The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
120
|
structure length |
114
|
Chain Sequence |
CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCKQIATGVSDTICEP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Cytokine/cytokine receptor
|
molecule keywords |
CD40 ligand
|
publication title |
Crystallographic and mutational analysis of the CD40-CD154 complex and its implications for receptor activation
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
14
|
structure length |
114
|
sequence length |
120
|
chains with identical sequence |
S, T, U
|
ec nomenclature | |
pdb deposition date | 2011-01-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
R | PF00020 | TNFR_c6 | TNFR/NGFR cysteine-rich region |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Tumor Necrosis Factor Receptor, subunit A; domain 2 | Tumor Necrosis Factor Receptor, subunit A, domain 2 | ||
Alpha Beta | Roll | Antimicrobial Peptide, Beta-defensin 2; Chain A | Antimicrobial Peptide, Beta-defensin 2; Chain A |
#chains in the Genus database with same CATH superfamily 5DMJ A; 2UWI A; 3THM F; 1SG1 X; 5IHL A; 1D0G R; 1FT4 A; 4BK5 A; 3IJ2 X; 2HEV R; 3BUK C; 1EXT A; 2X10 A; 3K51 B; 4J6G C; 3MHD D; 4GIQ R; 4MXW R; 3X3F A; 3MBW A; 2HEY R; 3QBQ B; 1ZA3 R; 1TNR R; 2AW2 B; 3U3V A; 4RSU D; 4BK4 A; 3QD6 R; 5CIR E; 3U3T A; 4M4R A; 3URF Z; 3ME4 A; 4FHQ A; 3ME2 R; 1NCF A; 3FL7 A; 4KGG C; 5L36 B; 3U3Q A; 1D4V A; 3TJE F; 3QO4 A; 3MI8 D; 1JMA B; 4OD2 S; 3ALQ R; 1DU3 A; 3WVT A; 4I9X C; 4YN0 A; 3U3S A; 5BNQ R; 3U3P A; 4KGQ C; 4E4D R; 2H9G R; 4N90 R; 4M4P A; 4MSV B; #chains in the Genus database with same CATH topology 5DMJ A; 2UWI A; 3THM F; 1SG1 X; 5IHL A; 1D0G R; 1FT4 A; 4BK5 A; 3IJ2 X; 2HEV R; 2E4X A; 3BUK C; 1EXT A; 2X10 A; 3K51 B; 4J6G C; 3MHD D; 4GIQ R; 4MXW R; 3X3F A; 3MBW A; 2HEY R; 3QBQ B; 4N90 R; 1ZA3 R; 1TNR R; 2AW2 B; 2LWL A; 3U3V A; 4RSU D; 4BK4 A; 3QD6 R; 5CIR E; 3U3T A; 4M4R A; 1FD3 A; 3URF Z; 2E4U A; 2QR6 A; 3ME4 A; 4FHQ A; 3ME2 R; 1NCF A; 3FL7 A; 4KGG C; 5L36 B; 3U3Q A; 1D4V A; 3TJE F; 3QO4 A; 3MI8 D; 1JMA B; 1FQQ A; 2LXO A; 4OD2 S; 3ALQ R; 1DU3 A; 3WVT A; 2E4W A; 2E4Y A; 4I9X C; 4YN0 A; 3U3S A; 5BNQ R; 3U3P A; 4KGQ C; 4E4D R; 2MJK A; 1KJ6 A; 2H9G R; 1FD4 A; 2E4V A; 4M4P A; 4MSV B; #chains in the Genus database with same CATH homology 5DMJ A; 2UWI A; 3THM F; 1SG1 X; 5IHL A; 1D0G R; 1FT4 A; 4BK5 A; 3IJ2 X; 2HEV R; 3BUK C; 1EXT A; 2X10 A; 3K51 B; 4J6G C; 3MHD D; 4GIQ R; 4MXW R; 3X3F A; 3MBW A; 2HEY R; 3QBQ B; 1ZA3 R; 1TNR R; 2AW2 B; 2LWL A; 3U3V A; 4RSU D; 4BK4 A; 3QD6 R; 5CIR E; 3U3T A; 4M4R A; 1FD3 A; 3URF Z; 3ME4 A; 4FHQ A; 3ME2 R; 1NCF A; 3FL7 A; 4KGG C; 5L36 B; 3U3Q A; 1D4V A; 3TJE F; 3QO4 A; 3MI8 D; 1JMA B; 1FQQ A; 2LXO A; 4OD2 S; 3ALQ R; 1DU3 A; 3WVT A; 4I9X C; 4YN0 A; 3U3S A; 5BNQ R; 3U3P A; 4KGQ C; 4E4D R; 2MJK A; 1KJ6 A; 2H9G R; 1FD4 A; 4N90 R; 4M4P A; 4MSV B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...