1V74 A;  4WP5 A;  3NHX A;  3S67 A;  2P09 A;  3B4O A;  3X3Y A;  3K5T A;  1Z1S A;  3BNE A;  3FCS B;  1N5P A;  2ML5 A;  1NO3 A;  1IK3 A;  3EJV A;  1CQS A;  1J2B A;  4XBT A;  2L4V A;  3FF0 A;  4AKZ A;  1VQ6 3;  1U8C B;  1SII A;  2YFI B;  1AV4 A;  2W56 A;  3NQZ A;  3OV4 A;  2HML B;  1OHO A;  1DMM A;  3HII A;  3LOY A;  3EBT A;  3IJE B;  3PCR A;  1VZZ A;  1SQW A;  2C11 A;  3G8Z A;  4HM4 B;  4LGQ A;  4N6N B;  3CCS 3;  1N9E A;  3PCS A;  2ML6 A;  2W56 B;  3VF1 A;  4HM1 B;  2OOV C;  5D82 A;  3NV0 A;  4O2H A;  5CK6 A;  2YX9 A;  5EVH A;  2GU1 A;  3GRD A;  3UL6 A;  3NBB A;  2W0Q A;  3NQY A;  3LT9 A;  4OVM A;  3S5C A;  2O9U X;  1D6Z A;  1QAL A;  3EN1 B;  2XRX B;  3NV0 B;  3CC4 3;  3G6E 3;  1JKG B;  1QJG A;  4HM5 B;  3T8U A;  3FF2 A;  3G4S 3;  4RZM A;  3FG1 A;  1TFO A;  3EE1 A;  1A67 A;  3BND A;  2LYX A;  1ROA A;  3DMC A;  4O3V A;  2Z77 A;  3NBR A;  4K61 A;  1DMN A;  5AI1 A;  4BTY A;  5CF1 A;  5G2G A;  1TUH A;  1ULI B;  2RFR A;  1KWI A;  2PNC A;  4RBN A;  4XM4 A;  1GD4 A;  4HZB B;  5JPP A;  3CC7 3;  3KKG A;  1HKX A;  4TX4 A;  3V99 A;  3JUQ A;  1IQ8 A;  1E3V A;  1VQP 3;  5LC6 A;  1US1 A;  3X41 A;  2IA7 A;  3DGN A;  4EV2 A;  1PU4 A;  1FGT A;  2V1L A;  3U1W A;  1S72 3;  2I9W A;  4FMD A;  4QWT A;  1RKY A;  2Y74 A;  2Z7A A;  3LXU X;  1DYU A;  1NB3 I;  1IVW A;  5IF6 A;  2Q07 A;  1YI2 3;  1WTH A;  5AEW B;  2P0M A;  2CW9 A;  1IQX A;  1K8A 4;  2QGU A;  5AYS C;  4FCJ A;  1YJ9 3;  4LEH A;  4HJL B;  3SOY A;  4XBX A;  2CFL A;  1VQK 3;  5FCY A;  3IPT A;  4EYC A;  5DRE A;  3S29 A;  2CWV A;  2F98 A;  1K9M 4;  3KZT A;  1KSI A;  4MEI A;  2QEX 3;  5IG0 A;  3MKI A;  2D1W A;  1IV7 A;  2C10 A;  3MG1 A;  1FGQ A;  3ECF A;  3BNB A;  3DGM A;  2INX A;  3LTC A;  3O8Y A;  3ALA A;  3UNL A;  1Q40 A;  3WOD G;  2R4I A;  1T5Y A;  4N6U A;  7STD A;  1GYB A;  2CFD A;  4R1K A;  5DRV A;  1IT7 A;  1Q82 4;  2Z6B A;  3X3X A;  3X40 A;  2P38 A;  5JPU A;  2CC3 A;  5HGR A;  1YHQ 3;  8CHO A;  1K73 4;  2XSH B;  2MF7 A;  1STF I;  3CC2 3;  2SBL A;  4AKY A;  1W6C A;  1VQ5 3;  2GEY A;  4MMZ B;  3DM8 A;  2F86 B;  2Z76 A;  3MHE A;  1U5O A;  2IUJ A;  1L5G B;  1ROV A;  3K63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...