The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Protein binding
|
| molecule keywords |
Nuclear polyadenylated RNA-binding protein NAB2
|
| publication title |
Structure of the N-terminal Mlp1-binding domain of the Saccharomyces cerevisiae mRNA-binding protein, Nab2
pubmed doi rcsb |
| source organism |
Saccharomyces cerevisiae
|
| total genus |
30
|
| structure length |
105
|
| sequence length |
105
|
| ec nomenclature | |
| pdb deposition date | 2007-05-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11517 | Nab2 | Nuclear abundant poly(A) RNA-bind protein 2 (Nab2) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Endonuclease III; domain 1 | Endonuclease III; domain 1 |
#chains in the Genus database with same CATH superfamily 2V75 A; 3LCN A; 2JPS A; #chains in the Genus database with same CATH topology 1KG3 A; 4AIA A; 3OYI A; 4E7L A; 1LWY A; 3OYJ A; 3KTU A; 3CWS A; 4BE0 A; 1PU8 A; 3CWA A; 3L2V A; 4BE2 A; 4E7H A; 3F0Z A; 1P59 A; 1WEG A; 3CW7 A; 5FRM A; 1VRL A; 4EW4 A; 1M3H A; 4BDZ A; 4B23 A; 1KG2 A; 1ORN A; 4IKF A; 5FRO A; 2W04 A; 3IH7 A; 3OY9 A; 3L2U A; 4ZTJ A; 3F10 A; 1WEI A; 3KNT A; 1LWV A; 1LWW A; 3CVT A; 4UNF A; 1N3C A; 5KN9 A; 3OYD A; 1PVS A; 1MUD A; 4YOQ A; 3S3N A; 1HU0 A; 3OS0 A; 2V75 A; 1PU6 A; 3S3O A; 1YQL A; 1EBM A; 2YG9 A; 1RRS A; 4BDY A; 3OYE A; 3OS2 A; 2OFI A; 3OS1 A; 4B21 A; 3CWT A; 3OYL A; 2JPS A; 3OYN A; 4UOB A; 3D4V A; 3S6I A; 4B24 A; 2JHJ A; 4BE1 A; 3VW4 A; 1N3A A; 2XHI A; 2I5W A; 1KG5 A; 2NOZ A; 4EW0 A; 4YPR A; 3OH9 A; 3OGD A; 1KEA A; 4OFE A; 3OYH A; 4BAC A; 1MUY A; 5DPK A; 1MPG A; 3OYK A; 5AN4 A; 4E9E A; 4E9F A; 2YG8 A; 1DIZ A; 2OFK A; 4B22 A; 2NOB A; 3OH6 A; 3N5N X; 4EA4 A; 1NKU A; 1XQP A; 4E7I A; 2NOE A; 3OYM A; 4E9H A; 2NOH A; 1KG6 A; 3I0X A; 3NNQ A; 4EVV A; 4OFA A; 3OYC A; 4E7J A; 3OYG A; 3FSP A; 4YPH A; 1KO9 A; 5KN8 A; 3L2R A; 1YQM A; 4NZG A; 3FHF A; 1XG7 A; 4HSB A; 4DK9 A; 2ABK A; 4EJZ A; 4AI5 A; 3L2W A; 1P7M A; 1YQK A; 1LMZ A; 1YQR A; 3LCN A; 1ORP A; 3OYF A; 1KG4 A; 2JG6 A; 4E7K A; 1XQO A; 4E9G A; 3R2X C; 5CHZ A; 2NOL A; 4AI4 A; 1PU7 A; 4PII A; 3G0Q A; 2JHN A; 2NOF A; 1N39 A; 3N0U A; 1KQJ A; 4EJY A; 3CWU A; 1U84 A; 2NOI A; 2W03 A; 1RRQ A; 4EA5 A; 2H56 A; 1KG7 A; 1NGN A; 3IHO A; 3OYB A; 4OFH A; 3OYA A; 1MUN A; 3I0W A; 4ZTF A; 3S3M A; 5FRN A; 1FN7 A; 3CVS A; 1M3Q A; 1WEF A; 3L2Q A; 3FHG A; #chains in the Genus database with same CATH homology 3L2W A; 3OYI A; 4E7L A; 3OYJ A; 3OYD A; 3LCN A; 3S3N A; 4BE0 A; 3OYF A; 3OYH A; 3OS0 A; 2V75 A; 4BAC A; 3L2V A; 4BE2 A; 4E7K A; 3S3O A; 4E7H A; 3OYK A; 4BDY A; 3OYE A; 3OS2 A; 5FRM A; 3OS1 A; 4BDZ A; 4E7I A; 3OYM A; 4IKF A; 5FRO A; 3OYL A; 2JPS A; 2W04 A; 3OYN A; 3NNQ A; 3OY9 A; 3L2U A; 3OYC A; 2W03 A; 4E7J A; 4ZTJ A; 4BE1 A; 3OYG A; 3VW4 A; 3OYB A; 3OYA A; 4ZTF A; 5FRN A; 3L2R A; 3S3M A; 4NZG A; 3L2Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
