The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
96
|
structure length |
96
|
Chain Sequence |
GFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Inhibition of a Ribosome Inactivating Ribonuclease: The Crystal Structure of the Cytotoxic Domain of Colicin E3 in Complex with its Immunity Protein
pubmed doi rcsb |
molecule tags |
Ribonuclease
|
source organism |
Escherichia coli
|
molecule keywords |
IMMUNITY PROTEIN
|
total genus |
21
|
structure length |
96
|
sequence length |
96
|
ec nomenclature | |
pdb deposition date | 2000-06-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF09000 | Cytotoxic | Cytotoxic |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Ribonuclease domain of colicin e3 (Residues 456-551) | Colicin E3-like ribonuclease domain |
#chains in the Genus database with same CATH superfamily 1E44 B; 1JCH A; 4UDM B; 2B5U A; #chains in the Genus database with same CATH topology 1E44 B; 2B5U A; 4NTQ A; 1JCH A; 4UDM B; #chains in the Genus database with same CATH homology 1E44 B; 1JCH A; 4UDM B; 2B5U A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...