The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
96
|
structure length |
96
|
Chain Sequence |
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the N-terminal, growth factor-like domain of Alzheimer amyloid precursor protein.
pubmed doi rcsb |
molecule tags |
Sugar binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
AMYLOID A4 PROTEIN
|
total genus |
21
|
structure length |
96
|
sequence length |
96
|
ec nomenclature | |
pdb deposition date | 1999-03-09 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Sugar Binding Protein, Amyloid A4 Protein; Chain A | Amyloidogenic glycoprotein, heparin-binding domain |
#chains in the Genus database with same CATH superfamily 3KTM A; 4JFN A; 4PWQ A; 1MWP A; 4PQD A; #chains in the Genus database with same CATH topology 3KTM A; 4JFN A; 4PWQ A; 1MWP A; 4PQD A; #chains in the Genus database with same CATH homology 3KTM A; 4JFN A; 4PWQ A; 1MWP A; 4PQD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...