2B5UA

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
470
structure length
470
Chain Sequence
SAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSCPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E3
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
total genus 142
structure length 470
sequence length 470
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b5uA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 2b5uA03
4UDMB 1JCHA 1E44B 1UJWB 2B5UA 2YSUB
chains in the Genus database with same CATH superfamily
1OCOC 2P4VA 2VWJA 4PJ0Z 2VQFO 4I7ZB 4JF3A 3ZN1A 1XQ8A 5J2TB 5FLXN 1N36O 4CH5A 1I94O 3SPCA 4X1IB 1O9HA 4A5UB 3OMNB 4PA3A 3ZHQA 5JQGB 5KUKA 1IBLB 4R6ZA 2QTOA 3CCJV 4O4IA 1ZLZA 4EFEA 1Q86W 1HW7A 1QQCA 4X65B 1RFYA 2VQEB 1AI4A 1H2KA 5BR8B 1JFFB 1TGOA 2YICA 1OHHG 1KUQA 1ZAUA 3WB1A 3CEIA 5CA3A 3OUSA 2C2AA 1H2NA 5LGNA 4DV5O 1I0HA 1SA0B 4MVOA 2B5UA 2XT9A 1PM9A 1TUEB 5LHIA 1GN3A 2AZ2A 1RSOB 4PELA 5E1AC 5JH7B 4CH4A 1PNMA 1L0NH 3HKBA 2P4KA 1N8RW 4U3FH 3CC7V 4DV7O 2UUCB 2XOKG 4XDLA 4BWAA 3CCVV 4DV1O 1LUWA 1ZTEA 2HJDA 4PDVA 2Z5UA 2YI9A 4MTOA 3N2GB 4ICGA 3WFVA 3SYPA 1GMGA 1SQGA 4GKKB 1NS1A 1Z5WA 1WB7A 2G38A 2IM9A 1R3LC 2FYUH 1HNXB 1LUVA 3KG2A 1R3IC 4FVMA 4RQEA 4LF5B 1S0VA 4JI3O 5LA6B 3RFRA 3L9DA 1EBOA 4MVMA 3B09A 3OMIB 1K97A 4Q6GA 3UCSC 1VQ8V 4I9WA 2LO1A 3JAWA 5A9GA 3KZIZ 4JI7O 3QG5A 1OCZB 4NYKA 2JS5A 3VBBA 5B1BB 2HVJC 3K79A 3UQ8A 4LFBB 4JI4B 2YIDA 5LP6C 1CEZA 5C8YA 3RYCA 1ZL8A 3FAVA 4BIUA 5DECA 5CBGA 3E8BA 5BXZA 2JJ2G 3BA9A 4MW3A 2UXNA 4P9OA 4DV4O 2UUBO 1VQ4V 1TVKA 2JIZG 3B40A 5KHKA 4DV0O 1T5EA 4K0KO 1V54B 1WNSA 3GB7C 1SETA 4DRXB 2AZ0A 3CRAA 2H8PC 1CXZB 2Y69B 5A2QN 4PI0A 5FPOA 2BSKA 1K73W 1OCOB 1BHBA 1TAEA 3FYEB 2QWQB 4Z2WA 3P32A 2X6BA 3KCYA 3K04A 1VF6A 5KMGB 4G28B 1XEQA 4L8JA 5ITZB 2YC0A 1NBMG 2XAGA 1FKAO 2QKAA 3D36C 3P3PA 1NQTA 3SJQC 3RYHA 1IZ3A 2R72A 5LYJB 4DR7O 4HNAA 2E76B 3A0HZ 3X2QC 1I5YA 2IH3C 1P84F 4NXMO 4LP8A 1K5QA 4H44B 5CN0A 4EB6B 4NVPA 2ZM6O 2ZDIC 4LF4O 5CB4B 5GTHZ 4XDJA 4TQDA 3OW2U 3ASNC 3DC6A 1N0JA 2WLMA 2DJVA 3VQVA 5IJ0A 3RVYA 2Q68A 3TK1A 4GKJO 4DXWA 1VQOV 5FNVA 3ZMVA 4X64O 4P2ZA 4N21A 1DK1A 3NR7A 1XNRB 3R66A 5EC2C 1XUQA 3QTCA 5LOVA 4PD4F 1HWYA 4X1YA 1LNQA 2HHHB 4MVRA 4GUNA 3G71V 2EIMC 4O4JB 3ETDA 2CE4A 3STLC 1BMFG 3CE2A 2RN9A 1MNGA 4EKWA 1GM9A 4ZIBA 4W4KA 1TUBB 1Y6XA 1QNMA 5LMNO 4N23A 1P49A 1Y67A 3HKCA 3MDSA 3K57A 3OT7A 1KECA 1QLEC 5LP6B 2BE3A 3U0ZA 3CRQA 1OJHA 1K4CC 5KHIA 2LGWA 3BCCH 1PL4A 4JI1B 1JQ0A 5H5NA 1QU7A 5LHGA 1V55B 3G4SV 1CP9A 1K9MW 3WU2Z 2AHYA 1VQ9V 2PY5A 2IJJA 3K3WA 2WSSG 2YIAA 1L8DA 1R6TA 3ABTA 5EK0A 1SQBH 1VP7A 4KXRA 4LNUB 3N2KA 2GV9A 2JDIG 4WBNB 2Y4TA 5JVDB 1GH6A 3D3IA 3FB7C 3EHBB 1FFXA 1U97A 2HJFC 1BQZA 4J9ZB 3F7VC 4J7ZA 2L35A 2IJKA 3CSXA 2F23A 3TXQA 2UU9B 1ROPA 1US6A 1BSMA 1I08A 3CXHF 4ZHQB 3F5WC 4WCEV 3ABUA 4JZGA 1IXBA 3L75H 1AVMA 5J2UB 2XAHA 1HNWB 3ZHSA 4PV1B 2PF4E 3B77A 1Y76A 1QBZA 2WLKA 2ZCEA 3BABA 5DM6V 3JCZA 1DLBA 2DOSA 2KG7A 3E22A 5K1XA 3JAMN 1IDSA 2DMXA 1VEWA 4ABMA 2QWOB 2LQTA 3CHXA 4Z1MG 4LBEC 3ASNB 3K5LA 1JVMA 5IE9A 5TISZ 1J95A 2ADPA 4X20B 2OTJV 5BY1A 1AILA 1IBKB 1SERA 1NTKH 4OX9O 1QR8A 4IYHA 1AROP 3B8MA 3JATB 2Q8VA 4DR4B 3LDDA 1S77D 4RWUA 3MHSC 4P9PA 2E74B 4H33A 4E4EA 3ZMUA 4YY3O 3HR0A 1AR1B 2GTAA 5FL7G 1P7GA 2YXLA 4JYCA 3T1HO 4YHHB 2F1MA 2YEVB 4X1IA 4CZZA 1N32B 5JCOC 5H6QA 3JYCA 3KCXA 4PA6A 5KAFZ 2JGUA 1JOYA 3C90A 4B3MO 4U7OA 4HYOA 2FL4A 5IT9N 2H3OA 1UPGA 1Y74B 3TETA 2YUAA 4BW5A 2GBOA 2EZPA 2HEPA 3JALA 4G27B 4XBFA 1QLEB 1I94B 4GZRB 2OT5A 1G1XB 2K9PA 2IU0A 4B7KA 4B08A 1B6QA 2M6YA 4TV8A 3W7SA 1MA1A 1RSOA 4U3JB 5JH7A 4IHJB 2X6AA 3G80A 4J7JA 3H1HH 4MS2A 2DYSC 2ZQMA 5B66Z 4F6RA 1Y4MA 2Q69A 2RJZA 2CDYA 2WA3A 1RPOA 4DV5B 4LF7O 1H38A 2QJ1A 4YIPA 2L6LA 2WLHA 5CBFA 2CGNA 3UM7A 1QVGU 1WA8A 3W7WA 2UXCO 2YIBD 1FXVA 2RMKB 4TOIA 5IYBO 4DV7B 3BFRA 4GYCB 4FLXA 3K0GA 3WG7C 3CMAV 4P30A 4X89A 5LA6A 2R9AA 3B4SA 4YJ3B 4DV1B 3RYIA 3FKSG 2XASA 1VQKV 3QF7A 1YTFB 3JCUZ 1H8HG 1HR0O 1K7DA 3SPJA 4FLUA 1FXKC 1NVPD 3JARA 2MK3A 3ZJZA 2VRZA 2D3OW 1AJPA 4IIJB 1GN6A 2QGNA 2ZXWB 5EZYB 2JEUA 1Q6UA 2OWOA 4JZ2A 4MTFA 4LFCO 2EBOA 4J41A 3ZHUA 3CCSV 4LF8O 4RQFA 2E75B 3JD1A 1BE3H 4AILC 1QHTA 3QO5A 2Y0PA 4DR3O 1VF7A 3ZRWA 4R50A 4JI7B 3ML0A 3JD2A 1F51A 2XAJA 4PHZA 3QNEA 2V4DA 5KX5B 3AK1A 4QPJA 1PL0A 1H8EG 5C93A 5CA1B 1MSDA 2P5OA 5JWPA 1VQ6V 2UUBB 5ITZA 1Q6IA 4GX5A 3HPLC 4FZ0A 2EX3A 3ABKC 4DV0B 4JI5O 1NJIW 1WB8A 4I4TB 4UVAA 2R70A 4DUYO 2HFEC 4X1KA 3CYOA 3ETEA 3UO2A 4C7UA 1NI8A 1ZUQA 5J9PC 4UB6Z 4LWSB 1NVPB 2LFRA 3ETGA 1PP9H 2KSDA 4EB6A 1XNQO 4E2LA 4DV3O 1HNZO 4JI6O 3OD4A 2Q0OC 4JYAO 2NLJC 2ZE5A 1FPOA 3JAKB 1IXMA 4NKGB 5GTIZ 3E8GA 1S3JA 5LBQA 2DYSB 2JK5C 2CTWA 4DR7B 3EXAA 3CCRV 2O57A 2HP8A 3E2EA 2QSAA 1XMQB 2UXBO 4NXMB 5L3GA 5CA0A 2LW7A 4YJ2B 2RQ6A 4FIPC 2DW4A 4LF4B 2QM8A 3UT5B 3CCEV 5H6RA 2ZINA 4JAVA 5EC1C 1OV9A 3L70H 2P7TC 1B06A 3FB8C 1RP3B 2Q7EA 3OGIB 4TV9A 5KA5A 3BAAA 3WG7B 4UVCA 3CCUV 4GKJB 4O4JA 1G4YB 2Y48A 1F4NA 3CRMA 4FJCC 1YI2V 4B3TO 4CS3A 2WLIA 3IGAC 2H94A 1H2LA 3SYOA 3AG7A 1E1RG 5EYPA 2BCCH 1YJ9V 1WP8A 4DV6O 2LFSA 2UXDO 4JYBA 2WPDG 4LF9O 2F66C 1K8AW 5LP6A 3AG4C 4BAYA 2JVDA 1Q6HA 4MVQA 4ZOLA 1RPRA 3LNMB 4JI0O 5LMUO 3B8NA 1MZFA 4DYLA 1YCIA 3H1KH 1PNKA 1DTOA 1HP8A 5B1NA 3SYAA 5K1PA 1GTOA 4Q20A 5LHHA 1MZEA 4CC5A 2WAMA 2B1GA 5KHJA 4QE9A 2ZIMA 4I0XB 3MD0A 2F95B 1NTZH 4WBNA 2AGAA 1WP7A 2P6JA 2HR3A 4YIOA 5IDJA 1HDJA 4CC6A 4UCVA 4O4LB 2BOCC 2Y0IA 4K3AA 3ABKB 1DF5A 3E83A 2WLLA 3D36A 4ZHQA 4JAAA 4O2AA 5L3CA 1KB9F 4KFMA 3PN1A 1SQPH 1VF5B 4DR5O 1XHZA 4I55A 2EJRA 4OPAA 3HKEB 3D8CA 4DUZO 2Z0AA 3JASB 3E89A 3OGCC 2M7WA 1YITV 4ZI7B 2CTPA 4PDRA 3QVNA 3CJHA 2ZKOA 1E1QG 1SKVA 3EFFK 2DWDC 2GUZA 3Q4HB 2Z3YA 4MT8A 4NTXA 4NTYA 4GX2A 1VQPV 4X20A 4JV5O 3RN4A 4WFHA 3A0RA 4IL6Z 3JATA 2Y4UA 2HVKC 3ICXA 4JI8O 2AHZA 4D7SA 1OCRC 1JR9A 5IYZA 5KAIZ 1YHQV 3WB0A 1VF6C 1AJQA 3SDLA 4FZ1A 4XDKA 3VQWA 5GONB 3STZC 3ZMSA 3ZEDA 4ZKIA 1W2BU 3GWKC 2W0XA 3LNNA 1XOUA 3OUFA 5JJNB 3ABLC 3C3SA 4FFBB 4LFAO 4FLWA 2A7WA 3BHPA 2ATKC 5BZBA 4RUEA 5AG2A 4FM2A 1YEWA 1VARA 1S5HC 1VIBA 1XREA 2MW2B 1RM1C 5IJ9B 1NU1H 3EVKA 1IBMO 5CBHA 2ITCC 3N27A 2CH7A 4YY3B 3OE7G 3OEEG 3SPHA 4F6EA 4LCUC 4GKKO 1QVFU 2P67A 4GT1A 1R73A 3AG4B 2AXTZ 1NH2D 4MSWC 1SQQH 2YXYA 3LDEA 5KLVH 1GN2A 4WFEA 2JEXA 3OMAB 5L3FA 4LC1A 4PDMA 4B3RO 4B3MB 5F2VO 2K1EA 5IYCO 2X0LA 2QWRB 1AP6A 2ZE7A 1KMIZ 1W0JG 3AK2A 4J9YB 1B04A 2QA4V 1WJZA 2PI4A 3ZN0A 3QO8A 2WA4A 4K35A 1Q82W 3A8TA 4UV9A 3H1LH 3SYCA 1SQXH 1GK9A 1MG1A 2A3QA 3AG3C 1K3EA 3L74H 3CCMV 1EN6A 4QNHB 3LSQA 5DEDA 5L3DA 4FLTA 1F23A 2HKOA 3J7AU 5B3SC 1BGYH 1M57C 3CPWU 2CGOA 4QE7A 3W7UA 4LF7B 1FJGO 1K4DC 4I50B 3T2MA 3M8AA 4TUYB 3ABMC 3FAVB 3JD3A 1ENVA 1QR9A 4JASA 5EZYA 3CCLV 2Q9LA 2F4VO 4HZ3A 4MW8A 4KUMA 1SZXA 3K5NA 1KU9A 3DSQA 2QEXV 4PA9A 3U11A 1N34B 4ZBMA 2YS8A 3OTOO 1KBHA 5H9CA 4OGQB 3X2QB 5L3BA 4JYYA 1AP5A 4X66O 2FKXA 2UUAO 1OCRB 5HFMA 2OYQA 2P90A 3G67A 2OIEA 3HKDA 1BCCH 3BRCA 4KP4A 5KX5A 3JD0A 2GSMB 1K34A 5CA1A 1H2SB 2LW1A 3CXCU 1AR5A 2N74A 4MVZA 1M56C 4UV8A 4WFGA 4X9QA 4YXWG 3ABLB 4DR3B 1YJWV 3CX5F 2F93B 4I4TA 2OCCC 3ZIAG 4FLYA 2EZOA 1I5XA 1SQFA 4HNAB 1RM1B 3DTUB 5J2TA 1S72V 4DR6O 1YVWA 1FYJA 2DYRC 1DGSA 3M7MX 2ZE8A 5JQGA 2EIMB 4B7EA 4LWSA 1SRYA 4PA4A 4JI2O 3APQA 3H01A 1KP3A 3LDCA 2HHHO 3B2EE 4JI5B 4O2BB 3K06A 5IJ0B 4UCOA 2A9HA 2CAZC 3E8HA 1J5EO 3FYIB 5IWAO 2VQFB 2N05A 1JFFA 5FNVB 3CRCA 2JJ1G 1VQ7V 1N36B 2ZR2A 3ZMZA 1YDXA 1XI1A 1SA0A 2FMLA 4UCRA 1G6UA 4JTCB 3TJTA 3E86A 3ETQA 4I9QA 4JI6B 4JYAB 4JI1O 2NN4A 3P30A 2W6JG 4X62O 3N2GA 3CD6V 4DR1O 5B3SB 1F4MA 1M57B 2UXBB 1XL4A 3HKCB 4LF6O 5KHGA 4PA7A 1AI6A 3BEHA 3ABMB 1NT2B 3IFXA 1P7BA 2AW9A 3BA8A 4CS2A 4UUJC 2ZR3A 2EILC 2A0LA 4FM0A 4O4HB 2QM4A 2KKWA 2UU9O 5KUMA 1ZX3A 1N33O 3A0BZ 4LH7A 2KB1A 4RO2A 1XMOO 1D5NA 2IH1C 5EBWC 4DR2O 2NR5A 3RYFB 5LGTA 2FB5A 2Q7GA 5EBLC 3JSNA 5BMVB 2HLDG 3I55V 3K5MA 2GTSA 4DV6B 3TGUH 3SPIA 2UXDB 4TSFG 1M1KW 4NXNO 4LF9B 4JI3B 2W0FC 1NTMH 1O9GA 1W0KG 1JJ2U 2JGDB 3WB2A 4JI0B 5LMUB 2N04A 1M56B 3OFNG 3OR6C 1R3JC 1JCHA 1MABG 3K08A 4EEQA 5LL6Y 4FPPA 4DRXA 3RT3C 3K03A 2OCCB 2KQXA 2A79B 4W4LA 1WLEA 1R6NA 2DE0X 2KG7B 5B1BC 3HKEA 5KMGA 1M9NA 3FX7A 3JASA 2DYRB 4DV4B 4ZI7A 3I56V 3DXRB 4K0KB 2OIGA 2Q5ZA 1GRJA 1PPJH 4YHHO 1H2MA 5B1AC 4L87A 3CMEV 1N32O 3GVMA 4WF9V 3ZMTA 4FLVA 5LYJA 3P3NA 1SZTA 2F43G 4DO2A 3K5OA 5H2FZ 1KP2A 2Y69C 1F7YA 2CTRA 1S5JA 1QCEA 2XTAA 4QGPA 5CB4A 3H1IH 3SJCC 5JJEB 2B9ZA 5GONA 4FK5C 1M93A 5E79Z 1EM1A 1AI7A 1BZKA 3KKYA 3NXSA 2RNBA 2Q0AA 4JV5B 4FFBA 1XILA 1GO3F 2ETNA 1Q90D 5EIBC 3MAQA 1AJNA 4JI8B 1N0NA 2ZM6B 2YI8A 1R3KC 5IJ9A 1U96A 3JALB 3TXSA 2UXXA 2XUMA 4KHPO 3MHHC 2IW5A 3OTFA 1BT8A 2DWEC 4TWKA 3SPGA 2DN9A 4TV8B 2EILB 2EULA 1VQ5V 4NR1A 4X64B 3CB2A 1FXHA 4DW1A 4LFAB 5D5PA 1VQNV 1XBLA 1NR1A 3K0DA 3ZBHA 1R1BA 1TUBA 4DK0A 3ZHTA 1FXKB 1SC5B 1VMGA 2IBZH 4JAUA 4AHCA 4B3SO 4F6RB 2EIKC 1IBMB 2ITDC 1M90W 3ZX6A 4MVSA 4GX0A 2WLNA 3ZS8C 1THZA 5LGUA 2LJ2A 2Q6AA 4J11A 1WA8B 2ILMA 3U10A 4U7NA 3IJ4A 4GX1A 5EIBD 4NTQA 1AR4A 2XNDG 4B3RB 5LMNB 3RYIB 5IY5C 4DW0A 1KKCA 4FMTA 2E5LO 4LNUA 4H13B 5JVDA 5GW7A 3JARB 2WWWA 4BR6A 2FTKA 4D7TA 4AQYO 2YSUB 3VQYA 1EZJA 2QKSA 4Z1VA 4I50A 1IVSA 4TUYA 1Z5VA 2BTQB 4DV2O 3G6EV 4NTWA 3ZCCA 2YDEA 2EJ7A 3T1YO 5B1AB 1YXBA 5J2UA 3IC7A 1V55C 2Q73A 4D6TH 3QO7A 1FS0G 3ZRWB 4ASUG 1G8MA 4EFBA 3OAAG 1KKDA 1KC8W 3C3TA 4H0LB 1PV0A 3S3XA 1WPXA 4FM1A 2HG5C 1FJGB 5KHHA 1D5AA 2ZDIA 4BW9A 4QJFB 2ARHA 3CC4V 1IBLO 2F4VB 3ZRSA 3T4DA 3E35A 3THOA 5LXTB 1MSWD 4X65O 3OTOB 2EIJC 1Y66A 2VQEO 1WN7A 5BR8O 3AG1C 4X1KB 4JGSA 2Q4PA 2B1IA 2QR4A 4X66B 3JSLA 4UCSA 4CH6A 2UUAB 4JTAB 2ZIOA 3DGEA 4LH6A 3K9SA 4UXNA 3ASOC 2EINC 2QDOA 1XMQO 2YEVA 2QWPB 4O4IB 2ZNIA 4FLZA 5FPRA 4OX9B 1BL8A 2QE7G 3F7YC 2UUCO 1E79G 1IX9A 1ZSPA 4O2BA 5D5QA 1V9PA 2P06A 1Y74A 1IURA 1PD3A 3HB3B 2EIKB 2JS3A 3T1HB 2PZSA 2XAQA 1S5LZ 4DR6B 3VOUA 1EFRG 1BHAA 1Q7YW 5CA0B 4J7KA 1PKXA 2VWKA 1HNXO 3HKBB 1H2GA 1SESA 1GKFA 2V7QG 1Q8IA 2LGQA 3OR7C 1JPXA 3T1CA 2W6IG 4JI2B 5B5EZ 4U3JA 4UCUA 4LF5O 4IHJA 1FFTB 1NKDA 4TV9B 1PNLA 4PDLA 1GAXA 2VS0A 2XHBA 2ZD9A 1YSCA 3L72H 4G2KA 1J5EB 5IWAB 2BOBC 1NZ6A 3K59A 3OM3B 3BPZA 4HBNA 4TT3G 5IY5B 4DK1A 1OCCC 1D2DA 2WLIB 4UDMB 4LFBO 4JI4O 1YIJV 2R9IA 3AEIA 4I5SA 2NNUA 1XL6A 3RWRD 4WFBV 5EYPB 4HAMA 1K33A 1EZVH 3CWBH 5JJJB 1P4RA 1JJOA 5EBMC 4ZOLB 3TCUA 2QTSA 4K8XA 5CMUA 4WFAV 4J42A 3JAWB 4YJ3A 2DQ0A 2LP7A 3H9VA 4O4HA 2ZNJA 4X62B 2PTMA 4MTXA 2D2CB 4DR1B 1KYOF 4K8ZA 3BVOA 5C8YB 3RYCB 1ZL8B 4LF6B 4IIJA 1VQMV 1B3QA 1SF9A 4QIWF 2V1DA 3RYFA 2UXCB 4OPHA 2ADQB 1M5IA 5BMVA 1EN4A 1TVKB 5KA6A 1S76D 2QM7A 4IYIA 2QWNB 3FD9A 3CC2V 1NH2B 2JGDA 1UJWB 4GCZA 1HR0B 2WLLB 4O2AB 1N33B 2BSKB 1I7FA 2EIJB 2JRIA 1XMOB 1GN4A 2PGGA 4QPKA 4DR2B 3AG1B 4I55B 1K92A 3UO3A 2PYLA 4IGGA 2OCHA 3LUTB 2X6CA 4LFCB 4JTDB 3ASOB 2EINB 3CJHB 3CP1A 4NXNB 1K5SA 4LF8B 5JCOA 3E8FA 2ZE6A 2ZXWC 2GUZB 3AG2C 4R8CA 1OZ0A 3DXRA 3L71H 1KD1W 3RYHB 1YF2A 2YIBA 2P22C 1JMKC 1WPBA 1TA8A 1EN5A 1XHXA 3LSSA 1COWG 1XNRO 2ODMA 3CCQV 4X8AA 5IYZB 2RCVA 4F4LA 2Q67A 2RDCA 2PI5A 3DC5A 3FFQA 3JD4A 3G6BA 3T4ZA 1KQSU 3S3WA 2QKCA 1BQ0A 4UVBA 4DUYB 2IJHA 1SS3A 3ZRVA 3JAKA 1YTFD 3F5TA 3FB6C 1JA8A 3APOA 4MTGA 4R7CA 1A32A 1OCCB 4NB5A 5LOVB 1E44B 2Q7HA 2CH7B 4X1YB 1XNQB 4YJ2A 4DV3B 1HNZB 3UT5A 2PUSA 4CH3A 3SGIA 2XAFA 3FB5C 4CS4A 1N4CA 3AG3B 4LR3A 1R6KA 1UFIA 4H37A 1MMMA 3I5DA 2CK3G 1M4UA 2GDSA 3CS5A 4CBCA 1FXKA 5B1OA 2OTLV 3SR2C 4X88A 2IJIA 1VQLV 4RUFA 4OXSA 4KHPB 1ZWIC 1YJNV 2BTOA 1Q3EA 1FAFA 1JX9A 3IAYA 1NR7A 2CTQA 1FD9A 4IT5A 4WFFA 3O9OA 3GWOA 1URFA 4AI8A 4B3TB 2CUGA 1W59A 1XDCA 4KL1A 3VQXA 2X7RB 3AK3A 3N2KB 1HNWO 3O65A 2R9RB 2A06H 1AB3A 1X59A 1N34O 4B3SB 1CPYA 4FFKA 4UB8Z 1FFXB 4I0XA 3OEHG 4TQFA 3ZRXA 4J10A 3BY6A 4UCTA 3J81N 3K9AA 3UKMA 3PJSK 2YXHA 3LSUA 1Q81W 3SJBC 4MVUA 2E3CA 2ZT9B 4O4LA 3SJAC 3AG2B 3CRRA 5L3EA 3IC9A 3RW0A 2BTQA 3RGBA 1WAZA 4PI2A 3D3QA 5IYDO 1Z2GA 2PYJA 1IBKO 2IU3A 3W7TA 3R65A 1Y76B 1Q5OA 4J80A 1OCZC 2WLJA 1BS3A 2E5LB 3E22B 4DR4O 4BIOA 1AI5A 3L73H 3SYQA 3H1JH 1GM8A 2DQ3A 1MOFA 4BIZA 4AQYB 1DF4A 3HKDB 2GHYA 1LR1A 1GM7A 3J80N 4UFZA 1L0LH 1ORQC 3Q4HA 3RVZA 1Q43A 4DV2B 1X4TA 1L1FA 3ZHVA 4JPRA 3T1YB 1QLNA 1V54C 1YZBA 1SQVH 4DR5B 3RBZA 3W7XA 4GLXA 4RAIA 3A2FA 3K58A 5DN6G 4DUZB 3M99B 3ZHRA 5LXTA 5HFLA
chains in the Genus database with same CATH topology
3IC7A 1OCOC 4UV9A 1V55C 3QO7A 2OT5A 1FS0G 3SYCA 4JF3A 1GK9A 3ZRWB 3ZN1A 2IU0A 4ASUG 1G8MA 1MG1A 1B6QA 3OAAG 3AG3C 1K3EA 3SPCA 3CCMV 3W7SA 1KKDA 3OMNB 1KC8W 4PA3A 4QNHB 2X6AA 3LSQA 5KUKA 1WPXA 5L3DA 1F23A 2HG5C 2HKOA 4MS2A 4R6ZA 5B3SC 2DYSC 2QTOA 2ZDIA 3CCJV 1M57C 4QJFB 2ZQMA 3CPWU 1Q86W 3CC4V 4QE7A 3W7UA 1Y4MA 1K4DC 3ZRSA 3T2MA 2Q69A 3ABMC 3JD3A 1ENVA 1AI4A 1QR9A 1RPOA 4JASA 3E35A 3T4DA 3CCLV 1MSWD 1OHHG 4HZ3A 1H38A 4MW8A 4KUMA 2WLHA 2EIJC 2QEXV 5CBFA 1Y66A 5CA3A 3UM7A 1QVGU 4PA9A 3OUSA 3AG1C 3W7WA 2C2AA 5LGNA 4JGSA 4MVOA 4ZBMA 2B5UA 2B1IA 1FXVA 1TUEB 5IYBO 5H9CA 5LHIA 3K0GA 4PELA 3WG7C 4JTAB 5E1AC 3X2QB 5L3BA 3DGEA 4P30A 1PNMA 3CMAV 4X89A 4UXNA 3ASOC 2EINC 1N8RW 3FKSG 2XASA 1VQKV 1YTFB 3CC7V 2YEVA 1OCRB 1H8HG 5HFMA 2P90A 2XOKG 4XDLA 4KP4A 3CCVV 1K7DA 1BL8A 3SPJA 1FXKC 1NVPD 2QE7G 2Z5UA 3JD0A 2MK3A 4MTOA 4PDVA 3F7YC 2GSMB 3ZJZA 1K34A 1E79G 2D3OW 1AJPA 3WFVA 3CXCU 3SYPA 4MVZA 2ZXWB 1M56C 2JEUA 1GMGA 4UV8A 4WFGA 4YXWG 4MTFA 3ABLB 2EBOA 1R3LC 1YJWV 1PD3A 3HB3B 3CCSV 2EIKB 2XAQA 2OCCC 3VOUA 3ZIAG 4RQFA 3KG2A 3JD1A 1EFRG 1R3IC 1I5XA 2EZOA 4RQEA 3QO5A 1BHAA 1Q7YW 1S0VA 1RM1B 1PKXA 3DTUB 3ZRWA 1S72V 1H2GA 1EBOA 1SESA 1GKFA 2V7QG 3ML0A 4MVMA 3OMIB 4R50A 3OR7C 1JPXA 1K97A 3JD2A 1F51A 2W6IG 2XAJA 3T1CA 2DYRC 1VQ8V 4I9WA 1FFTB 1NKDA 3QNEA 2EIMB 1PNLA 1OCZB 4PDLA 1SRYA 4PA4A 2ZD9A 3VBBA 5B1BB 1YSCA 4QPJA 4G2KA 1PL0A 2HVJC 1H8EG 3H01A 1KP3A 3K79A 5C93A 2BOBC 3LDCA 3OM3B 4TT3G 5IY5B 3K06A 1CEZA 1OCCC 2A9HA 1VQ6V 3E8HA 2WLIB 3FYIB 4GX5A 4BIUA 4UDMB 3HPLC 1YIJV 2R9IA 3ABKC 5CBGA 3E8BA 2JJ2G 3AEIA 2NNUA 1XL6A 4I5SA 2JJ1G 4WFBV 4MW3A 1VQ7V 2UXNA 4HAMA 1K33A 4UVAA 4P9OA 2ZR2A 3ZMZA 2HFEC 1VQ4V 2JIZG 3CYOA 1V54B 3ETEA 1P4RA 5EBMC 3GB7C 4JTCB 3TCUA 1SETA 5J9PC 5CMUA 3E86A 4WFAV 2H8PC 2Y69B 2DQ0A 2LP7A 1K73W 1OCOB 1BHBA 4MTXA 3FYEB 3P32A 2X6BA 1NVPB 2LFRA 3ETGA 3K04A 3P30A 4E2LA 2W6JG 4G28B 3CD6V 2NLJC 1VQMV 1NBMG 1IXMA 2XAGA 2V1DA 4QIWF 3E8GA 5B3SB 1S3JA 5LBQA 2DYSB 2JK5C 1F4MA 1M57B 1XL4A 3CCRV 5KA6A 1NQTA 2QM7A 3SJQC 1S76D 4PA7A 3CC2V 3E2EA 1AI6A 3BEHA 1NH2B 3ABMB 3IFXA 1P7BA 5L3GA 1UJWB 4GCZA 4UUJC 2WLLB 2ZR3A 1NJIW 4FIPC 2DW4A 2EILC 2A0LA 2QM8A 3X2QC 2EIJB 1I5YA 2IH3C 3CCEV 5H6RA 4JAVA 5EC1C 4QPKA 3AG1B 4LP8A 1K5QA 5CN0A 2P7TC 5KUMA 3FB8C 2ZDIC 1K92A 2KB1A 5KA5A 4RO2A 3LUTB 4XDJA 4UVCA 2X6CA 3WG7B 3CCUV 1G4YB 2Y48A 2IH1C 3ASNC 5EBWC 3OW2U 2WLMA 4JTDB 3ASOB 1F4NA 2EINB 3CP1A 1K5SA 4FJCC 5LGTA 5EBLC 1YI2V 2HLDG 3I55V 3RVYA 2Q68A 2WLIA 2ZXWC 3E8FA 2H94A 3IGAC 3TK1A 3SPIA 3AG2C 4TSFG 1M1KW 4R8CA 1OZ0A 4DXWA 1VQOV 3ZMVA 2W0FC 1KD1W 3SYOA 1E1RG 1W0KG 4P2ZA 1YJ9V 4N21A 2LFSA 1JJ2U 4JYBA 2WPDG 1M56B 3OFNG 3OR6C 1K8AW 1R3JC 1JCHA 5EC2C 3AG4C 4BAYA 4MVQA 1MABG 3K08A 3LSSA 1COWG 1RPRA 3LNMB 4FPPA 1HWYA 3B8NA 3CCQV 1LNQA 3K03A 4X8AA 2OCCB 4MVRA 4F4LA 2A79B 2Q67A 3G71V 2PI5A 1WLEA 2EIMC 1PNKA 3ETDA 1DTOA 1R6NA 3JD4A 5B1NA 3SYAA 5B1BC 3T4ZA 1M9NA 1GTOA 3STLC 1BMFG 4Q20A 5LHHA 1KQSU 2WAMA 2DYRB 2B1GA 4QE9A 4UVBA 4EKWA 1GM9A 3I56V 2IJHA 3MD0A 3ZRVA 1YTFD 4N23A 3FB6C 2P6JA 4XBFA 5B1AC 2HR3A 4L87A 5IDJA 1KECA 1QLEC 3CMEV 4MTGA 4R7CA 4WF9V 1OCCB 3ZMTA 2BOCC 1K4CC 1SZTA 2F43G 4DO2A 1E44B 3ABKB 1DF5A 3E83A 2WLLA 3D36A 1JQ0A 5L3CA 1KP2A 4KFMA 2Y69C 5LHGA 1V55B 3G4SV 1CP9A 2XAFA 1K9MW 3FB5C 2AHYA 1VQ9V 2EJRA 2IJJA 1QCEA 3K3WA 2WSSG 3AG3B 3E89A 3OGCC 2M7WA 1YITV 3ABTA 1R6KA 4PDRA 5EK0A 4H37A 4FK5C 2JDIG 1AI7A 1E1QG 3D3IA 3FB7C 3EFFK 3EHBB 2DWDC 2CK3G 3NXSA 2HJFC 4CBCA 2Z3YA 4J9ZB 4MT8A 1FXKA 3F7VC 5B1OA 2OTLV 4X88A 2IJIA 4GX2A 1VQPV 2IJKA 1GO3F 1VQLV 4RUFA 1AJNA 1ROPA 4OXSA 3F5WC 4WCEV 3ABUA 4WFHA 1ZWIC 1R3KC 1YJNV 3A0RA 2UXXA 2HVKC 2XAHA 1JX9A 2AHZA 1NR7A 1OCRC 3MHHC 4WFFA 2IW5A 3GWOA 1YHQV 1AJQA 3B77A 2DWEC 1QBZA 2WLKA 4TWKA 5DM6V 3JCZA 1DLBA 3SPGA 4XDKA 2EILB 3STZC 2X7RB 3ZMSA 4ZKIA 2R9RB 1W2BU 1VQ5V 1CPYA 1FXHA 1VQNV 1NR1A 3OEHG 3K0DA 3ZRXA 1FXKB 3OUFA 3BY6A 3ABLC 4JAUA 4Z1MG 3K9AA 3UKMA 4LBEC 2EIKC 3ASNB 3PJSK 1JVMA 2ATKC 1J95A 5BZBA 4RUEA 1Q81W 2OTJV 2ITDC 4MVUA 1M90W 1SERA 4MVSA 1S5HC 1QR8A 4GX0A 2WLNA 1AROP 1RM1C 1THZA 3AG2B 3B8MA 5LGUA 5L3EA 5CBHA 2ITCC 3RW0A 2Q6AA 3OE7G 5IYDO 3OEEG 3SPHA 3LDDA 1S77D 2IU3A 3MHSC 4P9PA 4U7NA 3W7TA 3R65A 4LCUC 1QVFU 4GX1A 1OCZC 4H33A 2WLJA 2P67A 4GT1A 3ZMUA 1AR1B 1R73A 3AG4B 2XNDG 1AI5A 1NH2D 5FL7G 4MSWC 4JYCA 3LDEA 3SYQA 5IY5C 4WFEA 2JEXA 1GM8A 2DQ3A 3OMAB 2YEVB 1MOFA 4FMTA 4CZZA 5L3FA 4BIZA 5H6QA 4LC1A 1DF4A 4PDMA 2GHYA 3JYCA 1GM7A 5GW7A 4PA6A 2K1EA 1ORQC 2WWWA 5IYCO 2X0LA 3RVZA 1JOYA 2FTKA 2YSUB 1EZJA 4U7OA 1L1FA 4HYOA 2QKSA 1W0JG 4JPRA 4J9YB 1QLNA 1V54C 3TETA 4BW5A 3RBZA 3W7XA 2QA4V 2PI4A 3ZN0A 3G6EV 3QO8A 4RAIA 1Q82W 2EZPA 5DN6G 3ZCCA 3M99B 5B1AB 4G27B 5HFLA 1QLEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDM B;  1JCH A;  1E44 B;  1UJW B;  2B5U A;  2YSU B; 
#chains in the Genus database with same CATH topology
 1OCO C;  2P4V A;  2VWJ A;  4PJ0 Z;  2VQF O;  4I7Z B;  4JF3 A;  3ZN1 A;  1XQ8 A;  5J2T B;  5FLX N;  1N36 O;  4CH5 A;  1I94 O;  3SPC A;  4X1I B;  1O9H A;  4A5U B;  3OMN B;  4PA3 A;  3ZHQ A;  5JQG B;  5KUK A;  1IBL B;  4R6Z A;  2QTO A;  3CCJ V;  4O4I A;  1ZLZ A;  4EFE A;  1Q86 W;  1HW7 A;  1QQC A;  4X65 B;  1RFY A;  2VQE B;  1AI4 A;  1H2K A;  5BR8 B;  1JFF B;  1TGO A;  2YIC A;  1OHH G;  1KUQ A;  1ZAU A;  3WB1 A;  3CEI A;  5CA3 A;  3OUS A;  2C2A A;  1H2N A;  5LGN A;  4DV5 O;  1I0H A;  1SA0 B;  4MVO A;  2B5U A;  2XT9 A;  1PM9 A;  1TUE B;  5LHI A;  1GN3 A;  2AZ2 A;  1RSO B;  4PEL A;  5E1A C;  5JH7 B;  4CH4 A;  1PNM A;  1L0N H;  3HKB A;  2P4K A;  1N8R W;  4U3F H;  3CC7 V;  4DV7 O;  2UUC B;  2XOK G;  4XDL A;  4BWA A;  3CCV V;  4DV1 O;  1LUW A;  1ZTE A;  2HJD A;  4PDV A;  2Z5U A;  2YI9 A;  4MTO A;  3N2G B;  4ICG A;  3WFV A;  3SYP A;  1GMG A;  1SQG A;  4GKK B;  1NS1 A;  1Z5W A;  1WB7 A;  2G38 A;  2IM9 A;  1R3L C;  2FYU H;  1HNX B;  1LUV A;  3KG2 A;  1R3I C;  4FVM A;  4RQE A;  4LF5 B;  1S0V A;  4JI3 O;  5LA6 B;  3RFR A;  3L9D A;  1EBO A;  4MVM A;  3B09 A;  3OMI B;  1K97 A;  4Q6G A;  3UCS C;  1VQ8 V;  4I9W A;  2LO1 A;  3JAW A;  5A9G A;  3KZI Z;  4JI7 O;  3QG5 A;  1OCZ B;  4NYK A;  2JS5 A;  3VBB A;  5B1B B;  2HVJ C;  3K79 A;  3UQ8 A;  4LFB B;  4JI4 B;  2YID A;  5LP6 C;  1CEZ A;  5C8Y A;  3RYC A;  1ZL8 A;  3FAV A;  4BIU A;  5DEC A;  5CBG A;  3E8B A;  5BXZ A;  2JJ2 G;  3BA9 A;  4MW3 A;  2UXN A;  4P9O A;  4DV4 O;  2UUB O;  1VQ4 V;  1TVK A;  2JIZ G;  3B40 A;  5KHK A;  4DV0 O;  1T5E A;  4K0K O;  1V54 B;  1WNS A;  3GB7 C;  1SET A;  4DRX B;  2AZ0 A;  3CRA A;  2H8P C;  1CXZ B;  2Y69 B;  5A2Q N;  4PI0 A;  5FPO A;  2BSK A;  1K73 W;  1OCO B;  1BHB A;  1TAE A;  3FYE B;  2QWQ B;  4Z2W A;  3P32 A;  2X6B A;  3KCY A;  3K04 A;  1VF6 A;  5KMG B;  4G28 B;  1XEQ A;  4L8J A;  5ITZ B;  2YC0 A;  1NBM G;  2XAG A;  1FKA O;  2QKA A;  3D36 C;  3P3P A;  1NQT A;  3SJQ C;  3RYH A;  1IZ3 A;  2R72 A;  5LYJ B;  4DR7 O;  4HNA A;  2E76 B;  3A0H Z;  3X2Q C;  1I5Y A;  2IH3 C;  1P84 F;  4NXM O;  4LP8 A;  1K5Q A;  4H44 B;  5CN0 A;  4EB6 B;  4NVP A;  2ZM6 O;  2ZDI C;  4LF4 O;  5CB4 B;  5GTH Z;  4XDJ A;  4TQD A;  3OW2 U;  3ASN C;  3DC6 A;  1N0J A;  2WLM A;  2DJV A;  3VQV A;  5IJ0 A;  3RVY A;  2Q68 A;  3TK1 A;  4GKJ O;  4DXW A;  1VQO V;  5FNV A;  3ZMV A;  4X64 O;  4P2Z A;  4N21 A;  1DK1 A;  3NR7 A;  1XNR B;  3R66 A;  5EC2 C;  1XUQ A;  3QTC A;  5LOV A;  4PD4 F;  1HWY A;  4X1Y A;  1LNQ A;  2HHH B;  4MVR A;  4GUN A;  3G71 V;  2EIM C;  4O4J B;  3ETD A;  2CE4 A;  3STL C;  1BMF G;  3CE2 A;  2RN9 A;  1MNG A;  4EKW A;  1GM9 A;  4ZIB A;  4W4K A;  1TUB B;  1Y6X A;  1QNM A;  5LMN O;  4N23 A;  1P49 A;  1Y67 A;  3HKC A;  3MDS A;  3K57 A;  3OT7 A;  1KEC A;  1QLE C;  5LP6 B;  2BE3 A;  3U0Z A;  3CRQ A;  1OJH A;  1K4C C;  5KHI A;  2LGW A;  3BCC H;  1PL4 A;  4JI1 B;  1JQ0 A;  5H5N A;  1QU7 A;  5LHG A;  1V55 B;  3G4S V;  1CP9 A;  1K9M W;  3WU2 Z;  2AHY A;  1VQ9 V;  2PY5 A;  2IJJ A;  3K3W A;  2WSS G;  2YIA A;  1L8D A;  1R6T A;  3ABT A;  5EK0 A;  1SQB H;  1VP7 A;  4KXR A;  4LNU B;  3N2K A;  2GV9 A;  2JDI G;  4WBN B;  2Y4T A;  5JVD B;  1GH6 A;  3D3I A;  3FB7 C;  3EHB B;  1FFX A;  1U97 A;  2HJF C;  1BQZ A;  4J9Z B;  3F7V C;  4J7Z A;  2L35 A;  2IJK A;  3CSX A;  2F23 A;  3TXQ A;  2UU9 B;  1ROP A;  1US6 A;  1BSM A;  1I08 A;  3CXH F;  4ZHQ B;  3F5W C;  4WCE V;  3ABU A;  4JZG A;  1IXB A;  3L75 H;  1AVM A;  5J2U B;  2XAH A;  1HNW B;  3ZHS A;  4PV1 B;  2PF4 E;  3B77 A;  1Y76 A;  1QBZ A;  2WLK A;  2ZCE A;  3BAB A;  5DM6 V;  3JCZ A;  1DLB A;  2DOS A;  2KG7 A;  3E22 A;  5K1X A;  3JAM N;  1IDS A;  2DMX A;  1VEW A;  4ABM A;  2QWO B;  2LQT A;  3CHX A;  4Z1M G;  4LBE C;  3ASN B;  3K5L A;  1JVM A;  5IE9 A;  5TIS Z;  1J95 A;  2ADP A;  4X20 B;  2OTJ V;  5BY1 A;  1AIL A;  1IBK B;  1SER A;  1NTK H;  4OX9 O;  1QR8 A;  4IYH A;  1ARO P;  3B8M A;  3JAT B;  2Q8V A;  4DR4 B;  3LDD A;  1S77 D;  4RWU A;  3MHS C;  4P9P A;  2E74 B;  4H33 A;  4E4E A;  3ZMU A;  4YY3 O;  3HR0 A;  1AR1 B;  2GTA A;  5FL7 G;  1P7G A;  2YXL A;  4JYC A;  3T1H O;  4YHH B;  2F1M A;  2YEV B;  4X1I A;  4CZZ A;  1N32 B;  5JCO C;  5H6Q A;  3JYC A;  3KCX A;  4PA6 A;  5KAF Z;  2JGU A;  1JOY A;  3C90 A;  4B3M O;  4U7O A;  4HYO A;  2FL4 A;  5IT9 N;  2H3O A;  1UPG A;  1Y74 B;  3TET A;  2YUA A;  4BW5 A;  2GBO A;  2EZP A;  2HEP A;  3JAL A;  4G27 B;  4XBF A;  1QLE B;  1I94 B;  4GZR B;  2OT5 A;  1G1X B;  2K9P A;  2IU0 A;  4B7K A;  4B08 A;  1B6Q A;  2M6Y A;  4TV8 A;  3W7S A;  1MA1 A;  1RSO A;  4U3J B;  5JH7 A;  4IHJ B;  2X6A A;  3G80 A;  4J7J A;  3H1H H;  4MS2 A;  2DYS C;  2ZQM A;  5B66 Z;  4F6R A;  1Y4M A;  2Q69 A;  2RJZ A;  2CDY A;  2WA3 A;  1RPO A;  4DV5 B;  4LF7 O;  1H38 A;  2QJ1 A;  4YIP A;  2L6L A;  2WLH A;  5CBF A;  2CGN A;  3UM7 A;  1QVG U;  1WA8 A;  3W7W A;  2UXC O;  2YIB D;  1FXV A;  2RMK B;  4TOI A;  5IYB O;  4DV7 B;  3BFR A;  4GYC B;  4FLX A;  3K0G A;  3WG7 C;  3CMA V;  4P30 A;  4X89 A;  5LA6 A;  2R9A A;  3B4S A;  4YJ3 B;  4DV1 B;  3RYI A;  3FKS G;  2XAS A;  1VQK V;  3QF7 A;  1YTF B;  3JCU Z;  1H8H G;  1HR0 O;  1K7D A;  3SPJ A;  4FLU A;  1FXK C;  1NVP D;  3JAR A;  2MK3 A;  3ZJZ A;  2VRZ A;  2D3O W;  1AJP A;  4IIJ B;  1GN6 A;  2QGN A;  2ZXW B;  5EZY B;  2JEU A;  1Q6U A;  2OWO A;  4JZ2 A;  4MTF A;  4LFC O;  2EBO A;  4J41 A;  3ZHU A;  3CCS V;  4LF8 O;  4RQF A;  2E75 B;  3JD1 A;  1BE3 H;  4AIL C;  1QHT A;  3QO5 A;  2Y0P A;  4DR3 O;  1VF7 A;  3ZRW A;  4R50 A;  4JI7 B;  3ML0 A;  3JD2 A;  1F51 A;  2XAJ A;  4PHZ A;  3QNE A;  2V4D A;  5KX5 B;  3AK1 A;  4QPJ A;  1PL0 A;  1H8E G;  5C93 A;  5CA1 B;  1MSD A;  2P5O A;  5JWP A;  1VQ6 V;  2UUB B;  5ITZ A;  1Q6I A;  4GX5 A;  3HPL C;  4FZ0 A;  2EX3 A;  3ABK C;  4DV0 B;  4JI5 O;  1NJI W;  1WB8 A;  4I4T B;  4UVA A;  2R70 A;  4DUY O;  2HFE C;  4X1K A;  3CYO A;  3ETE A;  3UO2 A;  4C7U A;  1NI8 A;  1ZUQ A;  5J9P C;  4UB6 Z;  4LWS B;  1NVP B;  2LFR A;  3ETG A;  1PP9 H;  2KSD A;  4EB6 A;  1XNQ O;  4E2L A;  4DV3 O;  1HNZ O;  4JI6 O;  3OD4 A;  2Q0O C;  4JYA O;  2NLJ C;  2ZE5 A;  1FPO A;  3JAK B;  1IXM A;  4NKG B;  5GTI Z;  3E8G A;  1S3J A;  5LBQ A;  2DYS B;  2JK5 C;  2CTW A;  4DR7 B;  3EXA A;  3CCR V;  2O57 A;  2HP8 A;  3E2E A;  2QSA A;  1XMQ B;  2UXB O;  4NXM B;  5L3G A;  5CA0 A;  2LW7 A;  4YJ2 B;  2RQ6 A;  4FIP C;  2DW4 A;  4LF4 B;  2QM8 A;  3UT5 B;  3CCE V;  5H6R A;  2ZIN A;  4JAV A;  5EC1 C;  1OV9 A;  3L70 H;  2P7T C;  1B06 A;  3FB8 C;  1RP3 B;  2Q7E A;  3OGI B;  4TV9 A;  5KA5 A;  3BAA A;  3WG7 B;  4UVC A;  3CCU V;  4GKJ B;  4O4J A;  1G4Y B;  2Y48 A;  1F4N A;  3CRM A;  4FJC C;  1YI2 V;  4B3T O;  4CS3 A;  2WLI A;  3IGA C;  2H94 A;  1H2L A;  3SYO A;  3AG7 A;  1E1R G;  5EYP A;  2BCC H;  1YJ9 V;  1WP8 A;  4DV6 O;  2LFS A;  2UXD O;  4JYB A;  2WPD G;  4LF9 O;  2F66 C;  1K8A W;  5LP6 A;  3AG4 C;  4BAY A;  2JVD A;  1Q6H A;  4MVQ A;  4ZOL A;  1RPR A;  3LNM B;  4JI0 O;  5LMU O;  3B8N A;  1MZF A;  4DYL A;  1YCI A;  3H1K H;  1PNK A;  1DTO A;  1HP8 A;  5B1N A;  3SYA A;  5K1P A;  1GTO A;  4Q20 A;  5LHH A;  1MZE A;  4CC5 A;  2WAM A;  2B1G A;  5KHJ A;  4QE9 A;  2ZIM A;  4I0X B;  3MD0 A;  2F95 B;  1NTZ H;  4WBN A;  2AGA A;  1WP7 A;  2P6J A;  2HR3 A;  4YIO A;  5IDJ A;  1HDJ A;  4CC6 A;  4UCV A;  4O4L B;  2BOC C;  2Y0I A;  4K3A A;  3ABK B;  1DF5 A;  3E83 A;  2WLL A;  3D36 A;  4ZHQ A;  4JAA A;  4O2A A;  5L3C A;  1KB9 F;  4KFM A;  3PN1 A;  1SQP H;  1VF5 B;  4DR5 O;  1XHZ A;  4I55 A;  2EJR A;  4OPA A;  3HKE B;  3D8C A;  4DUZ O;  2Z0A A;  3JAS B;  3E89 A;  3OGC C;  2M7W A;  1YIT V;  4ZI7 B;  2CTP A;  4PDR A;  3QVN A;  3CJH A;  2ZKO A;  1E1Q G;  1SKV A;  3EFF K;  2DWD C;  2GUZ A;  3Q4H B;  2Z3Y A;  4MT8 A;  4NTX A;  4NTY A;  4GX2 A;  1VQP V;  4X20 A;  4JV5 O;  3RN4 A;  4WFH A;  3A0R A;  4IL6 Z;  3JAT A;  2Y4U A;  2HVK C;  3ICX A;  4JI8 O;  2AHZ A;  4D7S A;  1OCR C;  1JR9 A;  5IYZ A;  5KAI Z;  1YHQ V;  3WB0 A;  1VF6 C;  1AJQ A;  3SDL A;  4FZ1 A;  4XDK A;  3VQW A;  5GON B;  3STZ C;  3ZMS A;  3ZED A;  4ZKI A;  1W2B U;  3GWK C;  2W0X A;  3LNN A;  1XOU A;  3OUF A;  5JJN B;  3ABL C;  3C3S A;  4FFB B;  4LFA O;  4FLW A;  2A7W A;  3BHP A;  2ATK C;  5BZB A;  4RUE A;  5AG2 A;  4FM2 A;  1YEW A;  1VAR A;  1S5H C;  1VIB A;  1XRE A;  2MW2 B;  1RM1 C;  5IJ9 B;  1NU1 H;  3EVK A;  1IBM O;  5CBH A;  2ITC C;  3N27 A;  2CH7 A;  4YY3 B;  3OE7 G;  3OEE G;  3SPH A;  4F6E A;  4LCU C;  4GKK O;  1QVF U;  2P67 A;  4GT1 A;  1R73 A;  3AG4 B;  2AXT Z;  1NH2 D;  4MSW C;  1SQQ H;  2YXY A;  3LDE A;  5KLV H;  1GN2 A;  4WFE A;  2JEX A;  3OMA B;  5L3F A;  4LC1 A;  4PDM A;  4B3R O;  4B3M B;  5F2V O;  2K1E A;  5IYC O;  2X0L A;  2QWR B;  1AP6 A;  2ZE7 A;  1KMI Z;  1W0J G;  3AK2 A;  4J9Y B;  1B04 A;  2QA4 V;  1WJZ A;  2PI4 A;  3ZN0 A;  3QO8 A;  2WA4 A;  4K35 A;  1Q82 W;  3A8T A;  4UV9 A;  3H1L H;  3SYC A;  1SQX H;  1GK9 A;  1MG1 A;  2A3Q A;  3AG3 C;  1K3E A;  3L74 H;  3CCM V;  1EN6 A;  4QNH B;  3LSQ A;  5DED A;  5L3D A;  4FLT A;  1F23 A;  2HKO A;  3J7A U;  5B3S C;  1BGY H;  1M57 C;  3CPW U;  2CGO A;  4QE7 A;  3W7U A;  4LF7 B;  1FJG O;  1K4D C;  4I50 B;  3T2M A;  3M8A A;  4TUY B;  3ABM C;  3FAV B;  3JD3 A;  1ENV A;  1QR9 A;  4JAS A;  5EZY A;  3CCL V;  2Q9L A;  2F4V O;  4HZ3 A;  4MW8 A;  4KUM A;  1SZX A;  3K5N A;  1KU9 A;  3DSQ A;  2QEX V;  4PA9 A;  3U11 A;  1N34 B;  4ZBM A;  2YS8 A;  3OTO O;  1KBH A;  5H9C A;  4OGQ B;  3X2Q B;  5L3B A;  4JYY A;  1AP5 A;  4X66 O;  2FKX A;  2UUA O;  1OCR B;  5HFM A;  2OYQ A;  2P90 A;  3G67 A;  2OIE A;  3HKD A;  1BCC H;  3BRC A;  4KP4 A;  5KX5 A;  3JD0 A;  2GSM B;  1K34 A;  5CA1 A;  1H2S B;  2LW1 A;  3CXC U;  1AR5 A;  2N74 A;  4MVZ A;  1M56 C;  4UV8 A;  4WFG A;  4X9Q A;  4YXW G;  3ABL B;  4DR3 B;  1YJW V;  3CX5 F;  2F93 B;  4I4T A;  2OCC C;  3ZIA G;  4FLY A;  2EZO A;  1I5X A;  1SQF A;  4HNA B;  1RM1 B;  3DTU B;  5J2T A;  1S72 V;  4DR6 O;  1YVW A;  1FYJ A;  2DYR C;  1DGS A;  3M7M X;  2ZE8 A;  5JQG A;  2EIM B;  4B7E A;  4LWS A;  1SRY A;  4PA4 A;  4JI2 O;  3APQ A;  3H01 A;  1KP3 A;  3LDC A;  2HHH O;  3B2E E;  4JI5 B;  4O2B B;  3K06 A;  5IJ0 B;  4UCO A;  2A9H A;  2CAZ C;  3E8H A;  1J5E O;  3FYI B;  5IWA O;  2VQF B;  2N05 A;  1JFF A;  5FNV B;  3CRC A;  2JJ1 G;  1VQ7 V;  1N36 B;  2ZR2 A;  3ZMZ A;  1YDX A;  1XI1 A;  1SA0 A;  2FML A;  4UCR A;  1G6U A;  4JTC B;  3TJT A;  3E86 A;  3ETQ A;  4I9Q A;  4JI6 B;  4JYA B;  4JI1 O;  2NN4 A;  3P30 A;  2W6J G;  4X62 O;  3N2G A;  3CD6 V;  4DR1 O;  5B3S B;  1F4M A;  1M57 B;  2UXB B;  1XL4 A;  3HKC B;  4LF6 O;  5KHG A;  4PA7 A;  1AI6 A;  3BEH A;  3ABM B;  1NT2 B;  3IFX A;  1P7B A;  2AW9 A;  3BA8 A;  4CS2 A;  4UUJ C;  2ZR3 A;  2EIL C;  2A0L A;  4FM0 A;  4O4H B;  2QM4 A;  2KKW A;  2UU9 O;  5KUM A;  1ZX3 A;  1N33 O;  3A0B Z;  4LH7 A;  2KB1 A;  4RO2 A;  1XMO O;  1D5N A;  2IH1 C;  5EBW C;  4DR2 O;  2NR5 A;  3RYF B;  5LGT A;  2FB5 A;  2Q7G A;  5EBL C;  3JSN A;  5BMV B;  2HLD G;  3I55 V;  3K5M A;  2GTS A;  4DV6 B;  3TGU H;  3SPI A;  2UXD B;  4TSF G;  1M1K W;  4NXN O;  4LF9 B;  4JI3 B;  2W0F C;  1NTM H;  1O9G A;  1W0K G;  1JJ2 U;  2JGD B;  3WB2 A;  4JI0 B;  5LMU B;  2N04 A;  1M56 B;  3OFN G;  3OR6 C;  1R3J C;  1JCH A;  1MAB G;  3K08 A;  4EEQ A;  5LL6 Y;  4FPP A;  4DRX A;  3RT3 C;  3K03 A;  2OCC B;  2KQX A;  2A79 B;  4W4L A;  1WLE A;  1R6N A;  2DE0 X;  2KG7 B;  5B1B C;  3HKE A;  5KMG A;  1M9N A;  3FX7 A;  3JAS A;  2DYR B;  4DV4 B;  4ZI7 A;  3I56 V;  3DXR B;  4K0K B;  2OIG A;  2Q5Z A;  1GRJ A;  1PPJ H;  4YHH O;  1H2M A;  5B1A C;  4L87 A;  3CME V;  1N32 O;  3GVM A;  4WF9 V;  3ZMT A;  4FLV A;  5LYJ A;  3P3N A;  1SZT A;  2F43 G;  4DO2 A;  3K5O A;  5H2F Z;  1KP2 A;  2Y69 C;  1F7Y A;  2CTR A;  1S5J A;  1QCE A;  2XTA A;  4QGP A;  5CB4 A;  3H1I H;  3SJC C;  5JJE B;  2B9Z A;  5GON A;  4FK5 C;  1M93 A;  5E79 Z;  1EM1 A;  1AI7 A;  1BZK A;  3KKY A;  3NXS A;  2RNB A;  2Q0A A;  4JV5 B;  4FFB A;  1XIL A;  1GO3 F;  2ETN A;  1Q90 D;  5EIB C;  3MAQ A;  1AJN A;  4JI8 B;  1N0N A;  2ZM6 B;  2YI8 A;  1R3K C;  5IJ9 A;  1U96 A;  3JAL B;  3TXS A;  2UXX A;  2XUM A;  4KHP O;  3MHH C;  2IW5 A;  3OTF A;  1BT8 A;  2DWE C;  4TWK A;  3SPG A;  2DN9 A;  4TV8 B;  2EIL B;  2EUL A;  1VQ5 V;  4NR1 A;  4X64 B;  3CB2 A;  1FXH A;  4DW1 A;  4LFA B;  5D5P A;  1VQN V;  1XBL A;  1NR1 A;  3K0D A;  3ZBH A;  1R1B A;  1TUB A;  4DK0 A;  3ZHT A;  1FXK B;  1SC5 B;  1VMG A;  2IBZ H;  4JAU A;  4AHC A;  4B3S O;  4F6R B;  2EIK C;  1IBM B;  2ITD C;  1M90 W;  3ZX6 A;  4MVS A;  4GX0 A;  2WLN A;  3ZS8 C;  1THZ A;  5LGU A;  2LJ2 A;  2Q6A A;  4J11 A;  1WA8 B;  2ILM A;  3U10 A;  4U7N A;  3IJ4 A;  4GX1 A;  5EIB D;  4NTQ A;  1AR4 A;  2XND G;  4B3R B;  5LMN B;  3RYI B;  5IY5 C;  4DW0 A;  1KKC A;  4FMT A;  2E5L O;  4LNU A;  4H13 B;  5JVD A;  5GW7 A;  3JAR B;  2WWW A;  4BR6 A;  2FTK A;  4D7T A;  4AQY O;  2YSU B;  3VQY A;  1EZJ A;  2QKS A;  4Z1V A;  4I50 A;  1IVS A;  4TUY A;  1Z5V A;  2BTQ B;  4DV2 O;  3G6E V;  4NTW A;  3ZCC A;  2YDE A;  2EJ7 A;  3T1Y O;  5B1A B;  1YXB A;  5J2U A;  3IC7 A;  1V55 C;  2Q73 A;  4D6T H;  3QO7 A;  1FS0 G;  3ZRW B;  4ASU G;  1G8M A;  4EFB A;  3OAA G;  1KKD A;  1KC8 W;  3C3T A;  4H0L B;  1PV0 A;  3S3X A;  1WPX A;  4FM1 A;  2HG5 C;  1FJG B;  5KHH A;  1D5A A;  2ZDI A;  4BW9 A;  4QJF B;  2ARH A;  3CC4 V;  1IBL O;  2F4V B;  3ZRS A;  3T4D A;  3E35 A;  3THO A;  5LXT B;  1MSW D;  4X65 O;  3OTO B;  2EIJ C;  1Y66 A;  2VQE O;  1WN7 A;  5BR8 O;  3AG1 C;  4X1K B;  4JGS A;  2Q4P A;  2B1I A;  2QR4 A;  4X66 B;  3JSL A;  4UCS A;  4CH6 A;  2UUA B;  4JTA B;  2ZIO A;  3DGE A;  4LH6 A;  3K9S A;  4UXN A;  3ASO C;  2EIN C;  2QDO A;  1XMQ O;  2YEV A;  2QWP B;  4O4I B;  2ZNI A;  4FLZ A;  5FPR A;  4OX9 B;  1BL8 A;  2QE7 G;  3F7Y C;  2UUC O;  1E79 G;  1IX9 A;  1ZSP A;  4O2B A;  5D5Q A;  1V9P A;  2P06 A;  1Y74 A;  1IUR A;  1PD3 A;  3HB3 B;  2EIK B;  2JS3 A;  3T1H B;  2PZS A;  2XAQ A;  1S5L Z;  4DR6 B;  3VOU A;  1EFR G;  1BHA A;  1Q7Y W;  5CA0 B;  4J7K A;  1PKX A;  2VWK A;  1HNX O;  3HKB B;  1H2G A;  1SES A;  1GKF A;  2V7Q G;  1Q8I A;  2LGQ A;  3OR7 C;  1JPX A;  3T1C A;  2W6I G;  4JI2 B;  5B5E Z;  4U3J A;  4UCU A;  4LF5 O;  4IHJ A;  1FFT B;  1NKD A;  4TV9 B;  1PNL A;  4PDL A;  1GAX A;  2VS0 A;  2XHB A;  2ZD9 A;  1YSC A;  3L72 H;  4G2K A;  1J5E B;  5IWA B;  2BOB C;  1NZ6 A;  3K59 A;  3OM3 B;  3BPZ A;  4HBN A;  4TT3 G;  5IY5 B;  4DK1 A;  1OCC C;  1D2D A;  2WLI B;  4UDM B;  4LFB O;  4JI4 O;  1YIJ V;  2R9I A;  3AEI A;  4I5S A;  2NNU A;  1XL6 A;  3RWR D;  4WFB V;  5EYP B;  4HAM A;  1K33 A;  1EZV H;  3CWB H;  5JJJ B;  1P4R A;  1JJO A;  5EBM C;  4ZOL B;  3TCU A;  2QTS A;  4K8X A;  5CMU A;  4WFA V;  4J42 A;  3JAW B;  4YJ3 A;  2DQ0 A;  2LP7 A;  3H9V A;  4O4H A;  2ZNJ A;  4X62 B;  2PTM A;  4MTX A;  2D2C B;  4DR1 B;  1KYO F;  4K8Z A;  3BVO A;  5C8Y B;  3RYC B;  1ZL8 B;  4LF6 B;  4IIJ A;  1VQM V;  1B3Q A;  1SF9 A;  4QIW F;  2V1D A;  3RYF A;  2UXC B;  4OPH A;  2ADQ B;  1M5I A;  5BMV A;  1EN4 A;  1TVK B;  5KA6 A;  1S76 D;  2QM7 A;  4IYI A;  2QWN B;  3FD9 A;  3CC2 V;  1NH2 B;  2JGD A;  1UJW B;  4GCZ A;  1HR0 B;  2WLL B;  4O2A B;  1N33 B;  2BSK B;  1I7F A;  2EIJ B;  2JRI A;  1XMO B;  1GN4 A;  2PGG A;  4QPK A;  4DR2 B;  3AG1 B;  4I55 B;  1K92 A;  3UO3 A;  2PYL A;  4IGG A;  2OCH A;  3LUT B;  2X6C A;  4LFC B;  4JTD B;  3ASO B;  2EIN B;  3CJH B;  3CP1 A;  4NXN B;  1K5S A;  4LF8 B;  5JCO A;  3E8F A;  2ZE6 A;  2ZXW C;  2GUZ B;  3AG2 C;  4R8C A;  1OZ0 A;  3DXR A;  3L71 H;  1KD1 W;  3RYH B;  1YF2 A;  2YIB A;  2P22 C;  1JMK C;  1WPB A;  1TA8 A;  1EN5 A;  1XHX A;  3LSS A;  1COW G;  1XNR O;  2ODM A;  3CCQ V;  4X8A A;  5IYZ B;  2RCV A;  4F4L A;  2Q67 A;  2RDC A;  2PI5 A;  3DC5 A;  3FFQ A;  3JD4 A;  3G6B A;  3T4Z A;  1KQS U;  3S3W A;  2QKC A;  1BQ0 A;  4UVB A;  4DUY B;  2IJH A;  1SS3 A;  3ZRV A;  3JAK A;  1YTF D;  3F5T A;  3FB6 C;  1JA8 A;  3APO A;  4MTG A;  4R7C A;  1A32 A;  1OCC B;  4NB5 A;  5LOV B;  1E44 B;  2Q7H A;  2CH7 B;  4X1Y B;  1XNQ B;  4YJ2 A;  4DV3 B;  1HNZ B;  3UT5 A;  2PUS A;  4CH3 A;  3SGI A;  2XAF A;  3FB5 C;  4CS4 A;  1N4C A;  3AG3 B;  4LR3 A;  1R6K A;  1UFI A;  4H37 A;  1MMM A;  3I5D A;  2CK3 G;  1M4U A;  2GDS A;  3CS5 A;  4CBC A;  1FXK A;  5B1O A;  2OTL V;  3SR2 C;  4X88 A;  2IJI A;  1VQL V;  4RUF A;  4OXS A;  4KHP B;  1ZWI C;  1YJN V;  2BTO A;  1Q3E A;  1FAF A;  1JX9 A;  3IAY A;  1NR7 A;  2CTQ A;  1FD9 A;  4IT5 A;  4WFF A;  3O9O A;  3GWO A;  1URF A;  4AI8 A;  4B3T B;  2CUG A;  1W59 A;  1XDC A;  4KL1 A;  3VQX A;  2X7R B;  3AK3 A;  3N2K B;  1HNW O;  3O65 A;  2R9R B;  2A06 H;  1AB3 A;  1X59 A;  1N34 O;  4B3S B;  1CPY A;  4FFK A;  4UB8 Z;  1FFX B;  4I0X A;  3OEH G;  4TQF A;  3ZRX A;  4J10 A;  3BY6 A;  4UCT A;  3J81 N;  3K9A A;  3UKM A;  3PJS K;  2YXH A;  3LSU A;  1Q81 W;  3SJB C;  4MVU A;  2E3C A;  2ZT9 B;  4O4L A;  3SJA C;  3AG2 B;  3CRR A;  5L3E A;  3IC9 A;  3RW0 A;  2BTQ A;  3RGB A;  1WAZ A;  4PI2 A;  3D3Q A;  5IYD O;  1Z2G A;  2PYJ A;  1IBK O;  2IU3 A;  3W7T A;  3R65 A;  1Y76 B;  1Q5O A;  4J80 A;  1OCZ C;  2WLJ A;  1BS3 A;  2E5L B;  3E22 B;  4DR4 O;  4BIO A;  1AI5 A;  3L73 H;  3SYQ A;  3H1J H;  1GM8 A;  2DQ3 A;  1MOF A;  4BIZ A;  4AQY B;  1DF4 A;  3HKD B;  2GHY A;  1LR1 A;  1GM7 A;  3J80 N;  4UFZ A;  1L0L H;  1ORQ C;  3Q4H A;  3RVZ A;  1Q43 A;  4DV2 B;  1X4T A;  1L1F A;  3ZHV A;  4JPR A;  3T1Y B;  1QLN A;  1V54 C;  1YZB A;  1SQV H;  4DR5 B;  3RBZ A;  3W7X A;  4GLX A;  4RAI A;  3A2F A;  3K58 A;  5DN6 G;  4DUZ B;  3M99 B;  3ZHR A;  5LXT A;  5HFL A; 
#chains in the Genus database with same CATH homology
 3IC7 A;  1OCO C;  4UV9 A;  1V55 C;  3QO7 A;  2OT5 A;  1FS0 G;  3SYC A;  4JF3 A;  1GK9 A;  3ZRW B;  3ZN1 A;  2IU0 A;  4ASU G;  1G8M A;  1MG1 A;  1B6Q A;  3OAA G;  3AG3 C;  1K3E A;  3SPC A;  3CCM V;  3W7S A;  1KKD A;  3OMN B;  1KC8 W;  4PA3 A;  4QNH B;  2X6A A;  3LSQ A;  5KUK A;  1WPX A;  5L3D A;  1F23 A;  2HG5 C;  2HKO A;  4MS2 A;  4R6Z A;  5B3S C;  2DYS C;  2QTO A;  2ZDI A;  3CCJ V;  1M57 C;  4QJF B;  2ZQM A;  3CPW U;  1Q86 W;  3CC4 V;  4QE7 A;  3W7U A;  1Y4M A;  1K4D C;  3ZRS A;  3T2M A;  2Q69 A;  3ABM C;  3JD3 A;  1ENV A;  1AI4 A;  1QR9 A;  1RPO A;  4JAS A;  3E35 A;  3T4D A;  3CCL V;  1MSW D;  1OHH G;  4HZ3 A;  1H38 A;  4MW8 A;  4KUM A;  2WLH A;  2EIJ C;  2QEX V;  5CBF A;  1Y66 A;  5CA3 A;  3UM7 A;  1QVG U;  4PA9 A;  3OUS A;  3AG1 C;  3W7W A;  2C2A A;  5LGN A;  4JGS A;  4MVO A;  4ZBM A;  2B5U A;  2B1I A;  1FXV A;  1TUE B;  5IYB O;  5H9C A;  5LHI A;  3K0G A;  4PEL A;  3WG7 C;  4JTA B;  5E1A C;  3X2Q B;  5L3B A;  3DGE A;  4P30 A;  1PNM A;  3CMA V;  4X89 A;  4UXN A;  3ASO C;  2EIN C;  1N8R W;  3FKS G;  2XAS A;  1VQK V;  1YTF B;  3CC7 V;  2YEV A;  1OCR B;  1H8H G;  5HFM A;  2P90 A;  2XOK G;  4XDL A;  4KP4 A;  3CCV V;  1K7D A;  1BL8 A;  3SPJ A;  1FXK C;  1NVP D;  2QE7 G;  2Z5U A;  3JD0 A;  2MK3 A;  4MTO A;  4PDV A;  3F7Y C;  2GSM B;  3ZJZ A;  1K34 A;  1E79 G;  2D3O W;  1AJP A;  3WFV A;  3CXC U;  3SYP A;  4MVZ A;  2ZXW B;  1M56 C;  2JEU A;  1GMG A;  4UV8 A;  4WFG A;  4YXW G;  4MTF A;  3ABL B;  2EBO A;  1R3L C;  1YJW V;  1PD3 A;  3HB3 B;  3CCS V;  2EIK B;  2XAQ A;  2OCC C;  3VOU A;  3ZIA G;  4RQF A;  3KG2 A;  3JD1 A;  1EFR G;  1R3I C;  1I5X A;  2EZO A;  4RQE A;  3QO5 A;  1BHA A;  1Q7Y W;  1S0V A;  1RM1 B;  1PKX A;  3DTU B;  3ZRW A;  1S72 V;  1H2G A;  1EBO A;  1SES A;  1GKF A;  2V7Q G;  3ML0 A;  4MVM A;  3OMI B;  4R50 A;  3OR7 C;  1JPX A;  1K97 A;  3JD2 A;  1F51 A;  2W6I G;  2XAJ A;  3T1C A;  2DYR C;  1VQ8 V;  4I9W A;  1FFT B;  1NKD A;  3QNE A;  2EIM B;  1PNL A;  1OCZ B;  4PDL A;  1SRY A;  4PA4 A;  2ZD9 A;  3VBB A;  5B1B B;  1YSC A;  4QPJ A;  4G2K A;  1PL0 A;  2HVJ C;  1H8E G;  3H01 A;  1KP3 A;  3K79 A;  5C93 A;  2BOB C;  3LDC A;  3OM3 B;  4TT3 G;  5IY5 B;  3K06 A;  1CEZ A;  1OCC C;  2A9H A;  1VQ6 V;  3E8H A;  2WLI B;  3FYI B;  4GX5 A;  4BIU A;  4UDM B;  3HPL C;  1YIJ V;  2R9I A;  3ABK C;  5CBG A;  3E8B A;  2JJ2 G;  3AEI A;  2NNU A;  1XL6 A;  4I5S A;  2JJ1 G;  4WFB V;  4MW3 A;  1VQ7 V;  2UXN A;  4HAM A;  1K33 A;  4UVA A;  4P9O A;  2ZR2 A;  3ZMZ A;  2HFE C;  1VQ4 V;  2JIZ G;  3CYO A;  1V54 B;  3ETE A;  1P4R A;  5EBM C;  3GB7 C;  4JTC B;  3TCU A;  1SET A;  5J9P C;  5CMU A;  3E86 A;  4WFA V;  2H8P C;  2Y69 B;  2DQ0 A;  2LP7 A;  1K73 W;  1OCO B;  1BHB A;  4MTX A;  3FYE B;  3P32 A;  2X6B A;  1NVP B;  2LFR A;  3ETG A;  3K04 A;  3P30 A;  4E2L A;  2W6J G;  4G28 B;  3CD6 V;  2NLJ C;  1VQM V;  1NBM G;  1IXM A;  2XAG A;  2V1D A;  4QIW F;  3E8G A;  5B3S B;  1S3J A;  5LBQ A;  2DYS B;  2JK5 C;  1F4M A;  1M57 B;  1XL4 A;  3CCR V;  5KA6 A;  1NQT A;  2QM7 A;  3SJQ C;  1S76 D;  4PA7 A;  3CC2 V;  3E2E A;  1AI6 A;  3BEH A;  1NH2 B;  3ABM B;  3IFX A;  1P7B A;  5L3G A;  1UJW B;  4GCZ A;  4UUJ C;  2WLL B;  2ZR3 A;  1NJI W;  4FIP C;  2DW4 A;  2EIL C;  2A0L A;  2QM8 A;  3X2Q C;  2EIJ B;  1I5Y A;  2IH3 C;  3CCE V;  5H6R A;  4JAV A;  5EC1 C;  4QPK A;  3AG1 B;  4LP8 A;  1K5Q A;  5CN0 A;  2P7T C;  5KUM A;  3FB8 C;  2ZDI C;  1K92 A;  2KB1 A;  5KA5 A;  4RO2 A;  3LUT B;  4XDJ A;  4UVC A;  2X6C A;  3WG7 B;  3CCU V;  1G4Y B;  2Y48 A;  2IH1 C;  3ASN C;  5EBW C;  3OW2 U;  2WLM A;  4JTD B;  3ASO B;  1F4N A;  2EIN B;  3CP1 A;  1K5S A;  4FJC C;  5LGT A;  5EBL C;  1YI2 V;  2HLD G;  3I55 V;  3RVY A;  2Q68 A;  2WLI A;  2ZXW C;  3E8F A;  2H94 A;  3IGA C;  3TK1 A;  3SPI A;  3AG2 C;  4TSF G;  1M1K W;  4R8C A;  1OZ0 A;  4DXW A;  1VQO V;  3ZMV A;  2W0F C;  1KD1 W;  3SYO A;  1E1R G;  1W0K G;  4P2Z A;  1YJ9 V;  4N21 A;  2LFS A;  1JJ2 U;  4JYB A;  2WPD G;  1M56 B;  3OFN G;  3OR6 C;  1K8A W;  1R3J C;  1JCH A;  5EC2 C;  3AG4 C;  4BAY A;  4MVQ A;  1MAB G;  3K08 A;  3LSS A;  1COW G;  1RPR A;  3LNM B;  4FPP A;  1HWY A;  3B8N A;  3CCQ V;  1LNQ A;  3K03 A;  4X8A A;  2OCC B;  4MVR A;  4F4L A;  2A79 B;  2Q67 A;  3G71 V;  2PI5 A;  1WLE A;  2EIM C;  1PNK A;  3ETD A;  1DTO A;  1R6N A;  3JD4 A;  5B1N A;  3SYA A;  5B1B C;  3T4Z A;  1M9N A;  1GTO A;  3STL C;  1BMF G;  4Q20 A;  5LHH A;  1KQS U;  2WAM A;  2DYR B;  2B1G A;  4QE9 A;  4UVB A;  4EKW A;  1GM9 A;  3I56 V;  2IJH A;  3MD0 A;  3ZRV A;  1YTF D;  4N23 A;  3FB6 C;  2P6J A;  4XBF A;  5B1A C;  2HR3 A;  4L87 A;  5IDJ A;  1KEC A;  1QLE C;  3CME V;  4MTG A;  4R7C A;  4WF9 V;  1OCC B;  3ZMT A;  2BOC C;  1K4C C;  1SZT A;  2F43 G;  4DO2 A;  1E44 B;  3ABK B;  1DF5 A;  3E83 A;  2WLL A;  3D36 A;  1JQ0 A;  5L3C A;  1KP2 A;  4KFM A;  2Y69 C;  5LHG A;  1V55 B;  3G4S V;  1CP9 A;  2XAF A;  1K9M W;  3FB5 C;  2AHY A;  1VQ9 V;  2EJR A;  2IJJ A;  1QCE A;  3K3W A;  2WSS G;  3AG3 B;  3E89 A;  3OGC C;  2M7W A;  1YIT V;  3ABT A;  1R6K A;  4PDR A;  5EK0 A;  4H37 A;  4FK5 C;  2JDI G;  1AI7 A;  1E1Q G;  3D3I A;  3FB7 C;  3EFF K;  3EHB B;  2DWD C;  2CK3 G;  3NXS A;  2HJF C;  4CBC A;  2Z3Y A;  4J9Z B;  4MT8 A;  1FXK A;  3F7V C;  5B1O A;  2OTL V;  4X88 A;  2IJI A;  4GX2 A;  1VQP V;  2IJK A;  1GO3 F;  1VQL V;  4RUF A;  1AJN A;  1ROP A;  4OXS A;  3F5W C;  4WCE V;  3ABU A;  4WFH A;  1ZWI C;  1R3K C;  1YJN V;  3A0R A;  2UXX A;  2HVK C;  2XAH A;  1JX9 A;  2AHZ A;  1NR7 A;  1OCR C;  3MHH C;  4WFF A;  2IW5 A;  3GWO A;  1YHQ V;  1AJQ A;  3B77 A;  2DWE C;  1QBZ A;  2WLK A;  4TWK A;  5DM6 V;  3JCZ A;  1DLB A;  3SPG A;  4XDK A;  2EIL B;  3STZ C;  2X7R B;  3ZMS A;  4ZKI A;  2R9R B;  1W2B U;  1VQ5 V;  1CPY A;  1FXH A;  1VQN V;  1NR1 A;  3OEH G;  3K0D A;  3ZRX A;  1FXK B;  3OUF A;  3BY6 A;  3ABL C;  4JAU A;  4Z1M G;  3K9A A;  3UKM A;  4LBE C;  2EIK C;  3ASN B;  3PJS K;  1JVM A;  2ATK C;  1J95 A;  5BZB A;  4RUE A;  1Q81 W;  2OTJ V;  2ITD C;  4MVU A;  1M90 W;  1SER A;  4MVS A;  1S5H C;  1QR8 A;  4GX0 A;  2WLN A;  1ARO P;  1RM1 C;  1THZ A;  3AG2 B;  3B8M A;  5LGU A;  5L3E A;  5CBH A;  2ITC C;  3RW0 A;  2Q6A A;  3OE7 G;  5IYD O;  3OEE G;  3SPH A;  3LDD A;  1S77 D;  2IU3 A;  3MHS C;  4P9P A;  4U7N A;  3W7T A;  3R65 A;  4LCU C;  1QVF U;  4GX1 A;  1OCZ C;  4H33 A;  2WLJ A;  2P67 A;  4GT1 A;  3ZMU A;  1AR1 B;  1R73 A;  3AG4 B;  2XND G;  1AI5 A;  1NH2 D;  5FL7 G;  4MSW C;  4JYC A;  3LDE A;  3SYQ A;  5IY5 C;  4WFE A;  2JEX A;  1GM8 A;  2DQ3 A;  3OMA B;  2YEV B;  1MOF A;  4FMT A;  4CZZ A;  5L3F A;  4BIZ A;  5H6Q A;  4LC1 A;  1DF4 A;  4PDM A;  2GHY A;  3JYC A;  1GM7 A;  5GW7 A;  4PA6 A;  2K1E A;  1ORQ C;  2WWW A;  5IYC O;  2X0L A;  3RVZ A;  1JOY A;  2FTK A;  2YSU B;  1EZJ A;  4U7O A;  1L1F A;  4HYO A;  2QKS A;  1W0J G;  4JPR A;  4J9Y B;  1QLN A;  1V54 C;  3TET A;  4BW5 A;  3RBZ A;  3W7X A;  2QA4 V;  2PI4 A;  3ZN0 A;  3G6E V;  3QO8 A;  4RAI A;  1Q82 W;  2EZP A;  5DN6 G;  3ZCC A;  3M99 B;  5B1A B;  4G27 B;  5HFL A;  1QLE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...