The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
150
|
structure length |
150
|
Chain Sequence |
LQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The three-dimensional structure of the nitrogen regulatory protein IIANtr from Escherichia coli.
pubmed doi rcsb |
| molecule tags |
Phosphotransferase system
|
| source organism |
Escherichia coli
|
| molecule keywords |
NITROGEN REGULATORY IIA PROTEIN
|
| total genus |
51
|
| structure length |
150
|
| sequence length |
150
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195, |
| pdb deposition date | 1998-02-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00359 | PTS_EIIA_2 | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the Genus database with same CATH superfamily 3LF6 A; 4M8Q C; 1XIZ A; 4KY9 A; 2OQT A; 2FEW A; 2A0J A; 1A3A A; 3BJV A; 3URR A; 1J6T A; 1HYN P; 4M62 S; 1A6J A; 3OXP A; 4GQX A; 4ODX X; 2OQ3 A; 3T43 A; #chains in the Genus database with same CATH topology 3LF6 A; 4M8Q C; 1XIZ A; 4KY9 A; 2OQT A; 2FEW A; 2A0J A; 1A3A A; 3BJV A; 3URR A; 1J6T A; 1HYN P; 4M62 S; 1A6J A; 3OXP A; 4GQX A; 4ODX X; 2OQ3 A; 3T43 A; #chains in the Genus database with same CATH homology 3LF6 A; 4M8Q C; 1XIZ A; 4KY9 A; 2OQT A; 2FEW A; 2A0J A; 1A3A A; 3BJV A; 3URR A; 1J6T A; 1HYN P; 4M62 S; 1A6J A; 3OXP A; 4GQX A; 4ODX X; 2OQ3 A; 3T43 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
