4PWQA

High-resolution crystal structure of the e1-domain of the amyloid precursor protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Heparin binding protein
molecule keywords Amyloid beta A4 protein
publication title The Amyloid Precursor Protein Shows a pH-Dependent Conformational Switch in Its E1 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 4pwqA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 4pwqA01
2FK2A 2FK3A 4PWQA 1MWPA 2FKLA 2FMAA 4JFNA 1OWTA 4PQDA 3KTMA 2M05A 2FJZA 2FK1A
chains in the Genus database with same CATH superfamily
2RF4A 3C0FB 3GTLA 4RNNA 4FBTA 4A3IG 1SYXB 5KT3A 4JV2A 4JI4H 4EBCA 4UCVA 3MR3A 3AYHB 2VUGA 2YZNA 5H80A 1N36H 5L1KA 2VR1A 3VPBA 4HNUA 2UXCH 3H20A 3MWDA 3M9MB 2FK3A 2I80A 3GIJA 2GLTA 2R7MA 3GTMA 5KG5A 2VPQA 3KHRA 4BXXG 2ZJTA 5D1OA 1N56A 4IAJA 4HR7A 3RGZA 5KFPA 5FD5A 3WNZA 3SI8A 2E2HA 2RDJA 4NLGA 4GKKH 4ME6A 3KAJA 2JA6A 2DZDA 2P0AA 3GIPA 5KFIA 4E4TA 3T1HH 1FKAH 2XGQA 2UVUA 1HNWH 4JI2H 5KFVA 5LMUH 3N43B 2JEFA 4RB0A 2CW7A 4MV7A 1PK8A 3GIKA 1CQJB 2YZGA 3JRWA 4FM9A 4UFZA 3RFCA 3QZ8A 2NU6B 4J9NA 4OX9H 3RB3A 5IYBG 2XCAA 2ZM6H 1FVIA 5KG3A 5CAEB 2IMWP 2R93A 2Q2UA 3V6KA 1TWAA 3GILA 3Q8QB 3J80W 4DUZH 4EBDA 4JYAH 4QWEA 4YHHH 3HOVG 2CKZB 4AYBA 4IRCA 4YJ2F 3G6VA 1IOVA 3HOXG 4A3JG 1HNXH 2YU9A 2FPIB 5KFNA 2YL2A 3K5IA 2JA5G 2YRWA 4YAKB 2O03A 1ULZA 1E4EB 4O2AF 3E5NA 4F4YA 1TWFA 3BAAA 4Q44A 3Q2OA 2DPIA 1GSOA 3GIIA 2UVVA 3QFFA 4LF7H 4JI3H 2R84A 3H4BA 4MV9A 1I7LA 2M05A 1RJPA 4XYMB 4HYKA 2ALZA 3GTPA 2NU9B 5KT6A 2W9BB 3K3PA 5DQIA 1M7JA 2J6UA 1OWTA 1TA8A 2SCUB 3CQZA 3EPGA 1JXLA 2WAQA 1I7NA 5DQHA 3VPCA 2FLLA 1WH2A 1KJ9A 1WSCA 4MV6A 4XX0B 5LYJF 4JV0A 4Y8VB 3M9NB 1IBKH 4IR1A 3PR5B 1J5EH 3MR6A 5BR8H 3GV7B 2X0SA 2J6TA 3N42B 1EUDB 4ECZA 4GC6A 3TQTA 4J0MA 2R6FA 5FLXW 3PW5A 4HQ6A 5IYCG 2RDIA 2YW2A 1KC7A 1GYFA 4MAMA 2FP4B 3TINA 1HNZH 4ECSA 5K2MA 5JVLA 5LMNH 2IA6A 5EWEA 4A3EG 4DL6A 3BG5A 2XIGA 2BQUA 2VQDA 1I3QA 1DV2A 5KFKA 3HOWG 4IWYA 4J9PA 5KFEA 2C00A 4LFCH 3Q1KA 1UC9A 2Y0SA 4JI7H 2V5AA 3HOUG 2PVPA 1RYSA 1TWGA 3KHGA 4YB8B 1K83A 4DR4H 5C44G 1KJJA 3KXYT 5KFOA 4MV3A 2QYZA 4KHPH 3L2PA 3PW7A 4RZQA 4LH6A 2B63G 1IOWA 1S03G 5EWFA 5F9LA 4G3IA 2I87A 4WD3A 4UCSA 4TQSA 4QWAA 1E4EA 3RGXA 5KFDA 2XC9A 3RAXA 1FJGH 2PN1A 2V58A 2R8KA 3I12A 3PW4A 4IZOA 3MR5A 4YR0A 1XNRH 3RIZA 3T5HA 2CQYA 4F4XA 1JKJB 2W9BA 3JZIA 1UNNC 3OHBA 2UUBH 1TWCA 4DR6H 2E2IA 4O4HF 2WB1A 4CC6A 5DLFA 4FS2A 3GTGA 2ZDQA 3WO0A 4ZHQF 2JEJA 2JA5A 4QJFA 4MV8A 1W96A 1Z2OX 4ECQA 2VQFH 3G8CA 1Y1VA 4ECVA 1KBLA 4JV1A 4NXMH 4UCRA 1IBMH 1KJ8A 4TV8F 4CC5A 1JDEA 4R7RA 4A3MG 2NUAB 2FB9A 1C30A 2FE3A 1MZBA 1Z2PX 3MJFA 2VA3A 2YZMA 2JEIA 4YP3A 2JA7G 2NU8B 3Q8PB 4Q43A 5CB4F 4F4WA 3V4ZA 1VBGA 5KG2A 4JV5H 4O3SA 3T5KA 4RB1A 3LWBA 4DV6H 2XCLA 4U6PA 4RUAA 4MTDA 3H0GA 1BJTA 2YS7A 4HNTA 2R7ZG 4I55F 2HVSA 4LF4H 1DIKA 3T5JA 4A3KG 2R8GA 3UFXB 4B3RH 4AYBE 4LH7A 3KALA 4J9MA 1Y1WG 5EWGA 5C3EG 5DQGA 4Q8FA 2MCTA 1C3OA 5CA0F 4QWCA 3U9SA 4ED6A 1ZHQA 4U7CA 3PN1A 4X64H 4Q45A 1JDBB 3JSNA 2BQRA 1N32H 3KHHA 3RV4A 5DG7A 4I7HA 3MWMA 1TAEA 4I4TF 3IG0A 5BPFA 4RNMA 4B3MH 5KFRA 2F4VH 5IP7G 3PVXA 3UQ8A 4I50F 3LMLA 4YY3H 3DF7A 4TV9F 2J9GA 3CVZA 2ASJA 3T1YH 3K3VA 3H3VH 5D1PA 5L1IA 4EG0A 2W6MA 3EYYA 5C1OA 3MFIA 4ECTA 2AGOA 1Y14B 2WAQE 2FMAA 2HVQA 4EYHB 2ASLA 2NVYA 4PDBA 3JSLA 3EPIA 1CQIB 4AQYH 4DL5A 2W70A 5KFSA 5L1LA 4DV3H 4DV4H 1SFOA 4A93G 2XD4A 2R92G 2HGSA 5JH7F 3HXLA 3GQCA 4DR2H 4GKJH 3ETJA 3RUPA 2V4QA 2C35B 4B3SH 3GLKA 2UXDH 5C4XG 1B04A 3GTQA 4ECXA 2FLNA 2V4RA 3OTOH 3RB6A 2DLNA 5KFZA 2C2DA 2C28A 2FJZA 5FPOA 2FK1A 4QW8A 4WBNF 2AU0A 2CW8A 2VA2A 2VUMA 1P8LA 2ZDHA 1JX4A 1T36A 2R7LA 1IBLH 1DV1A 2Y0SE 4FS1A 4BWSC 2XCPA 2DPJA 1GSAA 5LOVF 4EGJA 3TQ1A 2VQEH 3FKIG 5JQWA 2Q2TA 5A2QW 3RBEA 4JI0H 1DGSA 5KFMA 1KEEA 5JUMA 1A0IA 4RZRA 4DV2H 4YBZB 4RAYA 4L1KA 4NXNH 1O75A 2CZGA 3BJYA 3HOZG 3OSNA 2WDTA 4FU0A 1S0NA 1XDNA 4RU9A 4A3LG 3GTOA 5IYZF 5KFCA 1M0WA 1N34H 4QIWE 5BPHA 3BA8A 3H4DA 2I8CA 5FPRA 3R23A 3M9OB 3RB4A 4C2MA 2WYOA 1JLLB 1W93A 1I94H 2WB1E 3N41B 4MA0A 5KFUA 4ED0A 1B6RA 5KFBA 3KTMA 2DIKA 3FMAA 3RB0A 4RNOA 3KAKA 5KKNB 3RAQA 4TUYF 3J7AK 4ED7A 4BBRG 5F9NA 1VS0A 5T14A 4O3QA 3HB9A 2PBZA 4RUCA 4JI5H 3QZ7A 5KFWA 3JRXA 5C1PA 3GIMA 5J2TF 4HNVA 1N48A 1MWPA 5KFJA 4QIWA 4YJ3F 2W6NA 4BY7G 2NVXA 3HKZE 3MWEA 4ZI7F 4GLXA 2HHHH 5KFFA 1EYZA 4UCTA 4LFBH 2R93G 3PO2G 1AUVA 3R5FA 2R8HA 4ED2A 4DL3A 3NGDA 5DG9A 1E4GT 4ED3A 3PO3G 3GTKA 4PQDA 5C5JA 3PW2A 4BY1G 2RGVA 3BABA 1B6SA 1RYRA 1SEIA 1I6UA 4DR5H 5JVDF 5LL6b 4YR3A 4O3RA 1B33N 1ZQ7A 2R86A 5L9XA 3N8DA 3LP8A 5I47A 4J9QA 2BR0A 1S68A 1RJQA 2V9WA 1BXRA 5HBRB 5KG6A 4F4ZA 4O2BF 2ZDGA 4GC7A 1S10A 5EOYA 4B3TH 3HKZA 2R7KA 3R5HA 1I50A 1ZHSA 2YS6A 3BA9A 4RB2C 2V59A 3OUUA 5DGAA 1ZETA 4M9UA 5KG7A 2IBKA 4IRDA 1AN7A 3M4IA 5KG4A 5IYDG 4J9RA 4DV7H 1PX2A 1XNQH 4EFBA 1XMQH 4ECRA 4LFAH 1K1QA 2YYAA 1SCUB 3N40P 3IN5A 2IP4A 2W6PA 3SE7A 5KG0A 4EEYA 2OWOA 5HV6A 4Q8EA 1T3NA 1EZ1A 2UUCH 1UC8A 2YRXA 5DG8A 3OSPA 1T94A 1X9NA 2C2EA 4RB3C 3OUZA 4O3OA 1XMOH 4C5AA 4MV1A 4O4LF 4APMA 5C8YF 4R8UB 4LSXA 2C22A 2J6SA 3VPDA 4LMYA 4J9SA 4EEQA 3V6JA 1WR2A 5KFQA 2QK4A 2FPGB 4DL7A 1E4FT 4EBEA 1EHIA 4XYLB 1JIHA 4PWQA 3PW0A 2B63A 2DWCA 4TQRA 5KFAA 2AGQA 3RV3A 5KT4A 4UCUA 4DL2A 2W7PA 1EUCB 3RF2A 5LP6F 5FJ8G 3J81W 5IT9W 3TIGA 2R87A 1GLVA 3FDSA 1Z2NX 2XGPA 2UVWA 4XZ3B 2OH2A 4ECUA 2JA8G 3WO1A 5DLGA 1AUXA 1R9TA 4ED1A 1S97A 2HJWA 1WCMG 5EDWA 4ECYA 4LF8H 5LXTF 2W57A 1CS0A 1M6VA 5KFYA 4JFNA 3OHAA 2HVRA 3PR4A 3GTJA 3L4JA 1GSHA 1KJIA 2VPSA 3N44B 3BQ0A 4F50A 2UU9H 4Q0YA 2VOBA 2FLPA 3H40A 1GO3E 3N6XA 5IWAH 3G6XA 2R8IA 4LF5H 4MTEA 4QWBA 3K5HA 4O4IF 2PMZE 5CA1F 3KHLA 2GPWA 4C5CA 2AGPA 4DR1H 1Y1VG 3RJ0A 1A9XA 3G6YA 2JA7A 1RK5A 5J2UF 4ECWA 3TIIA 4IWXA 4YQWA 3Q8SB 4JI8H 3GIQA 2FKLA 2UXBH 3GV5B 2OLSA 3JAMW 2W6OA 2NU7B 3GIDA 4MA5A 4YAJB 5KT2A 2R7ZA 3HOYG 4K0KH 1V9PA 1TWHA 2GPSA 2UVRA 4J9OA 5EZYF 4R8UA 3H0GG 3HBLA 1L2ZA 2W6QA 5KT7A 2W9CB 1Y1WA 3L4KA 2PMZA 3ORRA 2FK2A 3GV8B 4DLKA 1KJQA 3MFHA 4X65H 3V4SA 3VMMA 4IR9A 4X62H 2W8LA 4JI1H 4A3FG 2W7OA 4EYIB 3PZPA 2JA6G 4MV4A 4O3NA 4DR7H 3T5LA 5KX5F 1HR0H 1K1SA 4A3CG 4RAZA 4IRKA 1V51A 1V4YA 4EFEA 5IP9G 4LSAA 1S0OA 4M7EA 4DV5H 1RJRA 4JI6H 1M0TA 4DV0H 5GONF 4DR3H 2R82A 3BQ1A 2UUAH 4ETSA 3BQ2A 2RGRA 4ZOLF 5KFLA 4A2AA 3U9TA 5D1OB 4LF6H 5DGBA 2W9AA 2YCHA 3Q8RB 5FLMG 5KFGA 2BQ3A 4A3DG 2R92A 5KFHA 1GGOA 2KSWA 2JEGA 4ED8A 4EGQA 1VAJA 2WTFA 4DV1H 3MR2A 1CE8A 1S9FA 2E5LH 1WCMA 3I4NG 5L1JA 1N33H 1VBHA 1RK6A 4LF9H 4X66H 5BMVF 2W8KA 5D8DA 4JUZA 4YR2A 4ZQIA 3RTXA 5KG1A 2FPPB 2R85A 4QW9A 4A3BG 2WE6A 5KT5A 3F8NA 4QWDA 2ATLA 2AQ4A 2W6ZA 3ORQA 4J9LA 4A2BA 3ETHA 4DL4A 2W71A 4O3PA 4J9KA 3I4MG 1BNCA 5FD6A 4C5BA 1VKZA 3RBDA 2R8JA 5KFXA 4BBSG 4A3GG 2W9CA 1BGWA 3FKIA 4DUYH 2VUMG 4UCOA 2ASDA 1S0MA 5KFTA 3V6HA 4FBUA 5LA6F 4IHJF 3R5XA 2R7NA 2C2RA
chains in the Genus database with same CATH topology
2FK2A 2FK3A 4PWQA 1MWPA 2FKLA 2FMAA 4JFNA 1OWTA 4PQDA 3KTMA 2M05A 2FJZA 2FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK2 A;  2FK3 A;  4PWQ A;  1MWP A;  2FKL A;  2FMA A;  4JFN A;  1OWT A;  4PQD A;  3KTM A;  2M05 A;  2FJZ A;  2FK1 A; 
#chains in the Genus database with same CATH topology
 2RF4 A;  3C0F B;  3GTL A;  4RNN A;  4FBT A;  4A3I G;  1SYX B;  5KT3 A;  4JV2 A;  4JI4 H;  4EBC A;  4UCV A;  3MR3 A;  3AYH B;  2VUG A;  2YZN A;  5H80 A;  1N36 H;  5L1K A;  2VR1 A;  3VPB A;  4HNU A;  2UXC H;  3H20 A;  3MWD A;  3M9M B;  2FK3 A;  2I80 A;  3GIJ A;  2GLT A;  2R7M A;  3GTM A;  5KG5 A;  2VPQ A;  3KHR A;  4BXX G;  2ZJT A;  5D1O A;  1N56 A;  4IAJ A;  4HR7 A;  3RGZ A;  5KFP A;  5FD5 A;  3WNZ A;  3SI8 A;  2E2H A;  2RDJ A;  4NLG A;  4GKK H;  4ME6 A;  3KAJ A;  2JA6 A;  2DZD A;  2P0A A;  3GIP A;  5KFI A;  4E4T A;  3T1H H;  1FKA H;  2XGQ A;  2UVU A;  1HNW H;  4JI2 H;  5KFV A;  5LMU H;  3N43 B;  2JEF A;  4RB0 A;  2CW7 A;  4MV7 A;  1PK8 A;  3GIK A;  1CQJ B;  2YZG A;  3JRW A;  4FM9 A;  4UFZ A;  3RFC A;  3QZ8 A;  2NU6 B;  4J9N A;  4OX9 H;  3RB3 A;  5IYB G;  2XCA A;  2ZM6 H;  1FVI A;  5KG3 A;  5CAE B;  2IMW P;  2R93 A;  2Q2U A;  3V6K A;  1TWA A;  3GIL A;  3Q8Q B;  3J80 W;  4DUZ H;  4EBD A;  4JYA H;  4QWE A;  4YHH H;  3HOV G;  2CKZ B;  4AYB A;  4IRC A;  4YJ2 F;  3G6V A;  1IOV A;  3HOX G;  4A3J G;  1HNX H;  2YU9 A;  2FPI B;  5KFN A;  2YL2 A;  3K5I A;  2JA5 G;  2YRW A;  4YAK B;  2O03 A;  1ULZ A;  1E4E B;  4O2A F;  3E5N A;  4F4Y A;  1TWF A;  3BAA A;  4Q44 A;  3Q2O A;  2DPI A;  1GSO A;  3GII A;  2UVV A;  3QFF A;  4LF7 H;  4JI3 H;  2R84 A;  3H4B A;  4MV9 A;  1I7L A;  2M05 A;  1RJP A;  4XYM B;  4HYK A;  2ALZ A;  3GTP A;  2NU9 B;  5KT6 A;  2W9B B;  3K3P A;  5DQI A;  1M7J A;  2J6U A;  1OWT A;  1TA8 A;  2SCU B;  3CQZ A;  3EPG A;  1JXL A;  2WAQ A;  1I7N A;  5DQH A;  3VPC A;  2FLL A;  1WH2 A;  1KJ9 A;  1WSC A;  4MV6 A;  4XX0 B;  5LYJ F;  4JV0 A;  4Y8V B;  3M9N B;  1IBK H;  4IR1 A;  3PR5 B;  1J5E H;  3MR6 A;  5BR8 H;  3GV7 B;  2X0S A;  2J6T A;  3N42 B;  1EUD B;  4ECZ A;  4GC6 A;  3TQT A;  4J0M A;  2R6F A;  5FLX W;  3PW5 A;  4HQ6 A;  5IYC G;  2RDI A;  2YW2 A;  1KC7 A;  1GYF A;  4MAM A;  2FP4 B;  3TIN A;  1HNZ H;  4ECS A;  5K2M A;  5JVL A;  5LMN H;  2IA6 A;  5EWE A;  4A3E G;  4DL6 A;  3BG5 A;  2XIG A;  2BQU A;  2VQD A;  1I3Q A;  1DV2 A;  5KFK A;  3HOW G;  4IWY A;  4J9P A;  5KFE A;  2C00 A;  4LFC H;  3Q1K A;  1UC9 A;  2Y0S A;  4JI7 H;  2V5A A;  3HOU G;  2PVP A;  1RYS A;  1TWG A;  3KHG A;  4YB8 B;  1K83 A;  4DR4 H;  5C44 G;  1KJJ A;  3KXY T;  5KFO A;  4MV3 A;  2QYZ A;  4KHP H;  3L2P A;  3PW7 A;  4RZQ A;  4LH6 A;  2B63 G;  1IOW A;  1S03 G;  5EWF A;  5F9L A;  4G3I A;  2I87 A;  4WD3 A;  4UCS A;  4TQS A;  4QWA A;  1E4E A;  3RGX A;  5KFD A;  2XC9 A;  3RAX A;  1FJG H;  2PN1 A;  2V58 A;  2R8K A;  3I12 A;  3PW4 A;  4IZO A;  3MR5 A;  4YR0 A;  1XNR H;  3RIZ A;  3T5H A;  2CQY A;  4F4X A;  1JKJ B;  2W9B A;  3JZI A;  1UNN C;  3OHB A;  2UUB H;  1TWC A;  4DR6 H;  2E2I A;  4O4H F;  2WB1 A;  4CC6 A;  5DLF A;  4FS2 A;  3GTG A;  2ZDQ A;  3WO0 A;  4ZHQ F;  2JEJ A;  2JA5 A;  4QJF A;  4MV8 A;  1W96 A;  1Z2O X;  4ECQ A;  2VQF H;  3G8C A;  1Y1V A;  4ECV A;  1KBL A;  4JV1 A;  4NXM H;  4UCR A;  1IBM H;  1KJ8 A;  4TV8 F;  4CC5 A;  1JDE A;  4R7R A;  4A3M G;  2NUA B;  2FB9 A;  1C30 A;  2FE3 A;  1MZB A;  1Z2P X;  3MJF A;  2VA3 A;  2YZM A;  2JEI A;  4YP3 A;  2JA7 G;  2NU8 B;  3Q8P B;  4Q43 A;  5CB4 F;  4F4W A;  3V4Z A;  1VBG A;  5KG2 A;  4JV5 H;  4O3S A;  3T5K A;  4RB1 A;  3LWB A;  4DV6 H;  2XCL A;  4U6P A;  4RUA A;  4MTD A;  3H0G A;  1BJT A;  2YS7 A;  4HNT A;  2R7Z G;  4I55 F;  2HVS A;  4LF4 H;  1DIK A;  3T5J A;  4A3K G;  2R8G A;  3UFX B;  4B3R H;  4AYB E;  4LH7 A;  3KAL A;  4J9M A;  1Y1W G;  5EWG A;  5C3E G;  5DQG A;  4Q8F A;  2MCT A;  1C3O A;  5CA0 F;  4QWC A;  3U9S A;  4ED6 A;  1ZHQ A;  4U7C A;  3PN1 A;  4X64 H;  4Q45 A;  1JDB B;  3JSN A;  2BQR A;  1N32 H;  3KHH A;  3RV4 A;  5DG7 A;  4I7H A;  3MWM A;  1TAE A;  4I4T F;  3IG0 A;  5BPF A;  4RNM A;  4B3M H;  5KFR A;  2F4V H;  5IP7 G;  3PVX A;  3UQ8 A;  4I50 F;  3LML A;  4YY3 H;  3DF7 A;  4TV9 F;  2J9G A;  3CVZ A;  2ASJ A;  3T1Y H;  3K3V A;  3H3V H;  5D1P A;  5L1I A;  4EG0 A;  2W6M A;  3EYY A;  5C1O A;  3MFI A;  4ECT A;  2AGO A;  1Y14 B;  2WAQ E;  2FMA A;  2HVQ A;  4EYH B;  2ASL A;  2NVY A;  4PDB A;  3JSL A;  3EPI A;  1CQI B;  4AQY H;  4DL5 A;  2W70 A;  5KFS A;  5L1L A;  4DV3 H;  4DV4 H;  1SFO A;  4A93 G;  2XD4 A;  2R92 G;  2HGS A;  5JH7 F;  3HXL A;  3GQC A;  4DR2 H;  4GKJ H;  3ETJ A;  3RUP A;  2V4Q A;  2C35 B;  4B3S H;  3GLK A;  2UXD H;  5C4X G;  1B04 A;  3GTQ A;  4ECX A;  2FLN A;  2V4R A;  3OTO H;  3RB6 A;  2DLN A;  5KFZ A;  2C2D A;  2C28 A;  2FJZ A;  5FPO A;  2FK1 A;  4QW8 A;  4WBN F;  2AU0 A;  2CW8 A;  2VA2 A;  2VUM A;  1P8L A;  2ZDH A;  1JX4 A;  1T36 A;  2R7L A;  1IBL H;  1DV1 A;  2Y0S E;  4FS1 A;  4BWS C;  2XCP A;  2DPJ A;  1GSA A;  5LOV F;  4EGJ A;  3TQ1 A;  2VQE H;  3FKI G;  5JQW A;  2Q2T A;  5A2Q W;  3RBE A;  4JI0 H;  1DGS A;  5KFM A;  1KEE A;  5JUM A;  1A0I A;  4RZR A;  4DV2 H;  4YBZ B;  4RAY A;  4L1K A;  4NXN H;  1O75 A;  2CZG A;  3BJY A;  3HOZ G;  3OSN A;  2WDT A;  4FU0 A;  1S0N A;  1XDN A;  4RU9 A;  4A3L G;  3GTO A;  5IYZ F;  5KFC A;  1M0W A;  1N34 H;  4QIW E;  5BPH A;  3BA8 A;  3H4D A;  2I8C A;  5FPR A;  3R23 A;  3M9O B;  3RB4 A;  4C2M A;  2WYO A;  1JLL B;  1W93 A;  1I94 H;  2WB1 E;  3N41 B;  4MA0 A;  5KFU A;  4ED0 A;  1B6R A;  5KFB A;  3KTM A;  2DIK A;  3FMA A;  3RB0 A;  4RNO A;  3KAK A;  5KKN B;  3RAQ A;  4TUY F;  3J7A K;  4ED7 A;  4BBR G;  5F9N A;  1VS0 A;  5T14 A;  4O3Q A;  3HB9 A;  2PBZ A;  4RUC A;  4JI5 H;  3QZ7 A;  5KFW A;  3JRX A;  5C1P A;  3GIM A;  5J2T F;  4HNV A;  1N48 A;  1MWP A;  5KFJ A;  4QIW A;  4YJ3 F;  2W6N A;  4BY7 G;  2NVX A;  3HKZ E;  3MWE A;  4ZI7 F;  4GLX A;  2HHH H;  5KFF A;  1EYZ A;  4UCT A;  4LFB H;  2R93 G;  3PO2 G;  1AUV A;  3R5F A;  2R8H A;  4ED2 A;  4DL3 A;  3NGD A;  5DG9 A;  1E4G T;  4ED3 A;  3PO3 G;  3GTK A;  4PQD A;  5C5J A;  3PW2 A;  4BY1 G;  2RGV A;  3BAB A;  1B6S A;  1RYR A;  1SEI A;  1I6U A;  4DR5 H;  5JVD F;  5LL6 b;  4YR3 A;  4O3R A;  1B33 N;  1ZQ7 A;  2R86 A;  5L9X A;  3N8D A;  3LP8 A;  5I47 A;  4J9Q A;  2BR0 A;  1S68 A;  1RJQ A;  2V9W A;  1BXR A;  5HBR B;  5KG6 A;  4F4Z A;  4O2B F;  2ZDG A;  4GC7 A;  1S10 A;  5EOY A;  4B3T H;  3HKZ A;  2R7K A;  3R5H A;  1I50 A;  1ZHS A;  2YS6 A;  3BA9 A;  4RB2 C;  2V59 A;  3OUU A;  5DGA A;  1ZET A;  4M9U A;  5KG7 A;  2IBK A;  4IRD A;  1AN7 A;  3M4I A;  5KG4 A;  5IYD G;  4J9R A;  4DV7 H;  1PX2 A;  1XNQ H;  4EFB A;  1XMQ H;  4ECR A;  4LFA H;  1K1Q A;  2YYA A;  1SCU B;  3N40 P;  3IN5 A;  2IP4 A;  2W6P A;  3SE7 A;  5KG0 A;  4EEY A;  2OWO A;  5HV6 A;  4Q8E A;  1T3N A;  1EZ1 A;  2UUC H;  1UC8 A;  2YRX A;  5DG8 A;  3OSP A;  1T94 A;  1X9N A;  2C2E A;  4RB3 C;  3OUZ A;  4O3O A;  1XMO H;  4C5A A;  4MV1 A;  4O4L F;  4APM A;  5C8Y F;  4R8U B;  4LSX A;  2C22 A;  2J6S A;  3VPD A;  4LMY A;  4J9S A;  4EEQ A;  3V6J A;  1WR2 A;  5KFQ A;  2QK4 A;  2FPG B;  4DL7 A;  1E4F T;  4EBE A;  1EHI A;  4XYL B;  1JIH A;  4PWQ A;  3PW0 A;  2B63 A;  2DWC A;  4TQR A;  5KFA A;  2AGQ A;  3RV3 A;  5KT4 A;  4UCU A;  4DL2 A;  2W7P A;  1EUC B;  3RF2 A;  5LP6 F;  5FJ8 G;  3J81 W;  5IT9 W;  3TIG A;  2R87 A;  1GLV A;  3FDS A;  1Z2N X;  2XGP A;  2UVW A;  4XZ3 B;  2OH2 A;  4ECU A;  2JA8 G;  3WO1 A;  5DLG A;  1AUX A;  1R9T A;  4ED1 A;  1S97 A;  2HJW A;  1WCM G;  5EDW A;  4ECY A;  4LF8 H;  5LXT F;  2W57 A;  1CS0 A;  1M6V A;  5KFY A;  4JFN A;  3OHA A;  2HVR A;  3PR4 A;  3GTJ A;  3L4J A;  1GSH A;  1KJI A;  2VPS A;  3N44 B;  3BQ0 A;  4F50 A;  2UU9 H;  4Q0Y A;  2VOB A;  2FLP A;  3H40 A;  1GO3 E;  3N6X A;  5IWA H;  3G6X A;  2R8I A;  4LF5 H;  4MTE A;  4QWB A;  3K5H A;  4O4I F;  2PMZ E;  5CA1 F;  3KHL A;  2GPW A;  4C5C A;  2AGP A;  4DR1 H;  1Y1V G;  3RJ0 A;  1A9X A;  3G6Y A;  2JA7 A;  1RK5 A;  5J2U F;  4ECW A;  3TII A;  4IWX A;  4YQW A;  3Q8S B;  4JI8 H;  3GIQ A;  2FKL A;  2UXB H;  3GV5 B;  2OLS A;  3JAM W;  2W6O A;  2NU7 B;  3GID A;  4MA5 A;  4YAJ B;  5KT2 A;  2R7Z A;  3HOY G;  4K0K H;  1V9P A;  1TWH A;  2GPS A;  2UVR A;  4J9O A;  5EZY F;  4R8U A;  3H0G G;  3HBL A;  1L2Z A;  2W6Q A;  5KT7 A;  2W9C B;  1Y1W A;  3L4K A;  2PMZ A;  3ORR A;  2FK2 A;  3GV8 B;  4DLK A;  1KJQ A;  3MFH A;  4X65 H;  3V4S A;  3VMM A;  4IR9 A;  4X62 H;  2W8L A;  4JI1 H;  4A3F G;  2W7O A;  4EYI B;  3PZP A;  2JA6 G;  4MV4 A;  4O3N A;  4DR7 H;  3T5L A;  5KX5 F;  1HR0 H;  1K1S A;  4A3C G;  4RAZ A;  4IRK A;  1V51 A;  1V4Y A;  4EFE A;  5IP9 G;  4LSA A;  1S0O A;  4M7E A;  4DV5 H;  1RJR A;  4JI6 H;  1M0T A;  4DV0 H;  5GON F;  4DR3 H;  2R82 A;  3BQ1 A;  2UUA H;  4ETS A;  3BQ2 A;  2RGR A;  4ZOL F;  5KFL A;  4A2A A;  3U9T A;  5D1O B;  4LF6 H;  5DGB A;  2W9A A;  2YCH A;  3Q8R B;  5FLM G;  5KFG A;  2BQ3 A;  4A3D G;  2R92 A;  5KFH A;  1GGO A;  2KSW A;  2JEG A;  4ED8 A;  4EGQ A;  1VAJ A;  2WTF A;  4DV1 H;  3MR2 A;  1CE8 A;  1S9F A;  2E5L H;  1WCM A;  3I4N G;  5L1J A;  1N33 H;  1VBH A;  1RK6 A;  4LF9 H;  4X66 H;  5BMV F;  2W8K A;  5D8D A;  4JUZ A;  4YR2 A;  4ZQI A;  3RTX A;  5KG1 A;  2FPP B;  2R85 A;  4QW9 A;  4A3B G;  2WE6 A;  5KT5 A;  3F8N A;  4QWD A;  2ATL A;  2AQ4 A;  2W6Z A;  3ORQ A;  4J9L A;  4A2B A;  3ETH A;  4DL4 A;  2W71 A;  4O3P A;  4J9K A;  3I4M G;  1BNC A;  5FD6 A;  4C5B A;  1VKZ A;  3RBD A;  2R8J A;  5KFX A;  4BBS G;  4A3G G;  2W9C A;  1BGW A;  3FKI A;  4DUY H;  2VUM G;  4UCO A;  2ASD A;  1S0M A;  5KFT A;  3V6H A;  4FBU A;  5LA6 F;  4IHJ F;  3R5X A;  2R7N A;  2C2R A; 
#chains in the Genus database with same CATH homology
 2FK2 A;  2FK3 A;  4PWQ A;  1MWP A;  2FKL A;  2FMA A;  4JFN A;  1OWT A;  4PQD A;  3KTM A;  2M05 A;  2FJZ A;  2FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...