The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPQGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
molecule keywords |
PTS system mannitol-specific EIICBA component
|
publication title |
Solution Structure of a Post-transition State Analog of the Phosphotransfer Reaction between the A and B Cytoplasmic Domains of the Mannitol Transporter IIMannitol of the Escherichia coli Phosphotransferase System
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
39
|
structure length |
144
|
sequence length |
144
|
ec nomenclature |
ec
2.7.1.197: Protein-N(pi)-phosphohistidine--D-mannitol phosphotransferase. |
pdb deposition date | 2005-12-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00359 | PTS_EIIA_2 | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the Genus database with same CATH superfamily 1A6J A; 4M62 S; 1A3A A; 1XIZ A; 3T43 A; 2A0J A; 1HYN P; 2OQT A; 3BJV A; 4M8Q C; 3OXP A; 3LF6 A; 4ODX X; 4KY9 A; 3URR A; 2OQ3 A; 4GQX A; 1J6T A; 2FEW A; #chains in the Genus database with same CATH topology 1A6J A; 4M62 S; 1A3A A; 1XIZ A; 3T43 A; 2A0J A; 1HYN P; 2OQT A; 3BJV A; 4M8Q C; 3OXP A; 3LF6 A; 4ODX X; 4KY9 A; 3URR A; 2OQ3 A; 4GQX A; 1J6T A; 2FEW A; #chains in the Genus database with same CATH homology 1A6J A; 4M62 S; 1A3A A; 1XIZ A; 3T43 A; 2A0J A; 1HYN P; 2OQT A; 3BJV A; 4M8Q C; 3OXP A; 3LF6 A; 4ODX X; 4KY9 A; 3URR A; 2OQ3 A; 4GQX A; 1J6T A; 2FEW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...