The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
8
|
sequence length |
77
|
structure length |
77
|
Chain Sequence |
QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Ribosomal protein
|
| molecule keywords |
50S ribosomal protein L28
|
| publication title |
Solution structure of 50S ribosomal protein L28 from Thermotoga maritima. Northeast Structural Genomics Consortium target VR97.
rcsb |
| source organism |
Thermotoga maritima msb8
|
| total genus |
8
|
| structure length |
77
|
| sequence length |
77
|
| ec nomenclature | |
| pdb deposition date | 2007-12-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00830 | Ribosomal_L28 | Ribosomal L28 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Ribosomal Protein L24e; Chain: T; | Ribosomal protein L28/L24 |
#chains in the Genus database with same CATH superfamily 5MLC Y; 5H1S Y; 4UY8 X; 2JZ6 A; 5DM6 U; 3J7Z X; #chains in the Genus database with same CATH topology 3CC7 U; 3CCJ U; 1NJI V; 1JJ2 T; 3CCE U; 5H1S Y; 1VQM U; 1YJ9 U; 5AN9 G; 2QEX U; 3ABO A; 1YIJ U; 2JZ6 A; 3I56 U; 1Q81 V; 1VQP U; 2QEZ A; 1Q86 V; 3CCU U; 3CCQ U; 5DM6 U; 1Q7Y V; 3G71 U; 3ANY A; 1VQK U; 2OTL U; 1KQS T; 1VQ6 U; 3G4S U; 1VQ9 U; 1YI2 U; 3J7Z X; 1N8R V; 3ABQ A; 1VQ7 U; 1VQL U; 1QVF T; 5MLC Y; 4UY8 X; 1KD1 V; 3CC4 U; 1KC8 V; 1YJN U; 1K73 V; 1S72 U; 3CXC T; 1YIT U; 3CCV U; 3G6E U; 3ABR A; 3CCL U; 1YHQ U; 3ABS A; 3CMA U; 1Q82 V; 3CME U; 3CC2 U; 2OTJ U; 3CCS U; 1K8A V; 1VQ5 U; 1VQN U; 1VQO U; 3CCM U; 3CCR U; 1M1K V; 1K9M V; 3CD6 U; 1QVG T; 1VQ8 U; 3AO0 A; 3OW2 T; 2QA4 U; 1M90 V; 1VQ4 U; 1JJD A; 3CPW T; 3I55 U; 1YJW U; 1W2B T; #chains in the Genus database with same CATH homology 5MLC Y; 5H1S Y; 4UY8 X; 2JZ6 A; 5DM6 U; 3J7Z X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
