4PWQA

High-resolution crystal structure of the e1-domain of the amyloid precursor protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Amyloid Precursor Protein Shows a pH-Dependent Conformational Switch in Its E1 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin binding protein
molecule keywords Amyloid beta A4 protein
total genus 40
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 4pwqA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 4pwqA01
2FK2A 2FK1A 1MWPA 2FKLA 4JFNA 1OWTA 2M05A 3KTMA 4PQDA 2FMAA 2FJZA 4PWQA 2FK3A
chains in the Genus database with same CATH superfamily
5KT2A 4C5AA 4BY1G 1Y1WA 2YZGA 4JUZA 1I50A 4NXMH 4O4LF 4DR6H 2IA6A 3HOUG 1RJPA 2IMWP 2RGRA 5D1PA 2VOBA 4O2BF 4QJFA 1M0WA 4IZOA 4R8UA 1N34H 3J81W 3NGDA 2ATLA 4DR3H 1GLVA 1Y1WG 3CQZA 3G6XA 2KSWA 5I47A 3I4NG 3GV5B 4DV4H 4EBDA 1EZ1A 5CA0F 3N44B 2PMZE 2NUAB 3LMLA 4X65H 1ZETA 4J9KA 3RBEA 5DG7A 4LSXA 4C2MA 4UCRA 2X0SA 2YW2A 5KFNA 4YR0A 2FK1A 5KG0A 5JH7F 2I8CA 1DV2A 4EEQA 4DR2H 3RB3A 5FD6A 4Q8FA 4YY3H 1O75A 1AUVA 2NVYA 5JVDF 4M7EA 4TQRA 2W6NA 5KG5A 2BR0A 5FD5A 5BPFA 3TINA 1HNXH 2SCUB 4A3EG 1RYRA 4EEYA 2XCAA 2W57A 1GGOA 3R5HA 3R5XA 3MFIA 3JAMW 4R7RA 3QFFA 2YZMA 3UFXB 4U7CA 4BY7G 2VUGA 4YJ2F 3RAXA 2VQDA 3IG0A 4MV6A 5H80A 2W9AA 3EPGA 4ECVA 3V6JA 4GC6A 2I87A 5KFXA 5C1PA 5FLMG 5D1OB 3MR5A 1TWGA 3OHBA 5LYJF 2XGQA 3H40A 4FM9A 4GKJH 2R7LA 1TWHA 5L9XA 1BJTA 4Q45A 4RU9A 1JDBB 1WCMA 2HHHH 2Q2TA 4ZHQF 4UCOA 1GSHA 3T1HH 4ED7A 4ZQIA 3V4ZA 5DGAA 4XX0B 4DV2H 4A3MG 5KFUA 2W9CA 1K1SA 2ZM6H 5KFVA 2GPSA 1WR2A 2FPGB 4B3MH 4AYBA 4O3NA 2NU9B 4I7HA 3HXLA 2VPQA 4YB8B 1PX2A 3SI8A 3BA9A 5KT4A 2RF4A 2C2EA 1T3NA 3FMAA 1L2ZA 3RGXA 3RF2A 1BNCA 5KFFA 3T5JA 1M0TA 3GILA 1UC8A 5FPOA 3BQ0A 4LMYA 1JX4A 2DPJA 4EGJA 2YRXA 2VA3A 1XMQH 4RB3C 3KAJA 2UXDH 5KFGA 2JEIA 1EUCB 4WD3A 2DPIA 4ME6A 2JA5G 1TA8A 1CQIB 3I12A 3PR5B 4F4WA 4JI7H 3PO2G 1DGSA 4O3OA 3M9MB 5LP6F 4J9OA 4ECQA 1IOWA 5HV6A 3GIKA 2W6QA 1V9PA 3N43B 1K83A 2W71A 4A3GG 2OLSA 2O03A 2E5LH 2YU9A 4J9SA 5A2QW 2GLTA 5KFDA 1DIKA 1MZBA 1VKZA 4QIWA 4HNUA 4Q43A 2XGPA 3GIIA 4U6PA 2W7PA 4ED6A 1XNRH 4I4TF 4Q44A 4RUAA 5KX5F 4IRKA 3K5IA 3KHRA 2WE6A 2ASLA 4A3LG 2UUBH 3KXYT 4RNMA 3TIGA 2FLNA 4J9PA 1RK6A 3PW5A 2W6OA 2RDJA 1SCUB 1TWCA 2IP4A 1HR0H 3JZIA 3RV3A 1VAJA 1WCMG 2R7NA 3V6KA 4UCSA 1X9NA 4O4HF 3LWBA 4LF9H 1IBKH 4ED2A 2NVXA 5KFLA 2UXBH 3RV4A 1E4EB 2R6FA 1JDEA 3RJ0A 3OSNA 4DUZH 5JQWA 4LF6H 2W6MA 5C4XG 4JI0H 4JI1H 3BA8A 5JVLA 2W9BB 1ULZA 4BBRG 2FK3A 1S9FA 3BG5A 3HOXG 5L1LA 4YR3A 5C44G 3Q8SB 2HVSA 1IOVA 1CE8A 4JV1A 1ZHSA 4MV7A 2FJZA 4HYKA 1A0IA 4JV5H 3RUPA 5KG3A 1Z2NX 4XZ3B 2AGQA 2Y0SA 3GTLA 2W6PA 4HQ6A 5LMNH 4HNTA 2JEFA 2UVVA 3ETJA 3Q8PB 2BQRA 2VA2A 3K3VA 1B6SA 1GO3E 1PK8A 3L4KA 5LMUH 3RB4A 3TIIA 5KFEA 3J80W 1XMOH 2J6SA 3GQCA 5DLGA 1W96A 3MWMA 2J9GA 3HOVG 5J2UF 1KC7A 3MWDA 1SEIA 2JA7A 4BWSC 4ECWA 3HKZE 2JEJA 5DG9A 3PW0A 3V6HA 1RJQA 5LA6F 1JXLA 5JUMA 4JI5H 1S10A 5KFPA 1N36H 3MFHA 4FBUA 5KG7A 3WO1A 5IP7G 4YBZB 2IBKA 4LF4H 3FKIG 2FLLA 4YJ3F 2R8KA 2B63G 3GTMA 2W6ZA 1KJ8A 3GTJA 4K0KH 4OX9H 3BJYA 5CA1F 5D1OA 5KFTA 3RGZA 2WYOA 4O3PA 2ASJA 4RUCA 1MWPA 5FJ8G 3H3VH 5C3EG 4ECXA 3WO0A 4B3TH 4GLXA 1VBGA 5KFJA 4DR1H 5DG8A 4FS2A 1XDNA 1DV1A 2YS6A 1KJQA 4J9MA 1T36A 1HNZH 4QW8A 2MCTA 4YR2A 1I6UA 1R9TA 3KHGA 3BQ2A 2CW8A 3TQ1A 5IP9G 4AQYH 4A3DG 4GKKH 2YYAA 3L4JA 5EOYA 3G6VA 4EYHB 4EGQA 2CW7A 1EYZA 2FMAA 4RB2C 3T5LA 4RNOA 2BQUA 4DR4H 1N56A 2VQEH 2FK2A 3C0FB 2CKZB 4MV8A 2HVQA 4NLGA 2VQFH 2JA7G 5L1JA 5CB4F 2GPWA 4RAYA 3U9SA 5EWFA 4TUYF 4MTDA 5F9LA 1B04A 2J6UA 2W70A 4JV2A 4ECRA 3RFCA 5EDWA 4JI8H 3M4IA 4ED8A 1FVIA 4ZOLF 1I94H 4A3BG 4QIWE 2ZJTA 4J9NA 5D8DA 4QWBA 4R8UB 3AYHB 4FS1A 3RBDA 3HOYG 2OH2A 4X62H 4CC6A 1E4GT 1B33N 4YP3A 1KJ9A 1W93A 1S0MA 2NU6B 3OTOH 3FKIA 5F9NA 4DL5A 4O3RA 2W8LA 2B63A 4B3SH 4A3FG 2YCHA 2HJWA 2PN1A 3WNZA 1Z2PX 3QZ7A 5IYCG 4DLKA 3I4MG 4A93G 3M9OB 4DL7A 4JI3H 5KFKA 5KFRA 5KFOA 3PW2A 2HVRA 4Q0YA 4YHHH 4IWYA 1I7NA 4MA0A 4LSAA 3V4SA 4A3IG 2CQYA 3QZ8A 1FKAH 3VPDA 3VPBA 4A2BA 1BXRA 2XCLA 3H4DA 1P8LA 2E2HA 1I7LA 2PMZA 5BPHA 3HOZG 4LH6A 3VMMA 5KFHA 4UCUA 4DV0H 1M6VA 3M9NB 3GV7B 2E2IA 5KG2A 1UC9A 4F50A 3GIQA 3KTMA 4GC7A 3OSPA 4J0MA 4LF5H 5KKNB 4RNNA 2ZDGA 4A3KG 3RB6A 3K5HA 4E4TA 2V4RA 3PZPA 4QWDA 2UUAH 2R7ZA 2XD4A 4MV1A 4MA5A 2YZNA 3T5KA 2R84A 3MJFA 3G6YA 5LOVF 2WB1A 4EFEA 2J6TA 4A3CG 1GSOA 5EZYF 2C35B 3UQ8A 2W7OA 1S03G 2R85A 4MV9A 3HBLA 2ALZA 3GTKA 3N41B 2R7ZG 4RZRA 2HGSA 4DUYH 3PW4A 3CVZA 4JV0A 2Q2UA 3GTQA 1N32H 4JFNA 3HKZA 4EFBA 4UCTA 2FPIB 4YAJB 5KFSA 3K3PA 4ECSA 2AQ4A 3JSLA 2R7MA 2JA8G 4O4IF 4RZQA 2UUCH 1Y14B 2FLPA 2V4QA 4EBCA 1VS0A 4TQSA 3ETHA 2PBZA 5T14A 1C30A 4HNVA 4X66H 1AUXA 3MR6A 3IN5A 1N48A 2UXCH 2JEGA 4ED0A 4A3JG 3OUUA 2V9WA 1TWFA 1JKJB 4XYLB 5LL6b 4XYMB 4AYBE 1B6RA 2WAQE 2XIGA 3ORRA 2UVUA 3RIZA 5BMVF 2C2RA 3H20A 5KT7A 5EWGA 2P0AA 2W9BA 2R8IA 2FE3A 2FB9A 4RB1A 4DV3H 2UVRA 4DR7H 3JRXA 4RAZA 2DIKA 5KG1A 4UCVA 5IYDG 3GV8B 2I80A 2QK4A 4ETSA 4QW9A 4DV5H 4DV6H 5KT3A 5LXTF 4B3RH 3N8DA 5KT6A 2R8GA 1FJGH 3RAQA 2UU9H 4ECTA 2YRWA 5C5JA 3MR3A 2FPPB 2WB1E 5IWAH 4X64H 5KFCA 1WH2A 4IWXA 1SYXB 4MV4A 4DV1H 3JRWA 4EG0A 4ZI7F 4ECYA 1S0OA 1Y1VG 3T1YH 4IAJA 1S97A 4YAKB 2ASDA 5L1KA 2JA5A 2ZDQA 2DWCA 1K1QA 1OWTA 1RJRA 1BGWA 4EYIB 5KT5A 2VPSA 1KJJA 3R5FA 2WTFA 1EUDB 2XC9A 4BXXG 3GIDA 4TV8F 2C00A 1HNWH 3KALA 2CZGA 1Y1VA 3BQ1A 5KFYA 3ORQA 3MR2A 4LF7H 5KFBA 3GTGA 2R82A 2JA6A 5DQGA 4CC5A 4MAMA 5C1OA 1IBMH 1N33H 2WAQA 4G3IA 3H0GG 2RDIA 4QWCA 4I50F 4IRCA 2YL2A 1TWAA 1SFOA 4FU0A 4QWEA 2UVWA 3KAKA 2DLNA 3Q1KA 3N40P 4UFZA 5BR8H 3DF7A 3GIJA 1JIHA 4ECZA 4LFCH 2M05A 5KFZA 1E4FT 4NXNH 2R93A 5KFWA 3H0GA 4O2AF 3E5NA 4LH7A 4J9LA 2F4VH 5KG6A 3HOWG 4LF8H 1ZHQA 1M7JA 3N6XA 5L1IA 1RK5A 3VPCA 2QYZA 4I55F 5KG4A 5DQHA 4QWAA 3KHLA 4LFBH 3LP8A 4IRDA 5DGBA 2PVPA 4MTEA 5KFQA 1GSAA 4DL6A 4JI6H 1KBLA 5FLXW 2BQ3A 1S68A 1V51A 5KFAA 1UNNC 1V4YA 2NU8B 3EPIA 4PWQA 4Q8EA 1TAEA 3HB9A 3FDSA 2V5AA 4TV9F 5HBRB 2YS7A 4DL2A 3T5HA 4C5CA 3PO3G 4DL4A 3SE7A 2V58A 3Q2OA 1EHIA 3H4BA 3Q8RB 4DV7H 4YQWA 3OHAA 4IHJF 1A9XA 3Q8QB 3GLKA 3R23A 3J7AK 2R92G 3GTOA 5C8YF 2JA6G 2V59A 4WBNF 5CAEB 5DLFA 2R7KA 1KJIA 3G8CA 5DQIA 4HR7A 3GIPA 5GONF 2VR1A 2WDTA 1Z2OX 4Y8VB 4F4XA 4KHPH 2AGOA 2RGVA 5IT9W 2R86A 1E4EA 2AGPA 4BBSG 4IR1A 5FPRA 4C5BA 1T94A 2W9CB 1XNQH 4A2AA 2OWOA 2R93G 2C28A 4J9RA 2NU7B 3JSNA 3F8NA 1JLLB 3OUZA 3PR4A 2C22A 1CS0A 3BABA 2VUMG 4PDBA 4O3QA 3GTPA 5IYZF 2R8JA 4JI4H 1CQJB 1VBHA 1WSCA 1GYFA 2XCPA 2C2DA 4APMA 3RTXA 5IYBG 1ZQ7A 3L2PA 4RB0A 4J9QA 4EBEA 1J5EH 1IBLH 2R87A 4ED1A 5KFIA 4MV3A 1KEEA 4O3SA 4ED3A 3PVXA 2AU0A 3BAAA 2FKLA 2DZDA 4DL3A 1RYSA 4LFAH 5KFMA 2VUMA 2ZDHA 2Y0SE 3GIMA 1I3QA 3N42B 3TQTA 4ECUA 4PQDA 2FP4B 3PN1A 3PW7A 2R8HA 3KHHA 3MWEA 4F4ZA 1AN7A 4M9UA 4L1KA 4FBTA 3EYYA 4JYAH 3RB0A 3U9TA 5EWEA 4F4YA 2W8KA 4JI2H 5K2MA 1C3OA 4DR5H 2R92A 5J2TF 1S0NA 4IR9A
chains in the Genus database with same CATH topology
2FK2A 2FK1A 1MWPA 2FKLA 4JFNA 1OWTA 2M05A 3KTMA 4PQDA 2FMAA 2FJZA 4PWQA 2FK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK2 A;  2FK1 A;  1MWP A;  2FKL A;  4JFN A;  1OWT A;  2M05 A;  3KTM A;  4PQD A;  2FMA A;  2FJZ A;  4PWQ A;  2FK3 A; 
#chains in the Genus database with same CATH topology
 5KT2 A;  4C5A A;  4BY1 G;  1Y1W A;  2YZG A;  4JUZ A;  1I50 A;  4NXM H;  4O4L F;  4DR6 H;  2IA6 A;  3HOU G;  1RJP A;  2IMW P;  2RGR A;  5D1P A;  2VOB A;  4O2B F;  4QJF A;  1M0W A;  4IZO A;  4R8U A;  1N34 H;  3J81 W;  3NGD A;  2ATL A;  4DR3 H;  1GLV A;  1Y1W G;  3CQZ A;  3G6X A;  2KSW A;  5I47 A;  3I4N G;  3GV5 B;  4DV4 H;  4EBD A;  1EZ1 A;  5CA0 F;  3N44 B;  2PMZ E;  2NUA B;  3LML A;  4X65 H;  1ZET A;  4J9K A;  3RBE A;  5DG7 A;  4LSX A;  4C2M A;  4UCR A;  2X0S A;  2YW2 A;  5KFN A;  4YR0 A;  2FK1 A;  5KG0 A;  5JH7 F;  2I8C A;  1DV2 A;  4EEQ A;  4DR2 H;  3RB3 A;  5FD6 A;  4Q8F A;  4YY3 H;  1O75 A;  1AUV A;  2NVY A;  5JVD F;  4M7E A;  4TQR A;  2W6N A;  5KG5 A;  2BR0 A;  5FD5 A;  5BPF A;  3TIN A;  1HNX H;  2SCU B;  4A3E G;  1RYR A;  4EEY A;  2XCA A;  2W57 A;  1GGO A;  3R5H A;  3R5X A;  3MFI A;  3JAM W;  4R7R A;  3QFF A;  2YZM A;  3UFX B;  4U7C A;  4BY7 G;  2VUG A;  4YJ2 F;  3RAX A;  2VQD A;  3IG0 A;  4MV6 A;  5H80 A;  2W9A A;  3EPG A;  4ECV A;  3V6J A;  4GC6 A;  2I87 A;  5KFX A;  5C1P A;  5FLM G;  5D1O B;  3MR5 A;  1TWG A;  3OHB A;  5LYJ F;  2XGQ A;  3H40 A;  4FM9 A;  4GKJ H;  2R7L A;  1TWH A;  5L9X A;  1BJT A;  4Q45 A;  4RU9 A;  1JDB B;  1WCM A;  2HHH H;  2Q2T A;  4ZHQ F;  4UCO A;  1GSH A;  3T1H H;  4ED7 A;  4ZQI A;  3V4Z A;  5DGA A;  4XX0 B;  4DV2 H;  4A3M G;  5KFU A;  2W9C A;  1K1S A;  2ZM6 H;  5KFV A;  2GPS A;  1WR2 A;  2FPG B;  4B3M H;  4AYB A;  4O3N A;  2NU9 B;  4I7H A;  3HXL A;  2VPQ A;  4YB8 B;  1PX2 A;  3SI8 A;  3BA9 A;  5KT4 A;  2RF4 A;  2C2E A;  1T3N A;  3FMA A;  1L2Z A;  3RGX A;  3RF2 A;  1BNC A;  5KFF A;  3T5J A;  1M0T A;  3GIL A;  1UC8 A;  5FPO A;  3BQ0 A;  4LMY A;  1JX4 A;  2DPJ A;  4EGJ A;  2YRX A;  2VA3 A;  1XMQ H;  4RB3 C;  3KAJ A;  2UXD H;  5KFG A;  2JEI A;  1EUC B;  4WD3 A;  2DPI A;  4ME6 A;  2JA5 G;  1TA8 A;  1CQI B;  3I12 A;  3PR5 B;  4F4W A;  4JI7 H;  3PO2 G;  1DGS A;  4O3O A;  3M9M B;  5LP6 F;  4J9O A;  4ECQ A;  1IOW A;  5HV6 A;  3GIK A;  2W6Q A;  1V9P A;  3N43 B;  1K83 A;  2W71 A;  4A3G G;  2OLS A;  2O03 A;  2E5L H;  2YU9 A;  4J9S A;  5A2Q W;  2GLT A;  5KFD A;  1DIK A;  1MZB A;  1VKZ A;  4QIW A;  4HNU A;  4Q43 A;  2XGP A;  3GII A;  4U6P A;  2W7P A;  4ED6 A;  1XNR H;  4I4T F;  4Q44 A;  4RUA A;  5KX5 F;  4IRK A;  3K5I A;  3KHR A;  2WE6 A;  2ASL A;  4A3L G;  2UUB H;  3KXY T;  4RNM A;  3TIG A;  2FLN A;  4J9P A;  1RK6 A;  3PW5 A;  2W6O A;  2RDJ A;  1SCU B;  1TWC A;  2IP4 A;  1HR0 H;  3JZI A;  3RV3 A;  1VAJ A;  1WCM G;  2R7N A;  3V6K A;  4UCS A;  1X9N A;  4O4H F;  3LWB A;  4LF9 H;  1IBK H;  4ED2 A;  2NVX A;  5KFL A;  2UXB H;  3RV4 A;  1E4E B;  2R6F A;  1JDE A;  3RJ0 A;  3OSN A;  4DUZ H;  5JQW A;  4LF6 H;  2W6M A;  5C4X G;  4JI0 H;  4JI1 H;  3BA8 A;  5JVL A;  2W9B B;  1ULZ A;  4BBR G;  2FK3 A;  1S9F A;  3BG5 A;  3HOX G;  5L1L A;  4YR3 A;  5C44 G;  3Q8S B;  2HVS A;  1IOV A;  1CE8 A;  4JV1 A;  1ZHS A;  4MV7 A;  2FJZ A;  4HYK A;  1A0I A;  4JV5 H;  3RUP A;  5KG3 A;  1Z2N X;  4XZ3 B;  2AGQ A;  2Y0S A;  3GTL A;  2W6P A;  4HQ6 A;  5LMN H;  4HNT A;  2JEF A;  2UVV A;  3ETJ A;  3Q8P B;  2BQR A;  2VA2 A;  3K3V A;  1B6S A;  1GO3 E;  1PK8 A;  3L4K A;  5LMU H;  3RB4 A;  3TII A;  5KFE A;  3J80 W;  1XMO H;  2J6S A;  3GQC A;  5DLG A;  1W96 A;  3MWM A;  2J9G A;  3HOV G;  5J2U F;  1KC7 A;  3MWD A;  1SEI A;  2JA7 A;  4BWS C;  4ECW A;  3HKZ E;  2JEJ A;  5DG9 A;  3PW0 A;  3V6H A;  1RJQ A;  5LA6 F;  1JXL A;  5JUM A;  4JI5 H;  1S10 A;  5KFP A;  1N36 H;  3MFH A;  4FBU A;  5KG7 A;  3WO1 A;  5IP7 G;  4YBZ B;  2IBK A;  4LF4 H;  3FKI G;  2FLL A;  4YJ3 F;  2R8K A;  2B63 G;  3GTM A;  2W6Z A;  1KJ8 A;  3GTJ A;  4K0K H;  4OX9 H;  3BJY A;  5CA1 F;  5D1O A;  5KFT A;  3RGZ A;  2WYO A;  4O3P A;  2ASJ A;  4RUC A;  1MWP A;  5FJ8 G;  3H3V H;  5C3E G;  4ECX A;  3WO0 A;  4B3T H;  4GLX A;  1VBG A;  5KFJ A;  4DR1 H;  5DG8 A;  4FS2 A;  1XDN A;  1DV1 A;  2YS6 A;  1KJQ A;  4J9M A;  1T36 A;  1HNZ H;  4QW8 A;  2MCT A;  4YR2 A;  1I6U A;  1R9T A;  3KHG A;  3BQ2 A;  2CW8 A;  3TQ1 A;  5IP9 G;  4AQY H;  4A3D G;  4GKK H;  2YYA A;  3L4J A;  5EOY A;  3G6V A;  4EYH B;  4EGQ A;  2CW7 A;  1EYZ A;  2FMA A;  4RB2 C;  3T5L A;  4RNO A;  2BQU A;  4DR4 H;  1N56 A;  2VQE H;  2FK2 A;  3C0F B;  2CKZ B;  4MV8 A;  2HVQ A;  4NLG A;  2VQF H;  2JA7 G;  5L1J A;  5CB4 F;  2GPW A;  4RAY A;  3U9S A;  5EWF A;  4TUY F;  4MTD A;  5F9L A;  1B04 A;  2J6U A;  2W70 A;  4JV2 A;  4ECR A;  3RFC A;  5EDW A;  4JI8 H;  3M4I A;  4ED8 A;  1FVI A;  4ZOL F;  1I94 H;  4A3B G;  4QIW E;  2ZJT A;  4J9N A;  5D8D A;  4QWB A;  4R8U B;  3AYH B;  4FS1 A;  3RBD A;  3HOY G;  2OH2 A;  4X62 H;  4CC6 A;  1E4G T;  1B33 N;  4YP3 A;  1KJ9 A;  1W93 A;  1S0M A;  2NU6 B;  3OTO H;  3FKI A;  5F9N A;  4DL5 A;  4O3R A;  2W8L A;  2B63 A;  4B3S H;  4A3F G;  2YCH A;  2HJW A;  2PN1 A;  3WNZ A;  1Z2P X;  3QZ7 A;  5IYC G;  4DLK A;  3I4M G;  4A93 G;  3M9O B;  4DL7 A;  4JI3 H;  5KFK A;  5KFR A;  5KFO A;  3PW2 A;  2HVR A;  4Q0Y A;  4YHH H;  4IWY A;  1I7N A;  4MA0 A;  4LSA A;  3V4S A;  4A3I G;  2CQY A;  3QZ8 A;  1FKA H;  3VPD A;  3VPB A;  4A2B A;  1BXR A;  2XCL A;  3H4D A;  1P8L A;  2E2H A;  1I7L A;  2PMZ A;  5BPH A;  3HOZ G;  4LH6 A;  3VMM A;  5KFH A;  4UCU A;  4DV0 H;  1M6V A;  3M9N B;  3GV7 B;  2E2I A;  5KG2 A;  1UC9 A;  4F50 A;  3GIQ A;  3KTM A;  4GC7 A;  3OSP A;  4J0M A;  4LF5 H;  5KKN B;  4RNN A;  2ZDG A;  4A3K G;  3RB6 A;  3K5H A;  4E4T A;  2V4R A;  3PZP A;  4QWD A;  2UUA H;  2R7Z A;  2XD4 A;  4MV1 A;  4MA5 A;  2YZN A;  3T5K A;  2R84 A;  3MJF A;  3G6Y A;  5LOV F;  2WB1 A;  4EFE A;  2J6T A;  4A3C G;  1GSO A;  5EZY F;  2C35 B;  3UQ8 A;  2W7O A;  1S03 G;  2R85 A;  4MV9 A;  3HBL A;  2ALZ A;  3GTK A;  3N41 B;  2R7Z G;  4RZR A;  2HGS A;  4DUY H;  3PW4 A;  3CVZ A;  4JV0 A;  2Q2U A;  3GTQ A;  1N32 H;  4JFN A;  3HKZ A;  4EFB A;  4UCT A;  2FPI B;  4YAJ B;  5KFS A;  3K3P A;  4ECS A;  2AQ4 A;  3JSL A;  2R7M A;  2JA8 G;  4O4I F;  4RZQ A;  2UUC H;  1Y14 B;  2FLP A;  2V4Q A;  4EBC A;  1VS0 A;  4TQS A;  3ETH A;  2PBZ A;  5T14 A;  1C30 A;  4HNV A;  4X66 H;  1AUX A;  3MR6 A;  3IN5 A;  1N48 A;  2UXC H;  2JEG A;  4ED0 A;  4A3J G;  3OUU A;  2V9W A;  1TWF A;  1JKJ B;  4XYL B;  5LL6 b;  4XYM B;  4AYB E;  1B6R A;  2WAQ E;  2XIG A;  3ORR A;  2UVU A;  3RIZ A;  5BMV F;  2C2R A;  3H20 A;  5KT7 A;  5EWG A;  2P0A A;  2W9B A;  2R8I A;  2FE3 A;  2FB9 A;  4RB1 A;  4DV3 H;  2UVR A;  4DR7 H;  3JRX A;  4RAZ A;  2DIK A;  5KG1 A;  4UCV A;  5IYD G;  3GV8 B;  2I80 A;  2QK4 A;  4ETS A;  4QW9 A;  4DV5 H;  4DV6 H;  5KT3 A;  5LXT F;  4B3R H;  3N8D A;  5KT6 A;  2R8G A;  1FJG H;  3RAQ A;  2UU9 H;  4ECT A;  2YRW A;  5C5J A;  3MR3 A;  2FPP B;  2WB1 E;  5IWA H;  4X64 H;  5KFC A;  1WH2 A;  4IWX A;  1SYX B;  4MV4 A;  4DV1 H;  3JRW A;  4EG0 A;  4ZI7 F;  4ECY A;  1S0O A;  1Y1V G;  3T1Y H;  4IAJ A;  1S97 A;  4YAK B;  2ASD A;  5L1K A;  2JA5 A;  2ZDQ A;  2DWC A;  1K1Q A;  1OWT A;  1RJR A;  1BGW A;  4EYI B;  5KT5 A;  2VPS A;  1KJJ A;  3R5F A;  2WTF A;  1EUD B;  2XC9 A;  4BXX G;  3GID A;  4TV8 F;  2C00 A;  1HNW H;  3KAL A;  2CZG A;  1Y1V A;  3BQ1 A;  5KFY A;  3ORQ A;  3MR2 A;  4LF7 H;  5KFB A;  3GTG A;  2R82 A;  2JA6 A;  5DQG A;  4CC5 A;  4MAM A;  5C1O A;  1IBM H;  1N33 H;  2WAQ A;  4G3I A;  3H0G G;  2RDI A;  4QWC A;  4I50 F;  4IRC A;  2YL2 A;  1TWA A;  1SFO A;  4FU0 A;  4QWE A;  2UVW A;  3KAK A;  2DLN A;  3Q1K A;  3N40 P;  4UFZ A;  5BR8 H;  3DF7 A;  3GIJ A;  1JIH A;  4ECZ A;  4LFC H;  2M05 A;  5KFZ A;  1E4F T;  4NXN H;  2R93 A;  5KFW A;  3H0G A;  4O2A F;  3E5N A;  4LH7 A;  4J9L A;  2F4V H;  5KG6 A;  3HOW G;  4LF8 H;  1ZHQ A;  1M7J A;  3N6X A;  5L1I A;  1RK5 A;  3VPC A;  2QYZ A;  4I55 F;  5KG4 A;  5DQH A;  4QWA A;  3KHL A;  4LFB H;  3LP8 A;  4IRD A;  5DGB A;  2PVP A;  4MTE A;  5KFQ A;  1GSA A;  4DL6 A;  4JI6 H;  1KBL A;  5FLX W;  2BQ3 A;  1S68 A;  1V51 A;  5KFA A;  1UNN C;  1V4Y A;  2NU8 B;  3EPI A;  4PWQ A;  4Q8E A;  1TAE A;  3HB9 A;  3FDS A;  2V5A A;  4TV9 F;  5HBR B;  2YS7 A;  4DL2 A;  3T5H A;  4C5C A;  3PO3 G;  4DL4 A;  3SE7 A;  2V58 A;  3Q2O A;  1EHI A;  3H4B A;  3Q8R B;  4DV7 H;  4YQW A;  3OHA A;  4IHJ F;  1A9X A;  3Q8Q B;  3GLK A;  3R23 A;  3J7A K;  2R92 G;  3GTO A;  5C8Y F;  2JA6 G;  2V59 A;  4WBN F;  5CAE B;  5DLF A;  2R7K A;  1KJI A;  3G8C A;  5DQI A;  4HR7 A;  3GIP A;  5GON F;  2VR1 A;  2WDT A;  1Z2O X;  4Y8V B;  4F4X A;  4KHP H;  2AGO A;  2RGV A;  5IT9 W;  2R86 A;  1E4E A;  2AGP A;  4BBS G;  4IR1 A;  5FPR A;  4C5B A;  1T94 A;  2W9C B;  1XNQ H;  4A2A A;  2OWO A;  2R93 G;  2C28 A;  4J9R A;  2NU7 B;  3JSN A;  3F8N A;  1JLL B;  3OUZ A;  3PR4 A;  2C22 A;  1CS0 A;  3BAB A;  2VUM G;  4PDB A;  4O3Q A;  3GTP A;  5IYZ F;  2R8J A;  4JI4 H;  1CQJ B;  1VBH A;  1WSC A;  1GYF A;  2XCP A;  2C2D A;  4APM A;  3RTX A;  5IYB G;  1ZQ7 A;  3L2P A;  4RB0 A;  4J9Q A;  4EBE A;  1J5E H;  1IBL H;  2R87 A;  4ED1 A;  5KFI A;  4MV3 A;  1KEE A;  4O3S A;  4ED3 A;  3PVX A;  2AU0 A;  3BAA A;  2FKL A;  2DZD A;  4DL3 A;  1RYS A;  4LFA H;  5KFM A;  2VUM A;  2ZDH A;  2Y0S E;  3GIM A;  1I3Q A;  3N42 B;  3TQT A;  4ECU A;  4PQD A;  2FP4 B;  3PN1 A;  3PW7 A;  2R8H A;  3KHH A;  3MWE A;  4F4Z A;  1AN7 A;  4M9U A;  4L1K A;  4FBT A;  3EYY A;  4JYA H;  3RB0 A;  3U9T A;  5EWE A;  4F4Y A;  2W8K A;  4JI2 H;  5K2M A;  1C3O A;  4DR5 H;  2R92 A;  5J2T F;  1S0N A;  4IR9 A; 
#chains in the Genus database with same CATH homology
 2FK2 A;  2FK1 A;  1MWP A;  2FKL A;  4JFN A;  1OWT A;  2M05 A;  3KTM A;  4PQD A;  2FMA A;  2FJZ A;  4PWQ A;  2FK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...