2B5UA

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
470
structure length
470
Chain Sequence
SAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSCPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
molecule keywords Colicin E3
total genus 142
structure length 470
sequence length 470
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b5uA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 2b5uA03
4UDMB 2YSUB 1E44B 1UJWB 1JCHA 2B5UA
chains in the Genus database with same CATH superfamily
2QM7A 4GX0A 2DYRC 4FM1A 4K3AA 2FMLA 1TVKA 4ASUG 4TV8B 4DXWA 2JVDA 4JTAB 5LMNB 3QNEA 2HHHO 3G4SV 2LFRA 5LXTA 3APQA 4XDJA 5IYZB 3E86A 3B2EE 3OMNB 4LP8A 1AI5A 1K7DA 4I4TB 4IT5A 4TOIA 1B3QA 5EZYA 3K59A 4NTQA 1K33A 4FLVA 1R3KC 3WB2A 5IE9A 5LYJB 4UCUA 5D5PA 1R3IC 4IL6Z 2CK3G 2LGWA 2NN4A 3FB6C 1SETA 1BS3A 4X20A 1Q3EA 5EIBC 2QTOA 1QR9A 2HJDA 2W0FC 4LFBB 3T1HO 1DTOA 4KXRA 2PF4E 1XDCA 1BZKA 1D5NA 5L3BA 3BPZA 1OCRB 5EYPA 1HWYA 1DGSA 1NR1A 5LGTA 3ABUA 3JALA 4R50A 1P7GA 5TISZ 4DRXA 1JFFB 4H37A 1OCCC 4DR2B 3ETGA 3ZS8C 2QWRB 3ZHVA 4CC5A 1FD9A 1S3JA 2Y4UA 5H5NA 3Q4HB 2QWPB 1N33B 1TUBB 1VF5B 2DQ3A 4PA9A 3JARA 4NTXA 2IJHA 4WCEV 3E83A 1VQ6V 4DV4O 1KD1W 1FAFA 3QTCA 4ZBMA 3DXRA 1R3JC 4TT3G 1MMMA 1RM1C 1Y6XA 4X66B 1KQSU 1HNZB 2OT5A 2DYSB 5CMUA 5EC2C 1D5AA 3IJ4A 3UCSC 4JI7O 2DWDC 1CEZA 2YXYA 4PJ0Z 4W4LA 2PI4A 4PA3A 1RSOA 3JATB 2MK3A 3BFRA 2LO1A 1BMFG 1HNWB 1SRYA 1QLEB 5J2TB 5J2UA 2YI9A 3R66A 2UU9B 4MVRA 1QBZA 5FL7G 3K03A 2ADQB 4MVQA 2WWWA 4IYHA 4CC6A 5JWPA 2UU9O 5AG2A 2QWNB 1SA0A 4NTYA 1OCCB 3NR7A 2GTAA 3DC5A 3JAKA 1MSDA 1AB3A 3W7WA 1RFYA 3M7MX 4B3SO 2RN9A 2ZDIC 1NR7A 2QKSA 3SGIA 4DR3O 4JI2O 4LC1A 1UJWB 4FLYA 3WG7B 1GTOA 1SZTA 2HJFC 2Q7GA 4I55B 2BE3A 3CCUV 4I50B 4O4JA 3CRRA 2B1GA 1SERA 2YEVA 1NH2B 4BIUA 2YIDA 4UUJC 3X2QC 4JASA 1JFFA 3W7UA 2UUCB 3FX7A 4MTOA 2LJ2A 1S72V 4JI4O 2YS8A 1ZX3A 2AXTZ 5F2VO 1VMGA 1K73W 1Q43A 1IBKB 4LF7B 3APOA 4X62B 3K58A 2QTSA 2IJIA 1SQXH 4JI8O 5CA1B 3RW0A 4DR2O 1LNQA 5DECA 1S5HC 2R9AA 4O2AB 3RYIA 1AJQA 3DXRB 3K5OA 2Q6AA 2DOSA 3JD4A 2E74B 1VQLV 4NKGB 5JVDB 3SJCC 2LP7A 3CRAA 4HZ3A 1GAXA 1NVPB 5FPOA 1WA8B 4O2BA 5D5QA 2F23A 3G6EV 5JQGA 2JK5C 2QM8A 4FMTA 1Y66A 2CUGA 3ICXA 1E79G 4DYLA 1G8MA 3SYPA 2E5LB 4NXNB 1GH6A 3P3NA 3AG2B 1J5EB 1SQVH 2V1DA 2A3QA 2XAQA 4QIWF 3O65A 1K3EA 1UFIA 4J41A 4YJ3B 3U0ZA 4J7KA 3K5MA 3ML0A 1VQ5V 2ZE6A 3KCYA 5LL6Y 3WB0A 2E76B 4X1IA 4UFZA 3OUFA 2ARHA 3RYCA 3RYFB 5LMUB 5LYJA 3ZBHA 3K3WA 4DUZB 1VQ9V 4DUZO 5LMUO 4J80A 3JD1A 4LBEC 3FYIB 2ZDIA 2PY5A 2A0LA 3LUTB 2OWOA 4PELA 1DLBA 2A79B 3RT3C 3ZRSA 2CDYA 3NXSA 1JJOA 4ZI7A 2EIMB 4DK0A 2YXHA 2E5LO 5FPRA 4AQYO 1K5QA 2ZT9B 3RBZA 3JALB 3R65A 4X65O 4DV5B 5L3CA 2AW9A 4RUFA 2UUAB 3UT5A 1L1FA 4HNAB 3CRQA 1AR1B 2BTQB 1FJGB 2NNUA 1S77D 4PA6A 1NU1H 2AGAA 2OTJV 4E4EA 4FZ0A 3TETA 2Y0IA 3UKMA 4X1KB 3OFNG 2VS0A 4O2AA 3RYIB 4B3TO 2R9IA 2ZIMA 5IYBO 1F23A 3CSXA 3TXQA 1XI1A 2F95B 1FFXA 1JPXA 4J9ZB 4ZIBA 4PI2A 4X1YB 3ZRXA 3AG3B 4DR5O 4KP4A 2WLHA 2EZOA 4J11A 3C3SA 3CXCU 2CGNA 3JSLA 5B5EZ 3E35A 1IBLO 2CE4A 2RMKB 3C90A 3JAWA 5BXZA 4DR7O 1CP9A 2JGUA 4DV3O 2ZIOA 5GTHZ 3ABLC 1AROP 3MDSA 5CB4A 3SYAA 2M6YA 1JMKC 2XHBA 2B1IA 1SF9A 1Q6HA 3VOUA 5J2TA 3JAMN 3RWRD 2BSKB 2XAHA 4UCRA 4TV8A 3CC7V 1FXKA 3CEIA 4BAYA 4E2LA 2OYQA 1QHTA 3CB2A 3ZHQA 4CH6A 3OGCC 5LA6B 2NR5A 3OTFA 2ILMA 3ABKC 3HKBB 3RYFA 1IURA 3OT7A 1OHHG 4FK5C 1Y74A 4QE7A 2PI5A 1Q90D 2ZKOA 4ZKIA 5IYDO 3ZX6A 2Y4TA 3FKSG 2GSMB 4TWKA 3RVYA 4IHJA 1S76D 4FZ1A 4I50A 4PDMA 1TAEA 3BRCA 4ZI7B 1XMQO 2OIGA 3CC4V 1YEWA 5EC1C 4PDLA 1H2SB 3B4SA 1KKDA 2RQ6A 1H2KA 3BY6A 1Q7YW 5LHHA 1CXZB 4Z2WA 4MVZA 4B7EA 2IU0A 1VQPV 3OE7G 1NI8A 4HNAA 4WFFA 3ZMTA 3BVOA 4DV5O 1WNSA 1U97A 4GZRB 1XL6A 1V54B 4GCZA 1H2MA 1W0JG 4AHCA 4DRXB 1Q5OA 4OPAA 2QSAA 1VEWA 1KYOF 2Q5ZA 3H1LH 3JCZA 5CA3A 5H2FZ 1H8HG 2OCHA 2WLKA 1IBMB 5CA1A 5KAFZ 3FD9A 4N21A 3F5TA 3IC9A 1AP5A 1HNZO 1TUBA 1N36O 3JARB 3N2GA 1M5IA 4YXWG 3CCVV 1NQTA 3BCCH 5IWAO 1FXKC 4ABMA 2P06A 1VQMV 1NTMH 2EILC 1K97A 2VQFO 2JDIG 3VQWA 3CPWU 3FFQA 1XMOB 1Y4MA 3ABLB 1JOYA 2B9ZA 1N33O 3TXSA 5CA0A 4YHHO 1XREA 1M56B 1MZFA 2EIKC 1IBKO 4UCTA 5KHIA 2ATKC 4DV7B 1NBMG 2FKXA 1SQQH 4FLWA 3ZRWA 4JYBA 4JI0B 2QEXV 4MTXA 3THOA 4UB6Z 3G67A 1FXHA 1Q6UA 4NXMB 2Q69A 1KU9A 3MAQA 1DF4A 1EN6A 2YXLA 5DN6G 1IBMO 4YJ3A 3FAVA 4G27B 3D8CA 3MD0A 4NXMO 3RYCB 4BW5A 1HR0O 2ZCEA 2D2CB 3A2FA 4RWUA 3SR2C 3ZHRA 2Q7HA 3CCRV 2JEUA 3ABKB 3M99B 1EN5A 3QVNA 4X89A 3CJHB 1R6KA 4N23A 1VF7A 2F93B 3ABMC 1PM9A 1RPOA 2RDCA 2XAGA 4FLZA 4F6EA 4FFBA 1B06A 4PDRA 1N0NA 2PUSA 1WB7A 2Q8VA 4O4HA 1Z5WA 1H38A 1IXMA 3JD2A 2Q68A 3HR0A 3CCJV 1BHAA 2JJ2G 4MW3A 1JJ2U 4NYKA 2RCVA 4X9QA 2XUMA 1B6QA 1LUVA 2BTQA 4C7UA 1GKFA 1M1KW 2N04A 1WPXA 4F6RB 3T1HB 2XAJA 4NB5A 3K5NA 3OMAB 1QU7A 1GMGA 4GLXA 4LH6A 3RN4A 1Y76B 5KMGA 5DEDA 3ETDA 4B3MB 5GONB 2A06H 4TQDA 5LGNA 2AHZA 3SYQA 4ZOLB 4PA4A 3OEEG 1VQ8V 1H2NA 1ROPA 3OMIB 5E1AC 3L74H 4MVUA 1IBLB 3K79A 3OR7C 3I56V 5C93A 1NH2D 4GKJB 4KUMA 4WBNB 4B3RB 1R73A 3E8BA 2HP8A 3G71V 4FFKA 4IGGA 2XTAA 4I9QA 4JI6B 3LDCA 3B40A 3ASNC 3KZIZ 3W7XA 2VQFB 1ZUQA 4DW0A 4JAAA 3IC7A 1ZWIC 1G6UA 2HVKC 3QF7A 1AILA 1S5JA 3T4ZA 3G80A 4I9WA 1K4DC 3VQVA 3W7TA 1NVPD 4X64B 2OIEA 5KHJA 1K8AW 3ZIAG 1N34O 3ZRVA 2Y69B 1JR9A 1M93A 1H2LA 5LA6A 3HKBA 3SJQC 3GWOA 1XHZA 2Q0OC 2ZQMA 1N4CA 4CZZA 3BABA 4Z1MG 4CH3A 4Q20A 3L75H 4JI0O 1EZJA 4AQYB 1I0HA 3ASOB 2Y69C 1KBHA 5B1AC 3HKDA 3LDEA 3CX5F 4IHJB 2QJ1A 3CMEV 3L9DA 5KHGA 3ZMVA 3I55V 2CTQA 2YICA 3JSNA 2GBOA 3AG1B 2YC0A 4O4HB 2JRIA 3ASOC 3FB7C 1X59A 2Y0PA 1WP7A 2PYJA 3RGBA 5DM6V 3ABMB 2C2AA 3TCUA 4F6RA 2G38A 4I0XB 2DYRB 2Q7EA 1XNRB 5ITZB 5A2QN 4DV1B 5LHIA 1R3LC 2HFEC 5IYCO 2WLIB 1Y76A 2CTPA 3FYEB 1FXVA 1WB8A 2OCCC 4JI1B 2ITDC 4X65B 1R1BA 1KUQA 2HG5C 1U96A 1OZ0A 1I7FA 2W6IG 1VQKV 3OUSA 1OCOC 3IFXA 1PP9H 1NTZH 2XASA 1OCZB 1MG1A 2BOBC 1Q86W 3LSUA 4WFEA 1F7YA 2KSDA 2HHHB 4W4KA 1H8EG 3K06A 2ZINA 1AP6A 4GUNA 2GDSA 2DMXA 3H9VA 1NTKH 2QKCA 1I5XA 1P7BA 4IYIA 5H9CA 1N8RW 3CHXA 2EINC 1QR8A 3VQXA 4LF8B 1I5YA 3SJAC 4TQFA 3CMAV 3ZHTA 1JQ0A 3FAVB 2Q9LA 4LFCB 4LH7A 5B1AB 3H01A 5EZYB 1GM9A 3GB7C 2X6CA 4NXNO 2AHYA 4CH4A 5HFLA 3CS5A 2QWQB 1N0JA 4B3MO 3QO5A 3OD4A 1MZEA 4QPJA 1FS0G 3SPCA 1KP3A 3ZMUA 4X20B 1XUQA 2QGNA 1K92A 4LR3A 2ZE7A 2W6JG 3D3IA 1AI4A 1VARA 3IAYA 2P4VA 1GRJA 1I94B 2CTRA 3E2EA 5EYPB 4WFHA 1QNMA 4U7NA 4WF9V 3HB3B 4DR6O 1N32O 1M57C 1QVFU 1BQ0A 1WAZA 3EFFK 2X0LA 3AK3A 5LOVA 5EIBD 1R6TA 4ICGA 5CBHA 2P90A 1P84F 3S3WA 2W0XA 2YIAA 4GKJO 3E22A 4AILC 1FFTB 1OCOB 3CYOA 2DN9A 2ODMA 4DO2A 3CE2A 1PPJH 4P30A 4JYCA 1RM1B 1CPYA 2IM9A 4X88A 4JI3B 5LBQA 3N27A 3D3QA 4B08A 4JI1O 1K34A 2JGDA 3GVMA 1HR0B 1R6NA 5FLXN 2YDEA 5IY5B 1IDSA 1V55B 1V9PA 4DV6B 1GM8A 1KKCA 1TGOA 4MTGA 2D3OW 4GKKO 3CD6V 2EINB 2HR3A 2PTMA 2CGOA 3QO8A 1YZBA 4UCVA 4PD4F 5H6QA 4FM0A 2RNBA 3JATA 2WLNA 5B3SB 4Q6GA 2JS5A 1IVSA 2UXCB 3STLC 3ZRWB 2V7QG 1NJIW 3WFVA 4OXSA 2P5OA 1OCRC 1ORQC 3AEIA 1KECA 1GO3F 5KUMA 3SJBC 4CBCA 3BHPA 5B3SC 1XL4A 3S3XA 3E8GA 4O4LA 4AI8A 3K9SA 4K0KB 5IYZA 3LSSA 3CCLV 2JIZG 4BIZA 1MOFA 1M4UA 1Y67A 2QE7G 4BWAA 4EEQA 1HNWO 5B1BB 3DTUB 4UVAA 4NTWA 4H44B 3ABTA 1BSMA 3RYHA 4XBFA 4EKWA 4D7SA 2LGQA 3HKDB 2XAFA 2Z5UA 1HP8A 1N34B 5EBLC 1XBLA 4X64O 3HPLC 3CJHA 1YITV 2YEVB 1AJPA 5KX5A 1TA8A 1NT2B 3CCEV 4DUYB 3J81N 1YVWA 4YIOA 5JJJB 3UM7A 2BTOA 4HYOA 5LOVB 3P3PA 3O9OA 4DV0O 2ZM6B 3EVKA 1NKDA 4P9PA 3VQYA 4LF6O 4YY3O 1WPBA 2DQ0A 1URFA 2E75B 4RO2A 3F7YC 2F4VB 3ZMSA 3WU2Z 4IIJB 4I0XA 3JD3A 4WFGA 3E22B 4B3RO 5E79Z 3H1HH 2WLIA 3LNMB 1QQCA 2KKWA 2JEXA 2WSSG 3WG7C 3C3TA 2MW2B 2Q67A 1AR5A 3EHBB 2GUZB 4YY3B 1EBOA 1SQBH 2AZ0A 5KMGB 5GONA 5IJ9B 4DV0B 1N32B 5CN0A 1G1XB 4ZOLA 1F4NA 3JASB 2L6LA 4DR4O 2VQEO 3UO3A 4OPHA 1MSWD 2YI8A 3T1CA 4DV6O 4UXNA 1HDJA 1GN6A 1YTFB 1YHQV 4JF3A 1D2DA 4X66O 3FB8C 1BT8A 3QG5A 1PV0A 1X4TA 2EX3A 4B3SB 3ZMZA 2M7WA 4GX1A 4QGPA 4JI3O 5B1OA 3HKEA 5KAIZ 3K9AA 4MVMA 4JZGA 5J2UB 1SESA 4O4LB 3JD0A 2XOKG 1Q82W 4LFCO 1XMQB 4EFEA 1SKVA 2ZR3A 4QE9A 1J95A 3B8MA 1SC5B 1ZTEA 1SA0B 5LMNO 1O9HA 5KUKA 2F66C 4D6TH 3BA9A 4U7OA 2ZXWB 3SYOA 1KMIZ 1ZLZA 4Z1VA 1MABG 2QDOA 2Z3YA 2VRZA 1M56C 3CXHF 2GTSA 1JX9A 4MVSA 2ZM6O 4DR1B 4MTFA 2ZE5A 2EIMC 5B1NA 1YSCA 1K5SA 2IU3A 4B3TB 5BY1A 1M9NA 4I55A 5KX5B 1I08A 1O9GA 4O4JB 2UUBO 2EZPA 4CH5A 3JCUZ 2ZE8A 1FKAO 2ZD9A 4O4IA 4LCUC 3KCXA 1V54C 4H13B 1YI2V 1G4YB 1JVMA 4JGSA 3A0HZ 3KG2A 1F51A 1W0KG 1TUEB 2UXBB 4PV1B 4L8JA 2YSUB 4MW8A 3LSQA 1ZAUA 3UO2A 5LHGA 3DGEA 5JJNB 3H1JH 4DV2O 3N2KB 1YDXA 4YHHB 4FIPC 5JJEB 3G6BA 3OGIB 2WLLB 4MS2A 2EILB 2K1EA 3CP1A 1FFXB 3HKCA 5J9PC 2L35A 5K1PA 1S5LZ 2JGDB 4UV8A 4U3FH 5KHHA 1BHBA 4GKKB 4LWSB 2CH7A 1RP3B 1L0NH 3ZN0A 2BCCH 5EBWC 1PD3A 2P7TC 4MT8A 3ZCCA 4DV2B 3JAWB 1VP7A 1BGYH 5C8YA 3BAAA 3SPGA 4JI5O 4GYCB 3DSQA 2F43G 3LNNA 1KC8W 1SQGA 5CB4B 1W59A 4LF4O 4HAMA 3ZHSA 3AG1C 3HKEB 5BR8B 1WLEA 1ZSPA 2BSKA 3PJSK 2ADPA 4D7TA 5LP6C 4DV3B 4TV9B 5JCOA 4UDMB 4JI5B 2YUAA 4FLXA 1K4CC 3CCMV 4OGQB 3RFRA 2UUBB 5GW7A 3AG2C 4J7ZA 4QJFB 3CCQV 1ENVA 2XT9A 1AI7A 1SS3A 2LW1A 5BMVA 4JTDB 5JH7A 2X6BA 4X8AA 1YJWV 2A9HA 2OCCB 2QWOB 1T5EA 4LNUA 4O4IB 1E1QG 3H1KH 3L72H 4H33A 2A7WA 1VQ4V 3AG3C 1BCCH 2EULA 3MHSC 3SPIA 2WA4A 3L70H 4EB6B 1BL8A 2P67A 5EK0A 2WPDG 4KHPB 3J80N 4U3JB 2HVJC 5BR8O 3BA8A 3STZC 4GX2A 1RPRA 4GX5A 1DK1A 1YF2A 1QCEA 1SQFA 1LR1A 4YIPA 5KLVH 4R7CA 2WLLA 4DV1O 3AK2A 1Q81W 1XQ8A 3N2GB 3ZHUA 4FM2A 4DR5B 1E1RG 3M8AA 4R8CA 1FYJA 1YIJV 2EIKB 1VQ7V 3OEHG 2CH7B 4H0LB 4JI6O 2ZXWC 3K08A 4OX9B 4JTCB 3K57A 5C8YB 5L3FA 3UQ8A 3OAAG 1PL4A 4LFAB 1FJGO 2DYSC 2EJ7A 4PA7A 4K35A 4QPKA 3A8TA 3SPJA 5IDJA 3RVZA 4WFBV 4LF5B 4BR6A 1XEQA 3QO7A 3T1YB 2KQXA 4EFBA 3ETQA 4JYAB 5LXTB 1F4MA 4G2KA 3F5WC 4JV5B 1YJ9V 4JYYA 3K04A 1FXKB 2Q0AA 1US6A 4I4TA 4UCSA 4QNHB 1SZXA 5H6RA 3CC2V 4PHZA 2F1MA 2PGGA 1Y74B 4DR1O 4DK1A 5JH7B 2BOCC 1K9MW 2O57A 4JAVA 3F7VC 4MSWC 2OTLV 1MA1A 4UV9A 2GV9A 3RYHB 4P9OA 1IX9A 2DWEC 2R9RB 2NLJC 1QVGU 4UCOA 2ZNIA 4EB6A 2VWKA 2B5UA 2JJ1G 3L73H 3E8HA 4TUYA 3I5DA 4PDVA 1AR4A 2FYUH 1V55C 2KB1A 2N05A 1GN2A 1AJNA 1VF6C 2P6JA 1MNGA 2X7RB 2WLJA 5LGUA 1WP8A 4B7KA 1XHXA 1BQZA 1ZL8B 1PL0A 1WN7A 2CTWA 2UXXA 2Y48A 4IIJA 4XDKA 1A32A 4JI7B 1XOUA 3L71H 3A0BZ 3P32A 2H94A 1OV9A 1Z2GA 3TGUH 2QKAA 3KKYA 3W7SA 4JI2B 1THZA 1EN4A 1B04A 1UPGA 4I7ZB 4RUEA 2KG7A 3BEHA 1Q6IA 2GUZA 3AG4B 2V4DA 4NR1A 2EBOA 3OR6C 5IJ9A 2GHYA 4LFAO 4LF9B 4LWSA 2YIBA 1JA8A 3JASA 3X2QB 2ITCC 5CA0B 3H1IH 2E3CA 2Q73A 2WA3A 4FPPA 4LF9O 5FNVB 3FB5C 4OX9O 1AVMA 4CS4A 3WB1A 1QLNA 1YXBA 2EIJC 1YTFD 4JI4B 2F4VO 4G28B 3CWBH 2UUCO 4LF6B 2UXDO 3SPHA 2YIBD 1TVKB 1PNLA 1N36B 2QM4A 4TV9A 1DF5A 3GWKC 4DUYO 4K8ZA 4FVMA 1S0VA 2AZ2A 5B1BC 5L3DA 1QLEC 4MVOA 2X6AA 3JAKB 4UB8Z 3TK1A 3CRCA 4LFBO 1NS1A 4JV5O 4DR4B 4YJ2B 1YJNV 1SQPH 3JYCA 5IY5C 4DR3B 1GN4A 5K1XA 1EZVH 3VBBA 1XILA 2UXDB 3T4DA 1VQOV 5BMVB 1PNKA 4BW9A 5IJ0B 4LF5O 4TSFG 5KHKA 1IZ3A 4J9YB 4DV7O 4DR7B 5A9GA 2FB5A 4TUYB 3ZEDA 4BIOA 1L8DA 2UXNA 1VF6A 2LQTA 3TJTA 2QR4A 3T2MA 1GN3A 3K5LA 4FFBB 4FJCC 4UVCA 4U3JA 2UXCO 4WFAV 3CRMA 5IWAB 1ZL8A 3U11A 3CCSV 1FPOA 2Q4PA 2HKOA 4FLUA 4CS3A 2LFSA 2EIJB 1AI6A 2LW7A 3ASNB 4ZHQB 3LDDA 5ITZA 4RQEA 2ETNA 3AG4C 5CBGA 3N2KA 1PKXA 1PNMA 1HNXO 3OW2U 2IJKA 1P4RA 3D36C 3T1YO 1P49A 3ZJZA 1NZ6A 3HKCB 2IW5A 4DV4B 3E8FA 1E44B 1M90W 4KHPO 4RQFA 5CBFA 3MHHC 3E89A 5B66Z 3B09A 1COWG 1GK9A 4K0KO 3K0DA 2QA4V 5FNVA 1GM7A 2PZSA 5JQGB 4DW1A 4WBNA 2ZR2A 4LF8O 1XMOO 5LP6B 4KL1A 2R72A 1RSOB 4KFMA 2DJVA 1XNQB 4P2ZA 4J7JA 1W2BU 5EBMC 1VIBA 4DR6B 4UVBA 3K0GA 5L3EA 2P22C 4YJ2A 4CS2A 1WJZA 1KP2A 2PYLA 3AG7A 4X1IB 5GTIZ 1Z5VA 1J5EO 3AK1A 4JYAO 4J42A 3PN1A 5IJ0A 3EXAA 4I5SA 3ZN1A 2UXBO 2RJZA 2CAZC 3ETEA 3DC6A 4R6ZA 2FL4A 4JZ2A 3U10A 1IXBA 2ZNJA 3B77A 5IT9N 4J10A 2H8PC 2IJJA 5KA6A 4LNUB 2IBZH 1EFRG 1XNRO 2JS3A 1JCHA 3SYCA 1KB9F 5KA5A 3UT5B 3OM3B 1OJHA 1XNQO 1OCZC 4GT1A 4A5UB 1LUWA 4HBNA 3SDLA 1L0LH 4JPRA 4F4LA 4ZHQA 4JAUA 1EM1A 2IH3C 5BZBA 1I94O 2WLMA 4X1KA 4JI8B 4FLTA 2HEPA 3OTOO 4X62O 2DE0X 4LF7O 1Q8IA 3J7AU 5JCOC 2FTKA 2VWJA 3Q4HA 5L3GA 1BE3H 3A0RA 4K8XA 2N74A 5HFMA 4X1YA 2UUAO 4RAIA 2WAMA 2XNDG 2KG7B 4XDLA 1H2GA 3B8NA 4LF4B 2K9PA 2Z0AA 4NVPA 4PI0A 1VQNV 5JVDA 3D36A 2HLDG 1M57B 2EJRA 2IH1C 1HNXB 1YCIA 1HW7A 3OTOB 2R70A 2DW4A 3P30A 2H3OA 3IGAC 5LP6A 1WA8A 4O2BB 4L87A 2P4KA 2VQEB
chains in the Genus database with same CATH topology
4WFHA 2QM7A 3ABKC 4WF9V 4U7NA 4GX0A 1OHHG 4FK5C 3HB3B 4QE7A 2DYRC 1M57C 2PI5A 1QVFU 3EFFK 2X0LA 4ZKIA 5IYDO 1E1RG 4R8CA 1YIJV 2EIKB 3FKSG 4ASUG 1VQ7V 2GSMB 3OEHG 4TWKA 4DXWA 3RVYA 2P90A 5CBHA 4JTAB 3QNEA 3G4SV 1S76D 2ZXWC 3K08A 2LFRA 4JTCB 4PDMA 4XDJA 5L3FA 3E86A 3OMNB 1FFTB 4LP8A 1OCOB 3OAAG 3CYOA 3CC4V 1AI5A 1K7DA 4PDLA 5EC1C 4DO2A 4P30A 2DYSC 4JYCA 4PA7A 1RM1B 4QPKA 1CPYA 1KKDA 3BY6A 1Q7YW 4X88A 1K33A 3SPJA 5LBQA 5LHHA 1R3KC 4MVZA 5IDJA 3RVZA 2IU0A 1VQPV 4WFBV 3OE7G 4WFFA 3ZMTA 1R3IC 1K34A 3QO7A 2CK3G 1XL6A 1V54B 1R6NA 4GCZA 1W0JG 3FB6C 1SETA 1F4MA 4G2KA 2QTOA 1QR9A 3JCZA 3F5WC 5IY5B 5CA3A 1YJ9V 2W0FC 1V55B 1H8HG 1DTOA 3K04A 1FXKB 1GM8A 2WLKA 4MTGA 4QNHB 4N21A 2D3OW 5H6RA 3CC2V 3CD6V 2EINB 2HR3A 5L3BA 1OCRB 3QO8A 5H6QA 1HWYA 2WLNA 1NR1A 5LGTA 3ABUA 5B3SB 2BOCC 4YXWG 1NQTA 3CCVV 1K9MW 4R50A 1FXKC 4JAVA 3F7VC 4MSWC 2OTLV 3STLC 3ZRWB 2V7QG 1VQMV 1NJIW 3WFVA 4H37A 4OXSA 4UV9A 2EILC 1K97A 1OCCC 2JDIG 3CPWU 4P9OA 1OCRC 1ORQC 1Y4MA 3ABLB 1JOYA 3AEIA 3ETGA 1KECA 2DWEC 1GO3F 2R9RB 5KUMA 4CBCA 2NLJC 5B3SC 1QVGU 1XL4A 1S3JA 3E8GA 1M56B 2EIKC 2B5UA 2JJ1G 3LSSA 3E8HA 2JIZG 3CCLV 2DQ3A 4PA9A 4PDVA 4BIZA 1MOFA 2ATKC 2IJHA 4WCEV 3E83A 1NBMG 2KB1A 1V55C 2QE7G 1VQ6V 1KD1W 5B1BB 3ZRWA 3DTUB 4JYBA 1AJNA 4UVAA 2QEXV 4MTXA 4ZBMA 3ABTA 2P6JA 4XBFA 1R3JC 4TT3G 4EKWA 1FXHA 2X7RB 2WLJA 5LGUA 1RM1C 2XAFA 2Q69A 1KQSU 1PL0A 2OT5A 2Z5UA 2DYSB 2UXXA 1DF4A 5CMUA 5EC2C 2Y48A 4XDKA 5EBLC 5DN6G 3HPLC 1YITV 2YEVB 1AJPA 4G27B 2DWDC 3P32A 2H94A 3MD0A 3CCEV 3UM7A 4HYOA 3W7SA 2PI4A 1CEZA 4PA3A 1THZA 4BW5A 1NKDA 2MK3A 4P9PA 4RUEA 3CCRV 3BEHA 1BMFG 2DQ0A 2JEUA 1SRYA 3AG4B 4RO2A 1QLEB 3F7YC 2EBOA 3OR6C 3ZMSA 3ABKB 3M99B 3JD3A 4WFGA 2GHYA 4X89A 1R6KA 4N23A 4MVRA 1QBZA 3X2QB 2ITCC 5FL7G 3K03A 4MVQA 2WWWA 3ABMC 1RPOA 2WLIA 2XAGA 3LNMB 4FPPA 2JEXA 2WSSG 1OCCB 3FB5C 3WG7C 1QLNA 2EIJC 4PDRA 1YTFD 3W7WA 2Q67A 3EHBB 4G28B 1H38A 1IXMA 3JD2A 2Q68A 3CCJV 1EBOA 2ZDIC 1BHAA 1NR7A 2JJ2G 4MW3A 2QKSA 3SPHA 1JJ2U 1B6QA 1PNLA 4LC1A 1UJWB 1DF5A 5CN0A 3WG7B 1GTOA 1F4NA 1SZTA 2HJFC 3CCUV 1GKFA 1MSWD 1S0VA 1M1KW 1WPXA 3T1CA 5B1BC 2B1GA 4UXNA 5L3DA 1QLEC 4MVOA 1SERA 2X6AA 3TK1A 2XAJA 2YEVA 1NH2B 3OMAB 1YTFB 1YHQV 4BIUA 1YJNV 1GMGA 4JF3A 3JYCA 4UUJC 5IY5C 3FB8C 3X2QC 4JASA 3VBBA 3ETDA 3T4DA 1VQOV 1PNKA 3W7UA 4TSFG 4MTOA 5LGNA 3ZMZA 2M7WA 2AHZA 3SYQA 4GX1A 4J9YB 1S72V 5B1OA 4PA4A 3K9AA 4MVMA 3OEEG 1VQ8V 1K73W 1SESA 1ROPA 3OMIB 5E1AC 3JD0A 2XOKG 4MVUA 1Q82W 3K79A 3OR7C 3I56V 5C93A 1NH2D 4KUMA 2IJIA 2ZR3A 1R73A 2UXNA 3E8BA 4QE9A 3RW0A 1J95A 3B8MA 3G71V 3LDCA 1LNQA 3T2MA 3ASNC 1S5HC 3W7XA 5KUKA 4FJCC 4UVCA 1AJQA 4U7OA 2ZXWB 2Q6AA 3SYOA 3IC7A 3JD4A 4WFAV 1ZWIC 1MABG 2Z3YA 1M56C 1JX9A 2HVKC 4MVSA 3CCSV 4MTFA 1VQLV 2HKOA 2LFSA 2LP7A 2EIJB 1AI6A 2EIMC 4HZ3A 5B1NA 1YSCA 1K5SA 3ASNB 3LDDA 2IU3A 3T4ZA 4RQEA 4I9WA 1NVPB 1M9NA 1K4DC 3W7TA 3AG4C 5CBGA 1NVPD 2EZPA 1K8AW 1PKXA 3ZIAG 3ZRVA 2Y69B 2ZD9A 1PNMA 4LCUC 3OW2U 1V54C 3G6EV 2JK5C 3SJQC 2IJKA 3GWOA 1YI2V 1G4YB 1JVMA 4JGSA 1P4RA 2ZQMA 4CZZA 2QM8A 4FMTA 3KG2A 4Z1MG 3ZJZA 1F51A 1Y66A 4Q20A 1W0KG 1TUEB 2IW5A 2YSUB 1E79G 1E44B 3E8FA 4MW8A 1M90W 1EZJA 3LSQA 4RQFA 1G8MA 2Y69C 3ASOB 3SYPA 3MHHC 3E89A 5CBFA 5B1AC 3LDEA 3DGEA 5LHGA 3AG2B 3CMEV 2V1DA 1COWG 2XAQA 4QIWF 1GK9A 3ZMVA 3I55V 3K0DA 2QA4V 1K3EA 1GM7A 4FIPC 3AG1B 2WLLB 4MS2A 2ZR2A 3ML0A 1VQ5V 2EILB 3ASOC 2K1EA 3CP1A 3FB7C 3OUFA 5J9PC 4KFMA 3K3WA 1VQ9V 4UV8A 5DM6V 3ABMB 4P2ZA 1W2BU 5EBMC 3JD1A 4LBEC 3FYIB 2C2AA 4UVBA 3K0GA 3TCUA 5L3EA 1BHBA 2DYRB 2ZDIA 2A0LA 3LUTB 4PELA 1DLBA 5LHIA 1R3LC 3ZN0A 2A79B 5EBWC 1PD3A 2HFEC 2P7TC 4MT8A 1KP2A 3ZCCA 3ZRSA 5IYCO 2WLIB 3NXSA 3SPGA 2EIMB 3FYEB 1FXVA 2F43G 1KC8W 1K5QA 3RBZA 2OCCC 3R65A 4I5SA 4HAMA 3ZN1A 3AG1C 2ITDC 5L3CA 1WLEA 2HG5C 4RUFA 3ETEA 1OZ0A 2W6IG 3PJSK 1L1FA 1VQKV 3OUSA 1OCOC 1AR1B 4R6ZA 4UDMB 3IFXA 1K4CC 2NNUA 3CCMV 1S77D 2XASA 3B77A 4PA6A 2OTJV 1OCZB 2H8PC 3TETA 1MG1A 2BOBC 2IJJA 1Q86W 5KA6A 3UKMA 3OFNG 5GW7A 1EFRG 4WFEA 2R9IA 3AG2C 5IYBO 1F23A 4QJFB 3CCQV 1ENVA 1H8EG 1AI7A 3K06A 1JPXA 4J9ZB 1JCHA 3SYCA 5KA5A 3OM3B 1OCZC 3ZRXA 4GT1A 3AG3B 4JTDB 1I5XA 4KP4A 1P7BA 4JPRA 4F4LA 2X6BA 2WLHA 2EZOA 5H9CA 4JAUA 1N8RW 4X8AA 2EINC 1QR8A 1YJWV 1I5YA 3CXCU 2A9HA 2OCCB 3CMAV 2IH3C 5BZBA 2WLMA 1E1QG 1JQ0A 3E35A 4H33A 1VQ4V 3AG3C 5B1AB 3H01A 1GM9A 3GB7C 3MHSC 2FTKA 3SPIA 2X6CA 2AHYA 5L3GA 1CP9A 1BL8A 3A0RA 2P67A 5HFMA 5EK0A 3ABLC 2WPDG 4RAIA 1AROP 2WAMA 2XNDG 5HFLA 4XDLA 1H2GA 2HVJC 3STZC 3SYAA 3B8NA 3QO5A 4GX2A 2B1IA 4QPJA 3SPCA 1FS0G 3VOUA 1VQNV 1KP3A 3ZMUA 1RPRA 4GX5A 2XAHA 3D36A 1K92A 2HLDG 1M57B 2EJRA 2IH1C 2W6JG 1QCEA 3CC7V 1FXKA 3D3IA 4R7CA 2DW4A 2WLLA 3P30A 4BAYA 4E2LA 1AI4A 3IGAC 1Q81W 3E2EA 4L87A 3OGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDM B;  2YSU B;  1E44 B;  1UJW B;  1JCH A;  2B5U A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  4GX0 A;  2DYR C;  4FM1 A;  4K3A A;  2FML A;  1TVK A;  4ASU G;  4TV8 B;  4DXW A;  2JVD A;  4JTA B;  5LMN B;  3QNE A;  2HHH O;  3G4S V;  2LFR A;  5LXT A;  3APQ A;  4XDJ A;  5IYZ B;  3E86 A;  3B2E E;  3OMN B;  4LP8 A;  1AI5 A;  1K7D A;  4I4T B;  4IT5 A;  4TOI A;  1B3Q A;  5EZY A;  3K59 A;  4NTQ A;  1K33 A;  4FLV A;  1R3K C;  3WB2 A;  5IE9 A;  5LYJ B;  4UCU A;  5D5P A;  1R3I C;  4IL6 Z;  2CK3 G;  2LGW A;  2NN4 A;  3FB6 C;  1SET A;  1BS3 A;  4X20 A;  1Q3E A;  5EIB C;  2QTO A;  1QR9 A;  2HJD A;  2W0F C;  4LFB B;  3T1H O;  1DTO A;  4KXR A;  2PF4 E;  1XDC A;  1BZK A;  1D5N A;  5L3B A;  3BPZ A;  1OCR B;  5EYP A;  1HWY A;  1DGS A;  1NR1 A;  5LGT A;  3ABU A;  3JAL A;  4R50 A;  1P7G A;  5TIS Z;  4DRX A;  1JFF B;  4H37 A;  1OCC C;  4DR2 B;  3ETG A;  3ZS8 C;  2QWR B;  3ZHV A;  4CC5 A;  1FD9 A;  1S3J A;  2Y4U A;  5H5N A;  3Q4H B;  2QWP B;  1N33 B;  1TUB B;  1VF5 B;  2DQ3 A;  4PA9 A;  3JAR A;  4NTX A;  2IJH A;  4WCE V;  3E83 A;  1VQ6 V;  4DV4 O;  1KD1 W;  1FAF A;  3QTC A;  4ZBM A;  3DXR A;  1R3J C;  4TT3 G;  1MMM A;  1RM1 C;  1Y6X A;  4X66 B;  1KQS U;  1HNZ B;  2OT5 A;  2DYS B;  5CMU A;  5EC2 C;  1D5A A;  3IJ4 A;  3UCS C;  4JI7 O;  2DWD C;  1CEZ A;  2YXY A;  4PJ0 Z;  4W4L A;  2PI4 A;  4PA3 A;  1RSO A;  3JAT B;  2MK3 A;  3BFR A;  2LO1 A;  1BMF G;  1HNW B;  1SRY A;  1QLE B;  5J2T B;  5J2U A;  2YI9 A;  3R66 A;  2UU9 B;  4MVR A;  1QBZ A;  5FL7 G;  3K03 A;  2ADQ B;  4MVQ A;  2WWW A;  4IYH A;  4CC6 A;  5JWP A;  2UU9 O;  5AG2 A;  2QWN B;  1SA0 A;  4NTY A;  1OCC B;  3NR7 A;  2GTA A;  3DC5 A;  3JAK A;  1MSD A;  1AB3 A;  3W7W A;  1RFY A;  3M7M X;  4B3S O;  2RN9 A;  2ZDI C;  1NR7 A;  2QKS A;  3SGI A;  4DR3 O;  4JI2 O;  4LC1 A;  1UJW B;  4FLY A;  3WG7 B;  1GTO A;  1SZT A;  2HJF C;  2Q7G A;  4I55 B;  2BE3 A;  3CCU V;  4I50 B;  4O4J A;  3CRR A;  2B1G A;  1SER A;  2YEV A;  1NH2 B;  4BIU A;  2YID A;  4UUJ C;  3X2Q C;  4JAS A;  1JFF A;  3W7U A;  2UUC B;  3FX7 A;  4MTO A;  2LJ2 A;  1S72 V;  4JI4 O;  2YS8 A;  1ZX3 A;  2AXT Z;  5F2V O;  1VMG A;  1K73 W;  1Q43 A;  1IBK B;  4LF7 B;  3APO A;  4X62 B;  3K58 A;  2QTS A;  2IJI A;  1SQX H;  4JI8 O;  5CA1 B;  3RW0 A;  4DR2 O;  1LNQ A;  5DEC A;  1S5H C;  2R9A A;  4O2A B;  3RYI A;  1AJQ A;  3DXR B;  3K5O A;  2Q6A A;  2DOS A;  3JD4 A;  2E74 B;  1VQL V;  4NKG B;  5JVD B;  3SJC C;  2LP7 A;  3CRA A;  4HZ3 A;  1GAX A;  1NVP B;  5FPO A;  1WA8 B;  4O2B A;  5D5Q A;  2F23 A;  3G6E V;  5JQG A;  2JK5 C;  2QM8 A;  4FMT A;  1Y66 A;  2CUG A;  3ICX A;  1E79 G;  4DYL A;  1G8M A;  3SYP A;  2E5L B;  4NXN B;  1GH6 A;  3P3N A;  3AG2 B;  1J5E B;  1SQV H;  2V1D A;  2A3Q A;  2XAQ A;  4QIW F;  3O65 A;  1K3E A;  1UFI A;  4J41 A;  4YJ3 B;  3U0Z A;  4J7K A;  3K5M A;  3ML0 A;  1VQ5 V;  2ZE6 A;  3KCY A;  5LL6 Y;  3WB0 A;  2E76 B;  4X1I A;  4UFZ A;  3OUF A;  2ARH A;  3RYC A;  3RYF B;  5LMU B;  5LYJ A;  3ZBH A;  3K3W A;  4DUZ B;  1VQ9 V;  4DUZ O;  5LMU O;  4J80 A;  3JD1 A;  4LBE C;  3FYI B;  2ZDI A;  2PY5 A;  2A0L A;  3LUT B;  2OWO A;  4PEL A;  1DLB A;  2A79 B;  3RT3 C;  3ZRS A;  2CDY A;  3NXS A;  1JJO A;  4ZI7 A;  2EIM B;  4DK0 A;  2YXH A;  2E5L O;  5FPR A;  4AQY O;  1K5Q A;  2ZT9 B;  3RBZ A;  3JAL B;  3R65 A;  4X65 O;  4DV5 B;  5L3C A;  2AW9 A;  4RUF A;  2UUA B;  3UT5 A;  1L1F A;  4HNA B;  3CRQ A;  1AR1 B;  2BTQ B;  1FJG B;  2NNU A;  1S77 D;  4PA6 A;  1NU1 H;  2AGA A;  2OTJ V;  4E4E A;  4FZ0 A;  3TET A;  2Y0I A;  3UKM A;  4X1K B;  3OFN G;  2VS0 A;  4O2A A;  3RYI B;  4B3T O;  2R9I A;  2ZIM A;  5IYB O;  1F23 A;  3CSX A;  3TXQ A;  1XI1 A;  2F95 B;  1FFX A;  1JPX A;  4J9Z B;  4ZIB A;  4PI2 A;  4X1Y B;  3ZRX A;  3AG3 B;  4DR5 O;  4KP4 A;  2WLH A;  2EZO A;  4J11 A;  3C3S A;  3CXC U;  2CGN A;  3JSL A;  5B5E Z;  3E35 A;  1IBL O;  2CE4 A;  2RMK B;  3C90 A;  3JAW A;  5BXZ A;  4DR7 O;  1CP9 A;  2JGU A;  4DV3 O;  2ZIO A;  5GTH Z;  3ABL C;  1ARO P;  3MDS A;  5CB4 A;  3SYA A;  2M6Y A;  1JMK C;  2XHB A;  2B1I A;  1SF9 A;  1Q6H A;  3VOU A;  5J2T A;  3JAM N;  3RWR D;  2BSK B;  2XAH A;  4UCR A;  4TV8 A;  3CC7 V;  1FXK A;  3CEI A;  4BAY A;  4E2L A;  2OYQ A;  1QHT A;  3CB2 A;  3ZHQ A;  4CH6 A;  3OGC C;  5LA6 B;  2NR5 A;  3OTF A;  2ILM A;  3ABK C;  3HKB B;  3RYF A;  1IUR A;  3OT7 A;  1OHH G;  4FK5 C;  1Y74 A;  4QE7 A;  2PI5 A;  1Q90 D;  2ZKO A;  4ZKI A;  5IYD O;  3ZX6 A;  2Y4T A;  3FKS G;  2GSM B;  4TWK A;  3RVY A;  4IHJ A;  1S76 D;  4FZ1 A;  4I50 A;  4PDM A;  1TAE A;  3BRC A;  4ZI7 B;  1XMQ O;  2OIG A;  3CC4 V;  1YEW A;  5EC1 C;  4PDL A;  1H2S B;  3B4S A;  1KKD A;  2RQ6 A;  1H2K A;  3BY6 A;  1Q7Y W;  5LHH A;  1CXZ B;  4Z2W A;  4MVZ A;  4B7E A;  2IU0 A;  1VQP V;  3OE7 G;  1NI8 A;  4HNA A;  4WFF A;  3ZMT A;  3BVO A;  4DV5 O;  1WNS A;  1U97 A;  4GZR B;  1XL6 A;  1V54 B;  4GCZ A;  1H2M A;  1W0J G;  4AHC A;  4DRX B;  1Q5O A;  4OPA A;  2QSA A;  1VEW A;  1KYO F;  2Q5Z A;  3H1L H;  3JCZ A;  5CA3 A;  5H2F Z;  1H8H G;  2OCH A;  2WLK A;  1IBM B;  5CA1 A;  5KAF Z;  3FD9 A;  4N21 A;  3F5T A;  3IC9 A;  1AP5 A;  1HNZ O;  1TUB A;  1N36 O;  3JAR B;  3N2G A;  1M5I A;  4YXW G;  3CCV V;  1NQT A;  3BCC H;  5IWA O;  1FXK C;  4ABM A;  2P06 A;  1VQM V;  1NTM H;  2EIL C;  1K97 A;  2VQF O;  2JDI G;  3VQW A;  3CPW U;  3FFQ A;  1XMO B;  1Y4M A;  3ABL B;  1JOY A;  2B9Z A;  1N33 O;  3TXS A;  5CA0 A;  4YHH O;  1XRE A;  1M56 B;  1MZF A;  2EIK C;  1IBK O;  4UCT A;  5KHI A;  2ATK C;  4DV7 B;  1NBM G;  2FKX A;  1SQQ H;  4FLW A;  3ZRW A;  4JYB A;  4JI0 B;  2QEX V;  4MTX A;  3THO A;  4UB6 Z;  3G67 A;  1FXH A;  1Q6U A;  4NXM B;  2Q69 A;  1KU9 A;  3MAQ A;  1DF4 A;  1EN6 A;  2YXL A;  5DN6 G;  1IBM O;  4YJ3 A;  3FAV A;  4G27 B;  3D8C A;  3MD0 A;  4NXM O;  3RYC B;  4BW5 A;  1HR0 O;  2ZCE A;  2D2C B;  3A2F A;  4RWU A;  3SR2 C;  3ZHR A;  2Q7H A;  3CCR V;  2JEU A;  3ABK B;  3M99 B;  1EN5 A;  3QVN A;  4X89 A;  3CJH B;  1R6K A;  4N23 A;  1VF7 A;  2F93 B;  3ABM C;  1PM9 A;  1RPO A;  2RDC A;  2XAG A;  4FLZ A;  4F6E A;  4FFB A;  1B06 A;  4PDR A;  1N0N A;  2PUS A;  1WB7 A;  2Q8V A;  4O4H A;  1Z5W A;  1H38 A;  1IXM A;  3JD2 A;  2Q68 A;  3HR0 A;  3CCJ V;  1BHA A;  2JJ2 G;  4MW3 A;  1JJ2 U;  4NYK A;  2RCV A;  4X9Q A;  2XUM A;  1B6Q A;  1LUV A;  2BTQ A;  4C7U A;  1GKF A;  1M1K W;  2N04 A;  1WPX A;  4F6R B;  3T1H B;  2XAJ A;  4NB5 A;  3K5N A;  3OMA B;  1QU7 A;  1GMG A;  4GLX A;  4LH6 A;  3RN4 A;  1Y76 B;  5KMG A;  5DED A;  3ETD A;  4B3M B;  5GON B;  2A06 H;  4TQD A;  5LGN A;  2AHZ A;  3SYQ A;  4ZOL B;  4PA4 A;  3OEE G;  1VQ8 V;  1H2N A;  1ROP A;  3OMI B;  5E1A C;  3L74 H;  4MVU A;  1IBL B;  3K79 A;  3OR7 C;  3I56 V;  5C93 A;  1NH2 D;  4GKJ B;  4KUM A;  4WBN B;  4B3R B;  1R73 A;  3E8B A;  2HP8 A;  3G71 V;  4FFK A;  4IGG A;  2XTA A;  4I9Q A;  4JI6 B;  3LDC A;  3B40 A;  3ASN C;  3KZI Z;  3W7X A;  2VQF B;  1ZUQ A;  4DW0 A;  4JAA A;  3IC7 A;  1ZWI C;  1G6U A;  2HVK C;  3QF7 A;  1AIL A;  1S5J A;  3T4Z A;  3G80 A;  4I9W A;  1K4D C;  3VQV A;  3W7T A;  1NVP D;  4X64 B;  2OIE A;  5KHJ A;  1K8A W;  3ZIA G;  1N34 O;  3ZRV A;  2Y69 B;  1JR9 A;  1M93 A;  1H2L A;  5LA6 A;  3HKB A;  3SJQ C;  3GWO A;  1XHZ A;  2Q0O C;  2ZQM A;  1N4C A;  4CZZ A;  3BAB A;  4Z1M G;  4CH3 A;  4Q20 A;  3L75 H;  4JI0 O;  1EZJ A;  4AQY B;  1I0H A;  3ASO B;  2Y69 C;  1KBH A;  5B1A C;  3HKD A;  3LDE A;  3CX5 F;  4IHJ B;  2QJ1 A;  3CME V;  3L9D A;  5KHG A;  3ZMV A;  3I55 V;  2CTQ A;  2YIC A;  3JSN A;  2GBO A;  3AG1 B;  2YC0 A;  4O4H B;  2JRI A;  3ASO C;  3FB7 C;  1X59 A;  2Y0P A;  1WP7 A;  2PYJ A;  3RGB A;  5DM6 V;  3ABM B;  2C2A A;  3TCU A;  4F6R A;  2G38 A;  4I0X B;  2DYR B;  2Q7E A;  1XNR B;  5ITZ B;  5A2Q N;  4DV1 B;  5LHI A;  1R3L C;  2HFE C;  5IYC O;  2WLI B;  1Y76 A;  2CTP A;  3FYE B;  1FXV A;  1WB8 A;  2OCC C;  4JI1 B;  2ITD C;  4X65 B;  1R1B A;  1KUQ A;  2HG5 C;  1U96 A;  1OZ0 A;  1I7F A;  2W6I G;  1VQK V;  3OUS A;  1OCO C;  3IFX A;  1PP9 H;  1NTZ H;  2XAS A;  1OCZ B;  1MG1 A;  2BOB C;  1Q86 W;  3LSU A;  4WFE A;  1F7Y A;  2KSD A;  2HHH B;  4W4K A;  1H8E G;  3K06 A;  2ZIN A;  1AP6 A;  4GUN A;  2GDS A;  2DMX A;  3H9V A;  1NTK H;  2QKC A;  1I5X A;  1P7B A;  4IYI A;  5H9C A;  1N8R W;  3CHX A;  2EIN C;  1QR8 A;  3VQX A;  4LF8 B;  1I5Y A;  3SJA C;  4TQF A;  3CMA V;  3ZHT A;  1JQ0 A;  3FAV B;  2Q9L A;  4LFC B;  4LH7 A;  5B1A B;  3H01 A;  5EZY B;  1GM9 A;  3GB7 C;  2X6C A;  4NXN O;  2AHY A;  4CH4 A;  5HFL A;  3CS5 A;  2QWQ B;  1N0J A;  4B3M O;  3QO5 A;  3OD4 A;  1MZE A;  4QPJ A;  1FS0 G;  3SPC A;  1KP3 A;  3ZMU A;  4X20 B;  1XUQ A;  2QGN A;  1K92 A;  4LR3 A;  2ZE7 A;  2W6J G;  3D3I A;  1AI4 A;  1VAR A;  3IAY A;  2P4V A;  1GRJ A;  1I94 B;  2CTR A;  3E2E A;  5EYP B;  4WFH A;  1QNM A;  4U7N A;  4WF9 V;  3HB3 B;  4DR6 O;  1N32 O;  1M57 C;  1QVF U;  1BQ0 A;  1WAZ A;  3EFF K;  2X0L A;  3AK3 A;  5LOV A;  5EIB D;  1R6T A;  4ICG A;  5CBH A;  2P90 A;  1P84 F;  3S3W A;  2W0X A;  2YIA A;  4GKJ O;  3E22 A;  4AIL C;  1FFT B;  1OCO B;  3CYO A;  2DN9 A;  2ODM A;  4DO2 A;  3CE2 A;  1PPJ H;  4P30 A;  4JYC A;  1RM1 B;  1CPY A;  2IM9 A;  4X88 A;  4JI3 B;  5LBQ A;  3N27 A;  3D3Q A;  4B08 A;  4JI1 O;  1K34 A;  2JGD A;  3GVM A;  1HR0 B;  1R6N A;  5FLX N;  2YDE A;  5IY5 B;  1IDS A;  1V55 B;  1V9P A;  4DV6 B;  1GM8 A;  1KKC A;  1TGO A;  4MTG A;  2D3O W;  4GKK O;  3CD6 V;  2EIN B;  2HR3 A;  2PTM A;  2CGO A;  3QO8 A;  1YZB A;  4UCV A;  4PD4 F;  5H6Q A;  4FM0 A;  2RNB A;  3JAT A;  2WLN A;  5B3S B;  4Q6G A;  2JS5 A;  1IVS A;  2UXC B;  3STL C;  3ZRW B;  2V7Q G;  1NJI W;  3WFV A;  4OXS A;  2P5O A;  1OCR C;  1ORQ C;  3AEI A;  1KEC A;  1GO3 F;  5KUM A;  3SJB C;  4CBC A;  3BHP A;  5B3S C;  1XL4 A;  3S3X A;  3E8G A;  4O4L A;  4AI8 A;  3K9S A;  4K0K B;  5IYZ A;  3LSS A;  3CCL V;  2JIZ G;  4BIZ A;  1MOF A;  1M4U A;  1Y67 A;  2QE7 G;  4BWA A;  4EEQ A;  1HNW O;  5B1B B;  3DTU B;  4UVA A;  4NTW A;  4H44 B;  3ABT A;  1BSM A;  3RYH A;  4XBF A;  4EKW A;  4D7S A;  2LGQ A;  3HKD B;  2XAF A;  2Z5U A;  1HP8 A;  1N34 B;  5EBL C;  1XBL A;  4X64 O;  3HPL C;  3CJH A;  1YIT V;  2YEV B;  1AJP A;  5KX5 A;  1TA8 A;  1NT2 B;  3CCE V;  4DUY B;  3J81 N;  1YVW A;  4YIO A;  5JJJ B;  3UM7 A;  2BTO A;  4HYO A;  5LOV B;  3P3P A;  3O9O A;  4DV0 O;  2ZM6 B;  3EVK A;  1NKD A;  4P9P A;  3VQY A;  4LF6 O;  4YY3 O;  1WPB A;  2DQ0 A;  1URF A;  2E75 B;  4RO2 A;  3F7Y C;  2F4V B;  3ZMS A;  3WU2 Z;  4IIJ B;  4I0X A;  3JD3 A;  4WFG A;  3E22 B;  4B3R O;  5E79 Z;  3H1H H;  2WLI A;  3LNM B;  1QQC A;  2KKW A;  2JEX A;  2WSS G;  3WG7 C;  3C3T A;  2MW2 B;  2Q67 A;  1AR5 A;  3EHB B;  2GUZ B;  4YY3 B;  1EBO A;  1SQB H;  2AZ0 A;  5KMG B;  5GON A;  5IJ9 B;  4DV0 B;  1N32 B;  5CN0 A;  1G1X B;  4ZOL A;  1F4N A;  3JAS B;  2L6L A;  4DR4 O;  2VQE O;  3UO3 A;  4OPH A;  1MSW D;  2YI8 A;  3T1C A;  4DV6 O;  4UXN A;  1HDJ A;  1GN6 A;  1YTF B;  1YHQ V;  4JF3 A;  1D2D A;  4X66 O;  3FB8 C;  1BT8 A;  3QG5 A;  1PV0 A;  1X4T A;  2EX3 A;  4B3S B;  3ZMZ A;  2M7W A;  4GX1 A;  4QGP A;  4JI3 O;  5B1O A;  3HKE A;  5KAI Z;  3K9A A;  4MVM A;  4JZG A;  5J2U B;  1SES A;  4O4L B;  3JD0 A;  2XOK G;  1Q82 W;  4LFC O;  1XMQ B;  4EFE A;  1SKV A;  2ZR3 A;  4QE9 A;  1J95 A;  3B8M A;  1SC5 B;  1ZTE A;  1SA0 B;  5LMN O;  1O9H A;  5KUK A;  2F66 C;  4D6T H;  3BA9 A;  4U7O A;  2ZXW B;  3SYO A;  1KMI Z;  1ZLZ A;  4Z1V A;  1MAB G;  2QDO A;  2Z3Y A;  2VRZ A;  1M56 C;  3CXH F;  2GTS A;  1JX9 A;  4MVS A;  2ZM6 O;  4DR1 B;  4MTF A;  2ZE5 A;  2EIM C;  5B1N A;  1YSC A;  1K5S A;  2IU3 A;  4B3T B;  5BY1 A;  1M9N A;  4I55 A;  5KX5 B;  1I08 A;  1O9G A;  4O4J B;  2UUB O;  2EZP A;  4CH5 A;  3JCU Z;  2ZE8 A;  1FKA O;  2ZD9 A;  4O4I A;  4LCU C;  3KCX A;  1V54 C;  4H13 B;  1YI2 V;  1G4Y B;  1JVM A;  4JGS A;  3A0H Z;  3KG2 A;  1F51 A;  1W0K G;  1TUE B;  2UXB B;  4PV1 B;  4L8J A;  2YSU B;  4MW8 A;  3LSQ A;  1ZAU A;  3UO2 A;  5LHG A;  3DGE A;  5JJN B;  3H1J H;  4DV2 O;  3N2K B;  1YDX A;  4YHH B;  4FIP C;  5JJE B;  3G6B A;  3OGI B;  2WLL B;  4MS2 A;  2EIL B;  2K1E A;  3CP1 A;  1FFX B;  3HKC A;  5J9P C;  2L35 A;  5K1P A;  1S5L Z;  2JGD B;  4UV8 A;  4U3F H;  5KHH A;  1BHB A;  4GKK B;  4LWS B;  2CH7 A;  1RP3 B;  1L0N H;  3ZN0 A;  2BCC H;  5EBW C;  1PD3 A;  2P7T C;  4MT8 A;  3ZCC A;  4DV2 B;  3JAW B;  1VP7 A;  1BGY H;  5C8Y A;  3BAA A;  3SPG A;  4JI5 O;  4GYC B;  3DSQ A;  2F43 G;  3LNN A;  1KC8 W;  1SQG A;  5CB4 B;  1W59 A;  4LF4 O;  4HAM A;  3ZHS A;  3AG1 C;  3HKE B;  5BR8 B;  1WLE A;  1ZSP A;  2BSK A;  3PJS K;  2ADP A;  4D7T A;  5LP6 C;  4DV3 B;  4TV9 B;  5JCO A;  4UDM B;  4JI5 B;  2YUA A;  4FLX A;  1K4C C;  3CCM V;  4OGQ B;  3RFR A;  2UUB B;  5GW7 A;  3AG2 C;  4J7Z A;  4QJF B;  3CCQ V;  1ENV A;  2XT9 A;  1AI7 A;  1SS3 A;  2LW1 A;  5BMV A;  4JTD B;  5JH7 A;  2X6B A;  4X8A A;  1YJW V;  2A9H A;  2OCC B;  2QWO B;  1T5E A;  4LNU A;  4O4I B;  1E1Q G;  3H1K H;  3L72 H;  4H33 A;  2A7W A;  1VQ4 V;  3AG3 C;  1BCC H;  2EUL A;  3MHS C;  3SPI A;  2WA4 A;  3L70 H;  4EB6 B;  1BL8 A;  2P67 A;  5EK0 A;  2WPD G;  4KHP B;  3J80 N;  4U3J B;  2HVJ C;  5BR8 O;  3BA8 A;  3STZ C;  4GX2 A;  1RPR A;  4GX5 A;  1DK1 A;  1YF2 A;  1QCE A;  1SQF A;  1LR1 A;  4YIP A;  5KLV H;  4R7C A;  2WLL A;  4DV1 O;  3AK2 A;  1Q81 W;  1XQ8 A;  3N2G B;  3ZHU A;  4FM2 A;  4DR5 B;  1E1R G;  3M8A A;  4R8C A;  1FYJ A;  1YIJ V;  2EIK B;  1VQ7 V;  3OEH G;  2CH7 B;  4H0L B;  4JI6 O;  2ZXW C;  3K08 A;  4OX9 B;  4JTC B;  3K57 A;  5C8Y B;  5L3F A;  3UQ8 A;  3OAA G;  1PL4 A;  4LFA B;  1FJG O;  2DYS C;  2EJ7 A;  4PA7 A;  4K35 A;  4QPK A;  3A8T A;  3SPJ A;  5IDJ A;  3RVZ A;  4WFB V;  4LF5 B;  4BR6 A;  1XEQ A;  3QO7 A;  3T1Y B;  2KQX A;  4EFB A;  3ETQ A;  4JYA B;  5LXT B;  1F4M A;  4G2K A;  3F5W C;  4JV5 B;  1YJ9 V;  4JYY A;  3K04 A;  1FXK B;  2Q0A A;  1US6 A;  4I4T A;  4UCS A;  4QNH B;  1SZX A;  5H6R A;  3CC2 V;  4PHZ A;  2F1M A;  2PGG A;  1Y74 B;  4DR1 O;  4DK1 A;  5JH7 B;  2BOC C;  1K9M W;  2O57 A;  4JAV A;  3F7V C;  4MSW C;  2OTL V;  1MA1 A;  4UV9 A;  2GV9 A;  3RYH B;  4P9O A;  1IX9 A;  2DWE C;  2R9R B;  2NLJ C;  1QVG U;  4UCO A;  2ZNI A;  4EB6 A;  2VWK A;  2B5U A;  2JJ1 G;  3L73 H;  3E8H A;  4TUY A;  3I5D A;  4PDV A;  1AR4 A;  2FYU H;  1V55 C;  2KB1 A;  2N05 A;  1GN2 A;  1AJN A;  1VF6 C;  2P6J A;  1MNG A;  2X7R B;  2WLJ A;  5LGU A;  1WP8 A;  4B7K A;  1XHX A;  1BQZ A;  1ZL8 B;  1PL0 A;  1WN7 A;  2CTW A;  2UXX A;  2Y48 A;  4IIJ A;  4XDK A;  1A32 A;  4JI7 B;  1XOU A;  3L71 H;  3A0B Z;  3P32 A;  2H94 A;  1OV9 A;  1Z2G A;  3TGU H;  2QKA A;  3KKY A;  3W7S A;  4JI2 B;  1THZ A;  1EN4 A;  1B04 A;  1UPG A;  4I7Z B;  4RUE A;  2KG7 A;  3BEH A;  1Q6I A;  2GUZ A;  3AG4 B;  2V4D A;  4NR1 A;  2EBO A;  3OR6 C;  5IJ9 A;  2GHY A;  4LFA O;  4LF9 B;  4LWS A;  2YIB A;  1JA8 A;  3JAS A;  3X2Q B;  2ITC C;  5CA0 B;  3H1I H;  2E3C A;  2Q73 A;  2WA3 A;  4FPP A;  4LF9 O;  5FNV B;  3FB5 C;  4OX9 O;  1AVM A;  4CS4 A;  3WB1 A;  1QLN A;  1YXB A;  2EIJ C;  1YTF D;  4JI4 B;  2F4V O;  4G28 B;  3CWB H;  2UUC O;  4LF6 B;  2UXD O;  3SPH A;  2YIB D;  1TVK B;  1PNL A;  1N36 B;  2QM4 A;  4TV9 A;  1DF5 A;  3GWK C;  4DUY O;  4K8Z A;  4FVM A;  1S0V A;  2AZ2 A;  5B1B C;  5L3D A;  1QLE C;  4MVO A;  2X6A A;  3JAK B;  4UB8 Z;  3TK1 A;  3CRC A;  4LFB O;  1NS1 A;  4JV5 O;  4DR4 B;  4YJ2 B;  1YJN V;  1SQP H;  3JYC A;  5IY5 C;  4DR3 B;  1GN4 A;  5K1X A;  1EZV H;  3VBB A;  1XIL A;  2UXD B;  3T4D A;  1VQO V;  5BMV B;  1PNK A;  4BW9 A;  5IJ0 B;  4LF5 O;  4TSF G;  5KHK A;  1IZ3 A;  4J9Y B;  4DV7 O;  4DR7 B;  5A9G A;  2FB5 A;  4TUY B;  3ZED A;  4BIO A;  1L8D A;  2UXN A;  1VF6 A;  2LQT A;  3TJT A;  2QR4 A;  3T2M A;  1GN3 A;  3K5L A;  4FFB B;  4FJC C;  4UVC A;  4U3J A;  2UXC O;  4WFA V;  3CRM A;  5IWA B;  1ZL8 A;  3U11 A;  3CCS V;  1FPO A;  2Q4P A;  2HKO A;  4FLU A;  4CS3 A;  2LFS A;  2EIJ B;  1AI6 A;  2LW7 A;  3ASN B;  4ZHQ B;  3LDD A;  5ITZ A;  4RQE A;  2ETN A;  3AG4 C;  5CBG A;  3N2K A;  1PKX A;  1PNM A;  1HNX O;  3OW2 U;  2IJK A;  1P4R A;  3D36 C;  3T1Y O;  1P49 A;  3ZJZ A;  1NZ6 A;  3HKC B;  2IW5 A;  4DV4 B;  3E8F A;  1E44 B;  1M90 W;  4KHP O;  4RQF A;  5CBF A;  3MHH C;  3E89 A;  5B66 Z;  3B09 A;  1COW G;  1GK9 A;  4K0K O;  3K0D A;  2QA4 V;  5FNV A;  1GM7 A;  2PZS A;  5JQG B;  4DW1 A;  4WBN A;  2ZR2 A;  4LF8 O;  1XMO O;  5LP6 B;  4KL1 A;  2R72 A;  1RSO B;  4KFM A;  2DJV A;  1XNQ B;  4P2Z A;  4J7J A;  1W2B U;  5EBM C;  1VIB A;  4DR6 B;  4UVB A;  3K0G A;  5L3E A;  2P22 C;  4YJ2 A;  4CS2 A;  1WJZ A;  1KP2 A;  2PYL A;  3AG7 A;  4X1I B;  5GTI Z;  1Z5V A;  1J5E O;  3AK1 A;  4JYA O;  4J42 A;  3PN1 A;  5IJ0 A;  3EXA A;  4I5S A;  3ZN1 A;  2UXB O;  2RJZ A;  2CAZ C;  3ETE A;  3DC6 A;  4R6Z A;  2FL4 A;  4JZ2 A;  3U10 A;  1IXB A;  2ZNJ A;  3B77 A;  5IT9 N;  4J10 A;  2H8P C;  2IJJ A;  5KA6 A;  4LNU B;  2IBZ H;  1EFR G;  1XNR O;  2JS3 A;  1JCH A;  3SYC A;  1KB9 F;  5KA5 A;  3UT5 B;  3OM3 B;  1OJH A;  1XNQ O;  1OCZ C;  4GT1 A;  4A5U B;  1LUW A;  4HBN A;  3SDL A;  1L0L H;  4JPR A;  4F4L A;  4ZHQ A;  4JAU A;  1EM1 A;  2IH3 C;  5BZB A;  1I94 O;  2WLM A;  4X1K A;  4JI8 B;  4FLT A;  2HEP A;  3OTO O;  4X62 O;  2DE0 X;  4LF7 O;  1Q8I A;  3J7A U;  5JCO C;  2FTK A;  2VWJ A;  3Q4H A;  5L3G A;  1BE3 H;  3A0R A;  4K8X A;  2N74 A;  5HFM A;  4X1Y A;  2UUA O;  4RAI A;  2WAM A;  2XND G;  2KG7 B;  4XDL A;  1H2G A;  3B8N A;  4LF4 B;  2K9P A;  2Z0A A;  4NVP A;  4PI0 A;  1VQN V;  5JVD A;  3D36 A;  2HLD G;  1M57 B;  2EJR A;  2IH1 C;  1HNX B;  1YCI A;  1HW7 A;  3OTO B;  2R70 A;  2DW4 A;  3P30 A;  2H3O A;  3IGA C;  5LP6 A;  1WA8 A;  4O2B B;  4L87 A;  2P4K A;  2VQE B; 
#chains in the Genus database with same CATH homology
 4WFH A;  2QM7 A;  3ABK C;  4WF9 V;  4U7N A;  4GX0 A;  1OHH G;  4FK5 C;  3HB3 B;  4QE7 A;  2DYR C;  1M57 C;  2PI5 A;  1QVF U;  3EFF K;  2X0L A;  4ZKI A;  5IYD O;  1E1R G;  4R8C A;  1YIJ V;  2EIK B;  3FKS G;  4ASU G;  1VQ7 V;  2GSM B;  3OEH G;  4TWK A;  4DXW A;  3RVY A;  2P90 A;  5CBH A;  4JTA B;  3QNE A;  3G4S V;  1S76 D;  2ZXW C;  3K08 A;  2LFR A;  4JTC B;  4PDM A;  4XDJ A;  5L3F A;  3E86 A;  3OMN B;  1FFT B;  4LP8 A;  1OCO B;  3OAA G;  3CYO A;  3CC4 V;  1AI5 A;  1K7D A;  4PDL A;  5EC1 C;  4DO2 A;  4P30 A;  2DYS C;  4JYC A;  4PA7 A;  1RM1 B;  4QPK A;  1CPY A;  1KKD A;  3BY6 A;  1Q7Y W;  4X88 A;  1K33 A;  3SPJ A;  5LBQ A;  5LHH A;  1R3K C;  4MVZ A;  5IDJ A;  3RVZ A;  2IU0 A;  1VQP V;  4WFB V;  3OE7 G;  4WFF A;  3ZMT A;  1R3I C;  1K34 A;  3QO7 A;  2CK3 G;  1XL6 A;  1V54 B;  1R6N A;  4GCZ A;  1W0J G;  3FB6 C;  1SET A;  1F4M A;  4G2K A;  2QTO A;  1QR9 A;  3JCZ A;  3F5W C;  5IY5 B;  5CA3 A;  1YJ9 V;  2W0F C;  1V55 B;  1H8H G;  1DTO A;  3K04 A;  1FXK B;  1GM8 A;  2WLK A;  4MTG A;  4QNH B;  4N21 A;  2D3O W;  5H6R A;  3CC2 V;  3CD6 V;  2EIN B;  2HR3 A;  5L3B A;  1OCR B;  3QO8 A;  5H6Q A;  1HWY A;  2WLN A;  1NR1 A;  5LGT A;  3ABU A;  5B3S B;  2BOC C;  4YXW G;  1NQT A;  3CCV V;  1K9M W;  4R50 A;  1FXK C;  4JAV A;  3F7V C;  4MSW C;  2OTL V;  3STL C;  3ZRW B;  2V7Q G;  1VQM V;  1NJI W;  3WFV A;  4H37 A;  4OXS A;  4UV9 A;  2EIL C;  1K97 A;  1OCC C;  2JDI G;  3CPW U;  4P9O A;  1OCR C;  1ORQ C;  1Y4M A;  3ABL B;  1JOY A;  3AEI A;  3ETG A;  1KEC A;  2DWE C;  1GO3 F;  2R9R B;  5KUM A;  4CBC A;  2NLJ C;  5B3S C;  1QVG U;  1XL4 A;  1S3J A;  3E8G A;  1M56 B;  2EIK C;  2B5U A;  2JJ1 G;  3LSS A;  3E8H A;  2JIZ G;  3CCL V;  2DQ3 A;  4PA9 A;  4PDV A;  4BIZ A;  1MOF A;  2ATK C;  2IJH A;  4WCE V;  3E83 A;  1NBM G;  2KB1 A;  1V55 C;  2QE7 G;  1VQ6 V;  1KD1 W;  5B1B B;  3ZRW A;  3DTU B;  4JYB A;  1AJN A;  4UVA A;  2QEX V;  4MTX A;  4ZBM A;  3ABT A;  2P6J A;  4XBF A;  1R3J C;  4TT3 G;  4EKW A;  1FXH A;  2X7R B;  2WLJ A;  5LGU A;  1RM1 C;  2XAF A;  2Q69 A;  1KQS U;  1PL0 A;  2OT5 A;  2Z5U A;  2DYS B;  2UXX A;  1DF4 A;  5CMU A;  5EC2 C;  2Y48 A;  4XDK A;  5EBL C;  5DN6 G;  3HPL C;  1YIT V;  2YEV B;  1AJP A;  4G27 B;  2DWD C;  3P32 A;  2H94 A;  3MD0 A;  3CCE V;  3UM7 A;  4HYO A;  3W7S A;  2PI4 A;  1CEZ A;  4PA3 A;  1THZ A;  4BW5 A;  1NKD A;  2MK3 A;  4P9P A;  4RUE A;  3CCR V;  3BEH A;  1BMF G;  2DQ0 A;  2JEU A;  1SRY A;  3AG4 B;  4RO2 A;  1QLE B;  3F7Y C;  2EBO A;  3OR6 C;  3ZMS A;  3ABK B;  3M99 B;  3JD3 A;  4WFG A;  2GHY A;  4X89 A;  1R6K A;  4N23 A;  4MVR A;  1QBZ A;  3X2Q B;  2ITC C;  5FL7 G;  3K03 A;  4MVQ A;  2WWW A;  3ABM C;  1RPO A;  2WLI A;  2XAG A;  3LNM B;  4FPP A;  2JEX A;  2WSS G;  1OCC B;  3FB5 C;  3WG7 C;  1QLN A;  2EIJ C;  4PDR A;  1YTF D;  3W7W A;  2Q67 A;  3EHB B;  4G28 B;  1H38 A;  1IXM A;  3JD2 A;  2Q68 A;  3CCJ V;  1EBO A;  2ZDI C;  1BHA A;  1NR7 A;  2JJ2 G;  4MW3 A;  2QKS A;  3SPH A;  1JJ2 U;  1B6Q A;  1PNL A;  4LC1 A;  1UJW B;  1DF5 A;  5CN0 A;  3WG7 B;  1GTO A;  1F4N A;  1SZT A;  2HJF C;  3CCU V;  1GKF A;  1MSW D;  1S0V A;  1M1K W;  1WPX A;  3T1C A;  5B1B C;  2B1G A;  4UXN A;  5L3D A;  1QLE C;  4MVO A;  1SER A;  2X6A A;  3TK1 A;  2XAJ A;  2YEV A;  1NH2 B;  3OMA B;  1YTF B;  1YHQ V;  4BIU A;  1YJN V;  1GMG A;  4JF3 A;  3JYC A;  4UUJ C;  5IY5 C;  3FB8 C;  3X2Q C;  4JAS A;  3VBB A;  3ETD A;  3T4D A;  1VQO V;  1PNK A;  3W7U A;  4TSF G;  4MTO A;  5LGN A;  3ZMZ A;  2M7W A;  2AHZ A;  3SYQ A;  4GX1 A;  4J9Y B;  1S72 V;  5B1O A;  4PA4 A;  3K9A A;  4MVM A;  3OEE G;  1VQ8 V;  1K73 W;  1SES A;  1ROP A;  3OMI B;  5E1A C;  3JD0 A;  2XOK G;  4MVU A;  1Q82 W;  3K79 A;  3OR7 C;  3I56 V;  5C93 A;  1NH2 D;  4KUM A;  2IJI A;  2ZR3 A;  1R73 A;  2UXN A;  3E8B A;  4QE9 A;  3RW0 A;  1J95 A;  3B8M A;  3G71 V;  3LDC A;  1LNQ A;  3T2M A;  3ASN C;  1S5H C;  3W7X A;  5KUK A;  4FJC C;  4UVC A;  1AJQ A;  4U7O A;  2ZXW B;  2Q6A A;  3SYO A;  3IC7 A;  3JD4 A;  4WFA V;  1ZWI C;  1MAB G;  2Z3Y A;  1M56 C;  1JX9 A;  2HVK C;  4MVS A;  3CCS V;  4MTF A;  1VQL V;  2HKO A;  2LFS A;  2LP7 A;  2EIJ B;  1AI6 A;  2EIM C;  4HZ3 A;  5B1N A;  1YSC A;  1K5S A;  3ASN B;  3LDD A;  2IU3 A;  3T4Z A;  4RQE A;  4I9W A;  1NVP B;  1M9N A;  1K4D C;  3W7T A;  3AG4 C;  5CBG A;  1NVP D;  2EZP A;  1K8A W;  1PKX A;  3ZIA G;  3ZRV A;  2Y69 B;  2ZD9 A;  1PNM A;  4LCU C;  3OW2 U;  1V54 C;  3G6E V;  2JK5 C;  3SJQ C;  2IJK A;  3GWO A;  1YI2 V;  1G4Y B;  1JVM A;  4JGS A;  1P4R A;  2ZQM A;  4CZZ A;  2QM8 A;  4FMT A;  3KG2 A;  4Z1M G;  3ZJZ A;  1F51 A;  1Y66 A;  4Q20 A;  1W0K G;  1TUE B;  2IW5 A;  2YSU B;  1E79 G;  1E44 B;  3E8F A;  4MW8 A;  1M90 W;  1EZJ A;  3LSQ A;  4RQF A;  1G8M A;  2Y69 C;  3ASO B;  3SYP A;  3MHH C;  3E89 A;  5CBF A;  5B1A C;  3LDE A;  3DGE A;  5LHG A;  3AG2 B;  3CME V;  2V1D A;  1COW G;  2XAQ A;  4QIW F;  1GK9 A;  3ZMV A;  3I55 V;  3K0D A;  2QA4 V;  1K3E A;  1GM7 A;  4FIP C;  3AG1 B;  2WLL B;  4MS2 A;  2ZR2 A;  3ML0 A;  1VQ5 V;  2EIL B;  3ASO C;  2K1E A;  3CP1 A;  3FB7 C;  3OUF A;  5J9P C;  4KFM A;  3K3W A;  1VQ9 V;  4UV8 A;  5DM6 V;  3ABM B;  4P2Z A;  1W2B U;  5EBM C;  3JD1 A;  4LBE C;  3FYI B;  2C2A A;  4UVB A;  3K0G A;  3TCU A;  5L3E A;  1BHB A;  2DYR B;  2ZDI A;  2A0L A;  3LUT B;  4PEL A;  1DLB A;  5LHI A;  1R3L C;  3ZN0 A;  2A79 B;  5EBW C;  1PD3 A;  2HFE C;  2P7T C;  4MT8 A;  1KP2 A;  3ZCC A;  3ZRS A;  5IYC O;  2WLI B;  3NXS A;  3SPG A;  2EIM B;  3FYE B;  1FXV A;  2F43 G;  1KC8 W;  1K5Q A;  3RBZ A;  2OCC C;  3R65 A;  4I5S A;  4HAM A;  3ZN1 A;  3AG1 C;  2ITD C;  5L3C A;  1WLE A;  2HG5 C;  4RUF A;  3ETE A;  1OZ0 A;  2W6I G;  3PJS K;  1L1F A;  1VQK V;  3OUS A;  1OCO C;  1AR1 B;  4R6Z A;  4UDM B;  3IFX A;  1K4C C;  2NNU A;  3CCM V;  1S77 D;  2XAS A;  3B77 A;  4PA6 A;  2OTJ V;  1OCZ B;  2H8P C;  3TET A;  1MG1 A;  2BOB C;  2IJJ A;  1Q86 W;  5KA6 A;  3UKM A;  3OFN G;  5GW7 A;  1EFR G;  4WFE A;  2R9I A;  3AG2 C;  5IYB O;  1F23 A;  4QJF B;  3CCQ V;  1ENV A;  1H8E G;  1AI7 A;  3K06 A;  1JPX A;  4J9Z B;  1JCH A;  3SYC A;  5KA5 A;  3OM3 B;  1OCZ C;  3ZRX A;  4GT1 A;  3AG3 B;  4JTD B;  1I5X A;  4KP4 A;  1P7B A;  4JPR A;  4F4L A;  2X6B A;  2WLH A;  2EZO A;  5H9C A;  4JAU A;  1N8R W;  4X8A A;  2EIN C;  1QR8 A;  1YJW V;  1I5Y A;  3CXC U;  2A9H A;  2OCC B;  3CMA V;  2IH3 C;  5BZB A;  2WLM A;  1E1Q G;  1JQ0 A;  3E35 A;  4H33 A;  1VQ4 V;  3AG3 C;  5B1A B;  3H01 A;  1GM9 A;  3GB7 C;  3MHS C;  2FTK A;  3SPI A;  2X6C A;  2AHY A;  5L3G A;  1CP9 A;  1BL8 A;  3A0R A;  2P67 A;  5HFM A;  5EK0 A;  3ABL C;  2WPD G;  4RAI A;  1ARO P;  2WAM A;  2XND G;  5HFL A;  4XDL A;  1H2G A;  2HVJ C;  3STZ C;  3SYA A;  3B8N A;  3QO5 A;  4GX2 A;  2B1I A;  4QPJ A;  3SPC A;  1FS0 G;  3VOU A;  1VQN V;  1KP3 A;  3ZMU A;  1RPR A;  4GX5 A;  2XAH A;  3D36 A;  1K92 A;  2HLD G;  1M57 B;  2EJR A;  2IH1 C;  2W6J G;  1QCE A;  3CC7 V;  1FXK A;  3D3I A;  4R7C A;  2DW4 A;  2WLL A;  3P30 A;  4BAY A;  4E2L A;  1AI4 A;  3IGA C;  1Q81 W;  3E2E A;  4L87 A;  3OGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...