4PWQA

High-resolution crystal structure of the e1-domain of the amyloid precursor protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein
publication title The Amyloid Precursor Protein Shows a pH-Dependent Conformational Switch in Its E1 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin binding protein
total genus 40
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 4pwqA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 4pwqA01
1OWTA 3KTMA 2FMAA 2FJZA 2FK2A 2FK1A 4PWQA 1MWPA 4JFNA 2FK3A 2M05A 4PQDA 2FKLA
chains in the Genus database with same CATH superfamily
5IYBG 4FU0A 4LFCH 3K3PA 3RUPA 3H4DA 2QYZA 1CQIB 3PZPA 2FLNA 3R5FA 5L1KA 4RZRA 4TQSA 4RNOA 2R93A 3N41B 2R8JA 4E4TA 2R86A 5F9LA 1IBLH 3RBDA 4PWQA 1TA8A 4JI0H 4BY7G 3M4IA 5D1OB 1B33N 5KT7A 3QZ8A 3RB3A 2B63G 4DV1H 4R8UB 5EWEA 3MWDA 4GC6A 2JEGA 3J7AK 2W6OA 3GV5B 4EYIB 2BQRA 1N34H 2YCHA 1M7JA 4IRCA 4B3MH 4O3NA 1CQJB 2HJWA 5KFPA 2FLPA 3KHHA 4DV6H 4HNTA 4JYAH 4MTDA 2W6ZA 4J9QA 4F4WA 1DV1A 2YRWA 2W9CA 3K3VA 3H4BA 5CB4F 3V6HA 5D1OA 2RDJA 4B3RH 4WD3A 4UCSA 5KFBA 4RB2C 1WH2A 1JX4A 2UVUA 4DR3H 4IRKA 2YU9A 2R92G 1OWTA 1I3QA 3PR4A 1N33H 4NXNH 2PBZA 5C4XG 4EFBA 2AQ4A 4DR4H 5HV6A 2QK4A 4EGJA 2RF4A 2WB1E 4RU9A 1IOWA 5KFAA 4ZOLF 2MCTA 2DPJA 4DUYH 1XNQH 2RGVA 5KFHA 3Q8SB 3HKZA 5A2QW 3BA8A 1EUDB 3L2PA 2WAQA 4O4LF 3VPCA 2HVQA 3VMMA 1FKAH 4K0KH 2W57A 3MR6A 3KHRA 4EBEA 1S10A 3HOUG 1RK5A 1TWAA 5KFYA 2DPIA 4YAJB 4I4TF 1S68A 4RB1A 1A0IA 4RB0A 4UCTA 4QIWE 3GLKA 5EWFA 1BGWA 2R7LA 5EDWA 1AUVA 4GKJH 2FPIB 1AUXA 5LA6F 2C2RA 1WCMG 1TWGA 4CC5A 4YR2A 4A3CG 3KAJA 4LH7A 3FDSA 5IP9G 4HNUA 4JFNA 3Q2OA 2FPPB 3M9OB 1TAEA 2XC9A 3OSPA 3QZ7A 2X0SA 5KG1A 3J81W 1S0NA 3HB9A 4A3LG 3BAAA 3E5NA 4RUAA 1S0MA 4LF4H 4UCVA 4XX0B 3R5HA 4YY3H 5IP7G 2R82A 3PR5B 3JRXA 2NVYA 5FD5A 2R7NA 1RYRA 4ZQIA 1E4EB 2V4QA 4YBZB 5DG9A 1ZQ7A 1GLVA 4LH6A 4LF7H 5LMNH 5C1OA 2CQYA 4BY1G 4EG0A 3MR5A 2JA7G 4L1KA 3FMAA 1T94A 3ETJA 4YQWA 2UVVA 4HQ6A 4IWYA 4A3MG 1XMOH 1KC7A 2ZM6H 1VAJA 3EYYA 3KAKA 3N40P 2R87A 2W7PA 3TQ1A 4DR7H 5KFIA 2R7ZG 1M6VA 4DV3H 4ECTA 4BBSG 2HGSA 3T5LA 1AN7A 2I87A 2NU8B 2YRXA 2VUMA 1V9PA 4MV8A 3M9MB 4O3RA 3RF2A 4FBUA 1ULZA 3KXYT 4YP3A 5DG7A 5KG3A 3JAMW 2ASDA 3M9NB 4C5AA 2FE3A 2W9BB 2AGOA 4DR5H 4J9SA 5DQGA 3RGZA 2IP4A 2V58A 3N8DA 5KX5F 4RNMA 2VQFH 4J9OA 1R9TA 5T14A 5KFTA 2UUCH 4TV9F 3SE7A 4QWAA 2HHHH 5KG6A 3HXLA 3GIQA 5CAEB 5KFEA 3RB4A 1HNXH 4YB8B 4BWSC 5DG8A 3GIMA 3PN1A 1RJRA 5KFNA 1EYZA 4J0MA 3GTMA 2PVPA 3I4NG 2UXBH 4UCUA 4C2MA 3T1HH 1C3OA 2C2DA 3HOWG 4QW9A 3NGDA 2FLLA 3CQZA 4YHHH 5LYJF 2UUAH 3LP8A 4ME6A 2J9GA 2W6QA 1EHIA 1KJQA 5LOVF 5KFUA 3HOVG 4LMYA 3MWEA 5LMUH 1TWHA 4O2BF 5KT6A 1I50A 4XYLB 5L1IA 4UFZA 2VPSA 2Y0SA 5KFWA 3U9SA 5KFCA 5KFFA 3AYHB 5KFLA 1BNCA 3GQCA 3PW4A 3N43B 4JI4H 2W9CB 4JI1H 1DV2A 3H40A 2XCLA 5IYZF 5KFRA 3GTKA 1FVIA 2R7MA 2UXDH 5LL6b 2FMAA 3TQTA 4MV4A 4WBNF 3V6JA 2VR1A 4IZOA 1S9FA 5BMVF 4ECWA 4A2AA 4LF8H 2IA6A 3ORQA 1ZHQA 2DLNA 1T36A 3HKZE 5JVDF 3RAXA 4A3DG 1C30A 2WAQE 4G3IA 2VA2A 3BG5A 4QWDA 3JSLA 2R85A 4RUCA 4LSAA 4FM9A 3BQ0A 2JA6G 4O3PA 3RFCA 3HOZG 3BABA 4DLKA 3J80W 1E4FT 4XYMB 4B3TH 4DL6A 3BQ2A 2XIGA 3IG0A 1Z2OX 2UXCH 4RZQA 2NUAB 3G8CA 4LFAH 5FLMG 2F4VH 3KHLA 4RAYA 4QW8A 4ECVA 4LF9H 2JA5G 3G6XA 4DV4H 5FPRA 1I94H 3BJYA 2YYAA 1UC8A 3K5HA 3PW7A 2NVXA 4M7EA 3L4JA 4HYKA 1W96A 4EEYA 3RB6A 1HNZH 2CZGA 2W7OA 4ECUA 1DIKA 2WTFA 4DL3A 3ORRA 4Q45A 4JUZA 4DL5A 1Y1WG 2BQUA 1J5EH 2V9WA 5KFJA 4B3SH 3H0GG 4MAMA 5D8DA 2VQEH 2JEIA 4JV5H 5C44G 2NU7B 2O03A 1GSAA 4LFBH 4TUYF 1Y1VG 4C5CA 3U9TA 2VQDA 4DR6H 2DIKA 4EBDA 2J6SA 4RAZA 2B63A 2BQ3A 2JA8G 1V51A 5H80A 1PX2A 2DWCA 2XCAA 2C22A 1BXRA 5DQIA 4Q43A 4JV1A 3G6VA 4UCRA 1B6SA 4EYHB 3KHGA 3GTGA 4JV2A 4RNNA 3N44B 4LF5H 3PVXA 3PW2A 4GLXA 4YJ3F 5KFXA 1L2ZA 1Z2NX 3R23A 4YR0A 5JUMA 3OHBA 4IR9A 2W8KA 3I12A 2E2IA 5I47A 2R8HA 1JDBB 4O3SA 5JVLA 2R92A 2ATLA 3F8NA 5L1LA 4ECRA 3I4MG 3V6KA 3GTPA 3GIPA 1XNRH 1XMQH 3OTOH 1MZBA 4R7RA 4ED6A 2GPSA 1VS0A 1SEIA 4APMA 4QWCA 2XD4A 3IN5A 5DLFA 1KJ8A 2HVRA 2JEJA 2FPGB 5IT9W 1GYFA 4Q44A 1I7LA 2V4RA 4FS2A 2WE6A 5HBRB 5J2UF 1ZETA 1IOVA 4DL4A 5GONF 2VUGA 1KBLA 4X66H 3HOXG 2C28A 1EZ1A 4NLGA 4J9RA 3MJFA 4ED8A 3RV4A 2FK3A 4Q0YA 5KT3A 4O2AF 2YS7A 3OHAA 4J9KA 3PO2G 4A2BA 4TQRA 3RGXA 4O4IF 1X9NA 3N42B 1GSHA 2JEFA 2WYOA 2R93G 4ECZA 4MV3A 4J9MA 2R6FA 4AQYH 2FKLA 5KFMA 2Y0SE 4QWBA 3GIKA 2GLTA 1P8LA 4A3JG 5KG4A 2IMWP 2V59A 4PQDA 4MV1A 4J9LA 2R7KA 2IBKA 1CS0A 5KG0A 3C0FB 4Q8FA 5KFDA 5FLXW 2ZDHA 3WO0A 4MTEA 4HNVA 2JA7A 5KT4A 3GTOA 3KTMA 4KHPH 2RDIA 5LP6F 3MWMA 1N36H 1RJPA 4MV7A 2I80A 4DL2A 4JI7H 4I55F 3EPGA 2Q2UA 3MFIA 4GC7A 2E5LH 1TWCA 2VPQA 2R7ZA 1T3NA 4CC6A 2CKZB 4IWXA 2E2HA 3FKIA 5JQWA 1FJGH 5KFVA 1M0TA 2ASLA 4OX9H 5IYDG 1KJIA 3L4KA 3VPBA 2KSWA 2NU9B 4EGQA 4C5BA 4X64H 4A3IG 2J6TA 5FPOA 5K2MA 4DUZH 1HR0H 4QWEA 4IR1A 4JI6H 5KT5A 2W8LA 5BPHA 2R8GA 1S0OA 4A3FG 2RGRA 2OWOA 1RK6A 2FK2A 3ETHA 5KT2A 4ED0A 1DGSA 3DF7A 4XZ3B 3LMLA 4ECQA 2YS6A 3Q1KA 4FBTA 1EUCB 3GILA 5BR8H 2W71A 3EPIA 1KJ9A 4YJ2F 2M05A 4EBCA 3GV7B 4JI8H 2PN1A 4GKKH 2PMZE 1PK8A 2HVSA 3RB0A 5IYCG 4ECSA 3RBEA 1GGOA 4DR2H 4ETSA 2ZDGA 2W70A 3T1YH 5KFQA 5JH7F 5KFKA 5L1JA 3H20A 3LWBA 2UVWA 5F9NA 4MV6A 3GIIA 4MA5A 5LXTF 4R8UA 1ZHSA 4JI2H 2FB9A 4X65H 2SCUB 4LF6H 3MFHA 4ECYA 4I50F 1XDNA 2R84A 4MA0A 4QJFA 5L9XA 1BJTA 1B6RA 4Y8VB 3OUUA 1VBHA 3JZIA 3OUZA 2AGPA 4JI5H 2PMZA 3GTJA 1GSOA 2Q2TA 5DLGA 4FS1A 1S03G 3BA9A 1KEEA 4BXXG 2WDTA 4A3EG 1VBGA 2I8CA 5KG5A 2CW7A 3G6YA 2VA3A 1MWPA 2C35B 3RTXA 2FK1A 4ECXA 2VUMG 1VKZA 3Q8PB 1I7NA 4O3OA 4UCOA 4IRDA 1N32H 4EEQA 3HOYG 3WNZA 5KG7A 3T5HA 4ED7A 4X62H 4EFEA 4JV0A 2BR0A 2ZJTA 4U6PA 3RJ0A 2UVRA 2J6UA 2WB1A 5EWGA 4Q8EA 2JA6A 1A9XA 1JIHA 3RIZA 4A3KG 1RJQA 2YW2A 4MV9A 1RYSA 1IBKH 4DV5H 2ASJA 2R8IA 5KFSA 3GTLA 5IWAH 4NXMH 3Q8RB 5EZYF 4DL7A 2ZDQA 5CA1F 2OLSA 3PO3G 2JA5A 2YL2A 3PW0A 1WSCA 5C5JA 2YZMA 3KALA 3UQ8A 1Y14B 1TWFA 2OH2A 4A93G 4ED2A 4QIWA 1K1SA 2W6MA 4J9PA 2W6NA 2DZDA 1N56A 5KFZA 5BPFA 3TINA 4DR1H 1UC9A 2XGPA 3SI8A 1HNWH 5FJ8G 4DV0H 5KG2A 4ZI7F 3HBLA 4F50A 1WR2A 5C1PA 5CA0F 2ALZA 1S97A 1Y1WA 3H0GA 2XGQA 2NU6B 5J2TF 1V4YA 1Z2PX 2P0AA 4U7CA 4DV2H 3GV8B 4ED1A 3QFFA 3TIIA 3RAQA 2VOBA 1Y1VA 3GIDA 2UU9H 1WCMA 1JLLB 4F4XA 2V5AA 3H3VH 2YZNA 1E4EA 2FP4B 3JSNA 3MR3A 4F4ZA 3T5JA 3CVZA 4A3BG 2GPWA 1K83A 1SFOA 4ZHQF 4IAJA 3R5XA 1O75A 3FKIG 1UNNC 1B04A 4F4YA 4PDBA 1I6UA 4M9UA 2C00A 5KFOA 4A3GG 1JKJB 5FD6A 1E4GT 2AGQA 5C8YF 1M0WA 4YR3A 1GO3E 4HR7A 4RB3C 2FJZA 2XCPA 2YZGA 4YAKB 3Q8QB 3PW5A 1KJJA 4BBRG 2C2EA 2R8KA 3UFXB 4I7HA 3V4SA 2W9AA 2W6PA 4AYBE 3MR2A 1N48A 5EOYA 4LSXA 3OSNA 4TV8F 5DGBA 4O4HF 1K1QA 5D1PA 3RV3A 4JI3H 5KKNB 3N6XA 4IHJF 2CW8A 1SYXB 1SCUB 3K5IA 3V4ZA 3T5KA 3GTQA 3TIGA 3JRWA 5C3EG 4DV7H 3BQ1A 2AU0A 2W9BA 2UUBH 4ED3A 3GIJA 1JXLA 1W93A 4J9NA 3WO1A 1CE8A 1JDEA 5DQHA 1IBMH 4AYBA 5DGAA 4O3QA 3VPDA 5KFGA
chains in the Genus database with same CATH topology
1OWTA 3KTMA 2FMAA 2FJZA 2FK2A 2FK1A 4PWQA 1MWPA 4JFNA 2FK3A 2M05A 4PQDA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  3KTM A;  2FMA A;  2FJZ A;  2FK2 A;  2FK1 A;  4PWQ A;  1MWP A;  4JFN A;  2FK3 A;  2M05 A;  4PQD A;  2FKL A; 
#chains in the Genus database with same CATH topology
 5IYB G;  4FU0 A;  4LFC H;  3K3P A;  3RUP A;  3H4D A;  2QYZ A;  1CQI B;  3PZP A;  2FLN A;  3R5F A;  5L1K A;  4RZR A;  4TQS A;  4RNO A;  2R93 A;  3N41 B;  2R8J A;  4E4T A;  2R86 A;  5F9L A;  1IBL H;  3RBD A;  4PWQ A;  1TA8 A;  4JI0 H;  4BY7 G;  3M4I A;  5D1O B;  1B33 N;  5KT7 A;  3QZ8 A;  3RB3 A;  2B63 G;  4DV1 H;  4R8U B;  5EWE A;  3MWD A;  4GC6 A;  2JEG A;  3J7A K;  2W6O A;  3GV5 B;  4EYI B;  2BQR A;  1N34 H;  2YCH A;  1M7J A;  4IRC A;  4B3M H;  4O3N A;  1CQJ B;  2HJW A;  5KFP A;  2FLP A;  3KHH A;  4DV6 H;  4HNT A;  4JYA H;  4MTD A;  2W6Z A;  4J9Q A;  4F4W A;  1DV1 A;  2YRW A;  2W9C A;  3K3V A;  3H4B A;  5CB4 F;  3V6H A;  5D1O A;  2RDJ A;  4B3R H;  4WD3 A;  4UCS A;  5KFB A;  4RB2 C;  1WH2 A;  1JX4 A;  2UVU A;  4DR3 H;  4IRK A;  2YU9 A;  2R92 G;  1OWT A;  1I3Q A;  3PR4 A;  1N33 H;  4NXN H;  2PBZ A;  5C4X G;  4EFB A;  2AQ4 A;  4DR4 H;  5HV6 A;  2QK4 A;  4EGJ A;  2RF4 A;  2WB1 E;  4RU9 A;  1IOW A;  5KFA A;  4ZOL F;  2MCT A;  2DPJ A;  4DUY H;  1XNQ H;  2RGV A;  5KFH A;  3Q8S B;  3HKZ A;  5A2Q W;  3BA8 A;  1EUD B;  3L2P A;  2WAQ A;  4O4L F;  3VPC A;  2HVQ A;  3VMM A;  1FKA H;  4K0K H;  2W57 A;  3MR6 A;  3KHR A;  4EBE A;  1S10 A;  3HOU G;  1RK5 A;  1TWA A;  5KFY A;  2DPI A;  4YAJ B;  4I4T F;  1S68 A;  4RB1 A;  1A0I A;  4RB0 A;  4UCT A;  4QIW E;  3GLK A;  5EWF A;  1BGW A;  2R7L A;  5EDW A;  1AUV A;  4GKJ H;  2FPI B;  1AUX A;  5LA6 F;  2C2R A;  1WCM G;  1TWG A;  4CC5 A;  4YR2 A;  4A3C G;  3KAJ A;  4LH7 A;  3FDS A;  5IP9 G;  4HNU A;  4JFN A;  3Q2O A;  2FPP B;  3M9O B;  1TAE A;  2XC9 A;  3OSP A;  3QZ7 A;  2X0S A;  5KG1 A;  3J81 W;  1S0N A;  3HB9 A;  4A3L G;  3BAA A;  3E5N A;  4RUA A;  1S0M A;  4LF4 H;  4UCV A;  4XX0 B;  3R5H A;  4YY3 H;  5IP7 G;  2R82 A;  3PR5 B;  3JRX A;  2NVY A;  5FD5 A;  2R7N A;  1RYR A;  4ZQI A;  1E4E B;  2V4Q A;  4YBZ B;  5DG9 A;  1ZQ7 A;  1GLV A;  4LH6 A;  4LF7 H;  5LMN H;  5C1O A;  2CQY A;  4BY1 G;  4EG0 A;  3MR5 A;  2JA7 G;  4L1K A;  3FMA A;  1T94 A;  3ETJ A;  4YQW A;  2UVV A;  4HQ6 A;  4IWY A;  4A3M G;  1XMO H;  1KC7 A;  2ZM6 H;  1VAJ A;  3EYY A;  3KAK A;  3N40 P;  2R87 A;  2W7P A;  3TQ1 A;  4DR7 H;  5KFI A;  2R7Z G;  1M6V A;  4DV3 H;  4ECT A;  4BBS G;  2HGS A;  3T5L A;  1AN7 A;  2I87 A;  2NU8 B;  2YRX A;  2VUM A;  1V9P A;  4MV8 A;  3M9M B;  4O3R A;  3RF2 A;  4FBU A;  1ULZ A;  3KXY T;  4YP3 A;  5DG7 A;  5KG3 A;  3JAM W;  2ASD A;  3M9N B;  4C5A A;  2FE3 A;  2W9B B;  2AGO A;  4DR5 H;  4J9S A;  5DQG A;  3RGZ A;  2IP4 A;  2V58 A;  3N8D A;  5KX5 F;  4RNM A;  2VQF H;  4J9O A;  1R9T A;  5T14 A;  5KFT A;  2UUC H;  4TV9 F;  3SE7 A;  4QWA A;  2HHH H;  5KG6 A;  3HXL A;  3GIQ A;  5CAE B;  5KFE A;  3RB4 A;  1HNX H;  4YB8 B;  4BWS C;  5DG8 A;  3GIM A;  3PN1 A;  1RJR A;  5KFN A;  1EYZ A;  4J0M A;  3GTM A;  2PVP A;  3I4N G;  2UXB H;  4UCU A;  4C2M A;  3T1H H;  1C3O A;  2C2D A;  3HOW G;  4QW9 A;  3NGD A;  2FLL A;  3CQZ A;  4YHH H;  5LYJ F;  2UUA H;  3LP8 A;  4ME6 A;  2J9G A;  2W6Q A;  1EHI A;  1KJQ A;  5LOV F;  5KFU A;  3HOV G;  4LMY A;  3MWE A;  5LMU H;  1TWH A;  4O2B F;  5KT6 A;  1I50 A;  4XYL B;  5L1I A;  4UFZ A;  2VPS A;  2Y0S A;  5KFW A;  3U9S A;  5KFC A;  5KFF A;  3AYH B;  5KFL A;  1BNC A;  3GQC A;  3PW4 A;  3N43 B;  4JI4 H;  2W9C B;  4JI1 H;  1DV2 A;  3H40 A;  2XCL A;  5IYZ F;  5KFR A;  3GTK A;  1FVI A;  2R7M A;  2UXD H;  5LL6 b;  2FMA A;  3TQT A;  4MV4 A;  4WBN F;  3V6J A;  2VR1 A;  4IZO A;  1S9F A;  5BMV F;  4ECW A;  4A2A A;  4LF8 H;  2IA6 A;  3ORQ A;  1ZHQ A;  2DLN A;  1T36 A;  3HKZ E;  5JVD F;  3RAX A;  4A3D G;  1C30 A;  2WAQ E;  4G3I A;  2VA2 A;  3BG5 A;  4QWD A;  3JSL A;  2R85 A;  4RUC A;  4LSA A;  4FM9 A;  3BQ0 A;  2JA6 G;  4O3P A;  3RFC A;  3HOZ G;  3BAB A;  4DLK A;  3J80 W;  1E4F T;  4XYM B;  4B3T H;  4DL6 A;  3BQ2 A;  2XIG A;  3IG0 A;  1Z2O X;  2UXC H;  4RZQ A;  2NUA B;  3G8C A;  4LFA H;  5FLM G;  2F4V H;  3KHL A;  4RAY A;  4QW8 A;  4ECV A;  4LF9 H;  2JA5 G;  3G6X A;  4DV4 H;  5FPR A;  1I94 H;  3BJY A;  2YYA A;  1UC8 A;  3K5H A;  3PW7 A;  2NVX A;  4M7E A;  3L4J A;  4HYK A;  1W96 A;  4EEY A;  3RB6 A;  1HNZ H;  2CZG A;  2W7O A;  4ECU A;  1DIK A;  2WTF A;  4DL3 A;  3ORR A;  4Q45 A;  4JUZ A;  4DL5 A;  1Y1W G;  2BQU A;  1J5E H;  2V9W A;  5KFJ A;  4B3S H;  3H0G G;  4MAM A;  5D8D A;  2VQE H;  2JEI A;  4JV5 H;  5C44 G;  2NU7 B;  2O03 A;  1GSA A;  4LFB H;  4TUY F;  1Y1V G;  4C5C A;  3U9T A;  2VQD A;  4DR6 H;  2DIK A;  4EBD A;  2J6S A;  4RAZ A;  2B63 A;  2BQ3 A;  2JA8 G;  1V51 A;  5H80 A;  1PX2 A;  2DWC A;  2XCA A;  2C22 A;  1BXR A;  5DQI A;  4Q43 A;  4JV1 A;  3G6V A;  4UCR A;  1B6S A;  4EYH B;  3KHG A;  3GTG A;  4JV2 A;  4RNN A;  3N44 B;  4LF5 H;  3PVX A;  3PW2 A;  4GLX A;  4YJ3 F;  5KFX A;  1L2Z A;  1Z2N X;  3R23 A;  4YR0 A;  5JUM A;  3OHB A;  4IR9 A;  2W8K A;  3I12 A;  2E2I A;  5I47 A;  2R8H A;  1JDB B;  4O3S A;  5JVL A;  2R92 A;  2ATL A;  3F8N A;  5L1L A;  4ECR A;  3I4M G;  3V6K A;  3GTP A;  3GIP A;  1XNR H;  1XMQ H;  3OTO H;  1MZB A;  4R7R A;  4ED6 A;  2GPS A;  1VS0 A;  1SEI A;  4APM A;  4QWC A;  2XD4 A;  3IN5 A;  5DLF A;  1KJ8 A;  2HVR A;  2JEJ A;  2FPG B;  5IT9 W;  1GYF A;  4Q44 A;  1I7L A;  2V4R A;  4FS2 A;  2WE6 A;  5HBR B;  5J2U F;  1ZET A;  1IOV A;  4DL4 A;  5GON F;  2VUG A;  1KBL A;  4X66 H;  3HOX G;  2C28 A;  1EZ1 A;  4NLG A;  4J9R A;  3MJF A;  4ED8 A;  3RV4 A;  2FK3 A;  4Q0Y A;  5KT3 A;  4O2A F;  2YS7 A;  3OHA A;  4J9K A;  3PO2 G;  4A2B A;  4TQR A;  3RGX A;  4O4I F;  1X9N A;  3N42 B;  1GSH A;  2JEF A;  2WYO A;  2R93 G;  4ECZ A;  4MV3 A;  4J9M A;  2R6F A;  4AQY H;  2FKL A;  5KFM A;  2Y0S E;  4QWB A;  3GIK A;  2GLT A;  1P8L A;  4A3J G;  5KG4 A;  2IMW P;  2V59 A;  4PQD A;  4MV1 A;  4J9L A;  2R7K A;  2IBK A;  1CS0 A;  5KG0 A;  3C0F B;  4Q8F A;  5KFD A;  5FLX W;  2ZDH A;  3WO0 A;  4MTE A;  4HNV A;  2JA7 A;  5KT4 A;  3GTO A;  3KTM A;  4KHP H;  2RDI A;  5LP6 F;  3MWM A;  1N36 H;  1RJP A;  4MV7 A;  2I80 A;  4DL2 A;  4JI7 H;  4I55 F;  3EPG A;  2Q2U A;  3MFI A;  4GC7 A;  2E5L H;  1TWC A;  2VPQ A;  2R7Z A;  1T3N A;  4CC6 A;  2CKZ B;  4IWX A;  2E2H A;  3FKI A;  5JQW A;  1FJG H;  5KFV A;  1M0T A;  2ASL A;  4OX9 H;  5IYD G;  1KJI A;  3L4K A;  3VPB A;  2KSW A;  2NU9 B;  4EGQ A;  4C5B A;  4X64 H;  4A3I G;  2J6T A;  5FPO A;  5K2M A;  4DUZ H;  1HR0 H;  4QWE A;  4IR1 A;  4JI6 H;  5KT5 A;  2W8L A;  5BPH A;  2R8G A;  1S0O A;  4A3F G;  2RGR A;  2OWO A;  1RK6 A;  2FK2 A;  3ETH A;  5KT2 A;  4ED0 A;  1DGS A;  3DF7 A;  4XZ3 B;  3LML A;  4ECQ A;  2YS6 A;  3Q1K A;  4FBT A;  1EUC B;  3GIL A;  5BR8 H;  2W71 A;  3EPI A;  1KJ9 A;  4YJ2 F;  2M05 A;  4EBC A;  3GV7 B;  4JI8 H;  2PN1 A;  4GKK H;  2PMZ E;  1PK8 A;  2HVS A;  3RB0 A;  5IYC G;  4ECS A;  3RBE A;  1GGO A;  4DR2 H;  4ETS A;  2ZDG A;  2W70 A;  3T1Y H;  5KFQ A;  5JH7 F;  5KFK A;  5L1J A;  3H20 A;  3LWB A;  2UVW A;  5F9N A;  4MV6 A;  3GII A;  4MA5 A;  5LXT F;  4R8U A;  1ZHS A;  4JI2 H;  2FB9 A;  4X65 H;  2SCU B;  4LF6 H;  3MFH A;  4ECY A;  4I50 F;  1XDN A;  2R84 A;  4MA0 A;  4QJF A;  5L9X A;  1BJT A;  1B6R A;  4Y8V B;  3OUU A;  1VBH A;  3JZI A;  3OUZ A;  2AGP A;  4JI5 H;  2PMZ A;  3GTJ A;  1GSO A;  2Q2T A;  5DLG A;  4FS1 A;  1S03 G;  3BA9 A;  1KEE A;  4BXX G;  2WDT A;  4A3E G;  1VBG A;  2I8C A;  5KG5 A;  2CW7 A;  3G6Y A;  2VA3 A;  1MWP A;  2C35 B;  3RTX A;  2FK1 A;  4ECX A;  2VUM G;  1VKZ A;  3Q8P B;  1I7N A;  4O3O A;  4UCO A;  4IRD A;  1N32 H;  4EEQ A;  3HOY G;  3WNZ A;  5KG7 A;  3T5H A;  4ED7 A;  4X62 H;  4EFE A;  4JV0 A;  2BR0 A;  2ZJT A;  4U6P A;  3RJ0 A;  2UVR A;  2J6U A;  2WB1 A;  5EWG A;  4Q8E A;  2JA6 A;  1A9X A;  1JIH A;  3RIZ A;  4A3K G;  1RJQ A;  2YW2 A;  4MV9 A;  1RYS A;  1IBK H;  4DV5 H;  2ASJ A;  2R8I A;  5KFS A;  3GTL A;  5IWA H;  4NXM H;  3Q8R B;  5EZY F;  4DL7 A;  2ZDQ A;  5CA1 F;  2OLS A;  3PO3 G;  2JA5 A;  2YL2 A;  3PW0 A;  1WSC A;  5C5J A;  2YZM A;  3KAL A;  3UQ8 A;  1Y14 B;  1TWF A;  2OH2 A;  4A93 G;  4ED2 A;  4QIW A;  1K1S A;  2W6M A;  4J9P A;  2W6N A;  2DZD A;  1N56 A;  5KFZ A;  5BPF A;  3TIN A;  4DR1 H;  1UC9 A;  2XGP A;  3SI8 A;  1HNW H;  5FJ8 G;  4DV0 H;  5KG2 A;  4ZI7 F;  3HBL A;  4F50 A;  1WR2 A;  5C1P A;  5CA0 F;  2ALZ A;  1S97 A;  1Y1W A;  3H0G A;  2XGQ A;  2NU6 B;  5J2T F;  1V4Y A;  1Z2P X;  2P0A A;  4U7C A;  4DV2 H;  3GV8 B;  4ED1 A;  3QFF A;  3TII A;  3RAQ A;  2VOB A;  1Y1V A;  3GID A;  2UU9 H;  1WCM A;  1JLL B;  4F4X A;  2V5A A;  3H3V H;  2YZN A;  1E4E A;  2FP4 B;  3JSN A;  3MR3 A;  4F4Z A;  3T5J A;  3CVZ A;  4A3B G;  2GPW A;  1K83 A;  1SFO A;  4ZHQ F;  4IAJ A;  3R5X A;  1O75 A;  3FKI G;  1UNN C;  1B04 A;  4F4Y A;  4PDB A;  1I6U A;  4M9U A;  2C00 A;  5KFO A;  4A3G G;  1JKJ B;  5FD6 A;  1E4G T;  2AGQ A;  5C8Y F;  1M0W A;  4YR3 A;  1GO3 E;  4HR7 A;  4RB3 C;  2FJZ A;  2XCP A;  2YZG A;  4YAK B;  3Q8Q B;  3PW5 A;  1KJJ A;  4BBR G;  2C2E A;  2R8K A;  3UFX B;  4I7H A;  3V4S A;  2W9A A;  2W6P A;  4AYB E;  3MR2 A;  1N48 A;  5EOY A;  4LSX A;  3OSN A;  4TV8 F;  5DGB A;  4O4H F;  1K1Q A;  5D1P A;  3RV3 A;  4JI3 H;  5KKN B;  3N6X A;  4IHJ F;  2CW8 A;  1SYX B;  1SCU B;  3K5I A;  3V4Z A;  3T5K A;  3GTQ A;  3TIG A;  3JRW A;  5C3E G;  4DV7 H;  3BQ1 A;  2AU0 A;  2W9B A;  2UUB H;  4ED3 A;  3GIJ A;  1JXL A;  1W93 A;  4J9N A;  3WO1 A;  1CE8 A;  1JDE A;  5DQH A;  1IBM H;  4AYB A;  5DGA A;  4O3Q A;  3VPD A;  5KFG A; 
#chains in the Genus database with same CATH homology
 1OWT A;  3KTM A;  2FMA A;  2FJZ A;  2FK2 A;  2FK1 A;  4PWQ A;  1MWP A;  4JFN A;  2FK3 A;  2M05 A;  4PQD A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...