4PWQA

High-resolution crystal structure of the e1-domain of the amyloid precursor protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
b'LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein
publication title The Amyloid Precursor Protein Shows a pH-Dependent Conformational Switch in Its E1 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin binding protein
total genus 40
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 4pwqA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 4pwqA01
4JFNA 3KTMA 1OWTA 2M05A 2FJZA 2FMAA 2FK1A 4PQDA 2FK3A 2FKLA 1MWPA 2FK2A 4PWQA
chains in the Genus database with same CATH superfamily
2AGOA 2PVPA 4J9SA 2UVRA 2M05A 1KJ8A 3BA8A 4TV9F 1Y1VA 3OUUA 5D1OB 3H0GG 5KFEA 3Q8PB 3RB0A 5EOYA 3JRWA 2AGQA 3BA9A 4R8UB 1EUCB 3JSLA 4O3NA 4TQRA 4FM9A 2UUCH 2FMAA 4QJFA 3BQ2A 3EPIA 4IR9A 2PN1A 1RK6A 3VPCA 4FBTA 5IYZF 4ED8A 4YP3A 3GTPA 1MWPA 4ED7A 3OSNA 2BQRA 5KFSA 1N56A 4JV2A 3QZ7A 4J9QA 2VA2A 3HOZG 2CW8A 1KBLA 2DLNA 4QWEA 5KFKA 5FD5A 4LF5H 5KFVA 4A93G 4RB1A 3RV3A 2NVYA 3N6XA 4I55F 2UXBH 2NU9B 2FK1A 2PMZA 3BQ1A 1SCUB 1GO3E 4O4LF 2MCTA 4EYIB 1IOWA 5C5JA 4DV5H 3GILA 4A2BA 4Q43A 4HNUA 3RAXA 1Y1VG 2RGRA 1V51A 3RB6A 2Y0SE 1TWGA 3U9TA 4YHHH 4BBRG 4ECXA 2NVXA 4FS1A 1W96A 3R23A 4ME6A 2PMZE 2W7PA 3IN5A 4OX9H 3T5KA 4LF9H 3UQ8A 5LL6b 4J9RA 3JAMW 3BQ0A 3QFFA 5DQHA 4J9OA 3GTJA 4JI2H 3N44B 3Q2OA 3RTXA 4PDBA 2FLLA 2VUGA 2XCLA 1EUDB 5LYJF 1OWTA 2CQYA 3TQTA 4AYBA 3PW5A 1GSOA 4JI8H 2R93A 5D1OA 4R7RA 2W9CB 1GYFA 4UCUA 1SFOA 4PWQA 4R8UA 4LSXA 1VS0A 4UFZA 1JX4A 1B04A 5EWEA 2KSWA 4F4WA 4Q8EA 5K2MA 1AUXA 1M0WA 2W9BA 2J6UA 1TWAA 1A9XA 5KFBA 1XMOH 4IHJF 2JEGA 2XGQA 3PO2G 1T3NA 4O4HF 2DPJA 1FKAH 4EBDA 3MJFA 5JQWA 2JEFA 1UNNC 1A0IA 4XYMB 3RJ0A 2I80A 3KALA 4MV7A 1I94H 2ZDGA 3PZPA 4YJ3F 4GC6A 4HNVA 4LFBH 4M9UA 2CZGA 5DG9A 4RB2C 4DUZH 3I4MG 5IYDG 2R93G 4J0MA 3PW0A 3HB9A 5KFHA 5DG8A 4X66H 2W6ZA 2J6TA 4LF6H 5CA0F 4QW9A 2YYAA 4O3OA 2WYOA 4LH7A 5KFWA 4A3EG 3G8CA 1N34H 4JI4H 1T36A 3GTLA 4YB8B 1UC8A 5BMVF 3VPDA 4U6PA 1WR2A 4ED3A 4IR1A 3MWDA 2WB1E 1TA8A 5KFAA 4JI6H 1DV1A 2W70A 1KJ9A 2R6FA 2JA8G 2W7OA 2R92A 3L2PA 1B33N 2VOBA 2W9CA 1ZHSA 4YR2A 4X62H 4MTDA 1IBLH 4JV1A 5T14A 1CQIB 1GSHA 4WBNF 2V4RA 3GTMA 2R8KA 4ED0A 5CA1F 2ZDHA 5KT2A 2R85A 3EYYA 1RJQA 3IG0A 1N33H 2IBKA 4DL2A 2HJWA 4I7HA 4RNOA 2R8IA 2VQEH 3MWMA 3HOVG 2AQ4A 1I7LA 4YR0A 4MV6A 5C1OA 5C44G 5IWAH 1S0OA 4DL6A 1I6UA 1TWFA 5IYCG 1K83A 3HOWG 3J7AK 2BR0A 2X0SA 3AYHB 3ETHA 4HQ6A 3V6JA 5FJ8G 2UVUA 4IRKA 3PW4A 4A3GG 1Z2OX 1GSAA 4LMYA 5KT6A 3Q8RB 4ECQA 1S97A 4RAZA 1S10A 2E2HA 2XD4A 1CS0A 4ECVA 1RYRA 1EYZA 4JI0H 4B3RH 5JVLA 2VUMG 4XX0B 2HVRA 5KFUA 4QWCA 4JUZA 4ZOLF 2W8KA 3L4KA 4DV6H 2R92G 1DIKA 5L1KA 2R86A 3GIQA 2W9BB 4ED2A 3RAQA 1XNRH 3ORRA 2YL2A 2YZGA 3ETJA 3JZIA 3OUZA 4BBSG 4ZHQF 2YS7A 4DLKA 1Y1WA 2Y0SA 4A3MG 4XYLB 4ETSA 2JEJA 4A3LG 2P0AA 2UUBH 4LF7H 1VBHA 1WSCA 2FPIB 1TWHA 3PW7A 1EHIA 2V5AA 5KFGA 3DF7A 1XMQH 1GLVA 4MV4A 4ECUA 4RB0A 3RF2A 4NXMH 2NU6B 1DV2A 4EFBA 2JA6A 1EZ1A 1BJTA 3KHGA 4A2AA 2W57A 4MV3A 3TINA 4YAJB 3GIDA 2FP4B 4YJ2F 4EGQA 2J6SA 2YU9A 4O2BF 2FKLA 2RDIA 4IWYA 2OWOA 3N43B 4RAYA 5FPOA 4RNNA 3ORQA 3N40P 1BNCA 4O2AF 2PBZA 3J80W 4F4YA 4DL4A 4FBUA 1P8LA 4O3QA 1Z2PX 2DPIA 3FDSA 4DL5A 2Q2TA 4EEQA 2JA7A 4UCOA 3KXYT 1TAEA 5KFTA 2V4QA 1Y1WG 3GTQA 4G3IA 5J2TF 5KFYA 5L1IA 2R8GA 5C4XG 1M0TA 3HKZE 1ZETA 1AN7A 4ZQIA 2W6MA 4F50A 4A3JG 1VKZA 2VPSA 1K1QA 5F9LA 1IBKH 3PVXA 3NGDA 5KFNA 3GIIA 1JDBB 4YBZB 3U9SA 1JLLB 3H20A 4QIWE 3GQCA 4B3TH 4LFCH 4Q44A 2I8CA 2HGSA 5KFPA 4GKKH 2JA6G 3RBDA 3V4ZA 4CC6A 5C8YF 3GIMA 3WO1A 1S0NA 1ULZA 3K3VA 5KFXA 5KFZA 4J9NA 4M7EA 3I4NG 5KG1A 4J9PA 1HNWH 2R7LA 2UXCH 1S0MA 2ALZA 2UVVA 4WD3A 5KT7A 5L1LA 3H4BA 3R5FA 5CB4F 2W71A 3KAKA 2RF4A 5KT3A 4RZRA 1KEEA 4HNTA 5KFIA 3RB4A 2HHHH 3GTGA 2R8JA 3H3VH 4LH6A 3GTOA 3GIKA 2CKZB 5KG3A 2C22A 3GTKA 2W6PA 2VPQA 1KC7A 2C28A 4CC5A 4C2MA 2WB1A 4F4ZA 1FJGH 3LMLA 3EPGA 2JA5A 2NU7B 2IMWP 3J81W 4DV7H 3HOXG 4JV5H 3T5HA 4UCRA 1L2ZA 4GLXA 1W93A 3PW2A 5JVDF 2AGPA 5KFRA 5DQIA 4XZ3B 2GPWA 3RV4A 4BY7G 1FVIA 3R5HA 4JV0A 2ZJTA 4U7CA 3G6XA 4ECYA 4AQYH 1O75A 2XC9A 3GIJA 1N32H 3MFIA 1KJQA 4JFNA 1B6SA 4O3SA 4F4XA 5LMUH 1ZQ7A 1B6RA 3M9OB 4DV4H 2YZNA 5KG4A 1N48A 3BJYA 5D8DA 4Q0YA 2RGVA 5LMNH 1PX2A 1XDNA 4J9MA 2NUAB 4GC7A 1J5EH 3V4SA 1Y14B 5JUMA 3GV5B 2C35B 1XNQH 1CE8A 2VQDA 2C2RA 1SYXB 1S03G 1HR0H 4EBEA 4QW8A 4DUYH 5J2UF 4ECZA 5KFCA 4ECRA 4C5AA 2W6NA 2HVQA 5DLGA 1K1SA 4O3PA 1S68A 3WO0A 5KFJA 2R7NA 5BR8H 2YRWA 3TIIA 2JA5G 3OSPA 5LA6F 1GGOA 1I3QA 3I12A 3G6VA 1Z2NX 5KG5A 3OHAA 4ZI7F 2OH2A 4GKJH 5LXTF 1T94A 4BY1G 2CW7A 5BPFA 5C3EG 5DLFA 2IA6A 2C2EA 2B63A 2R7ZA 3JRXA 4HYKA 4A3DG 1HNZH 4PQDA 1AUVA 2WE6A 5KFFA 2VQFH 3V6KA 3GIPA 4KHPH 3E5NA 2WDTA 3PR5B 3Q1KA 4IAJA 5KFMA 3OHBA 3PN1A 4DR3H 1M6VA 1PK8A 4NLGA 4DR2H 2R84A 2W6QA 5KFLA 3C0FB 5H80A 4O3RA 4TUYF 1WH2A 3MR3A 3SE7A 5KFDA 3GLKA 1WCMA 2I87A 4UCSA 5C1PA 4L1KA 2XCAA 4MV9A 2R8HA 2V58A 5L1JA 3VPBA 3WNZA 2WAQE 1RJRA 3K3PA 4Q45A 3KHHA 4RUAA 5JH7F 2W6OA 1C30A 3BABA 2UVWA 3R5XA 3N8DA 2YW2A 1V4YA 4MAMA 4X65H 2ASLA 4IZOA 2FK3A 4DR1H 2XIGA 4EFEA 4RB3C 4A3FG 4JYAH 3VMMA 2ZM6H 4NXNH 2B63G 4X64H 4QWAA 5L9XA 3V6HA 2R7ZG 5KFOA 4RUCA 5F9NA 3K5HA 4I4TF 4QWDA 4ECWA 2O03A 3BG5A 5BPHA 2HVSA 5KKNB 5GONF 4JI5H 3HKZA 4O4IF 2BQUA 1KJJA 5FD6A 3KHLA 3KAJA 1S9FA 1DGSA 1N36H 2ATLA 2FE3A 2R87A 1ZHQA 4IRDA 4Q8FA 2FPGB 2IP4A 2YRXA 4DR7H 1E4FT 1R9TA 2ASDA 2GLTA 4QIWA 5D1PA 4ECSA 1WCMG 1JXLA 3GV8B 4BXXG 1RJPA 2JEIA 5EWGA 4ECTA 1HNXH 2VR1A 4Y8VB 5HBRB 3M9NB 1E4EA 5DQGA 4A3KG 4JI7H 2R7KA 5DG7A 3FKIA 4UCVA 3HOUG 1IOVA 4DV0H 1UC9A 3BAAA 2YS6A 5I47A 2XCPA 2FJZA 1VBGA 4RZQA 2DWCA 5KG6A 3TQ1A 2QYZA 5KG2A 3HXLA 4DR6H 5KT4A 5DGAA 2VA3A 3RUPA 5KG7A 4EGJA 4JI1H 4C5CA 1JIHA 3QZ8A 3H40A 1X9NA 4EBCA 5DGBA 4ED6A 4DV3H 5EWFA 4DL3A 2E5LH 3RB3A 4MA0A 5CAEB 4IRCA 4MA5A 4I50F 2FB9A 5FLMG 2E2IA 3F8NA 2GPSA 3MR5A 5FLXW 3SI8A 4QWBA 3CVZA 2JA7G 3KHRA 3Q8SB 4FS2A 4J9KA 3FMAA 2FPPB 3PR4A 4FU0A 4AYBE 3FKIG 1BXRA 3K5IA 2R82A 2XGPA 2FK2A 4HR7A 3RGXA 3G6YA 5KFQA 2YCHA 1MZBA 4RNMA 2ASJA 5LP6F 3RGZA 4DR4H 5LOVF 4E4TA 5KX5F 4EG0A 4LF8H 3MR6A 2FLNA 5IP7G 4B3SH 3JSNA 3MFHA 2V59A 2ZDQA 2YZMA 3UFXB 3RIZA 5EDWA 3T1HH 3GV7B 4J9LA 4EEYA 3CQZA 4LF4H 2J9GA 4DV1H 3L4JA 4ED1A 4C5BA 4A3CG 5FPRA 1M7JA 1KJIA 4LFAH 2QK4A 1JKJB 5IYBG 5EZYF 4YQWA 2FLPA 4EYHB 2Q2UA 3M4IA 3LP8A 3HOYG 3MR2A 3T1YH 3H0GA 4APMA 4DV2H 3Q8QB 4DR5H 2VUMA 5HV6A 1E4GT 3N41B 1RYSA 3OTOH 4DL7A 2W8LA 2RDJA 1IBMH 4UCTA 1CQJB 3RFCA 3HBLA 4B3MH 4BWSC 3H4DA 2UU9H 5KG0A 4YAKB 4YR3A 4MV8A 4TQSA 3N42B 5A2QW 1RK5A 4IWXA 2W9AA 2V9WA 1E4EB 4YY3H 2WAQA 3T5LA 4MV1A 2C2DA 3M9MB 4K0KH 2C00A 4A3IG 3LWBA 2WTFA 5KT5A 3T5JA 1TWCA 4RU9A 4JI3H 2F4VH 2OLSA 1VAJA 2DZDA 1V9PA 3RBEA 2AU0A 2NU8B 3PO3G 1JDEA 4TV8F 3MWEA 1BGWA 2DIKA 2SCUB 3TIGA 4LSAA 3KTMA 2R7MA 4MTEA 1I7NA 1I50A 2UXDH 5IT9W 1C3OA 5IP9G 2UUAH 4A3BG 1SEIA 2BQ3A
chains in the Genus database with same CATH topology
4JFNA 3KTMA 1OWTA 2M05A 2FJZA 2FMAA 2FK1A 4PQDA 2FK3A 2FKLA 1MWPA 2FK2A 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFN A;  3KTM A;  1OWT A;  2M05 A;  2FJZ A;  2FMA A;  2FK1 A;  4PQD A;  2FK3 A;  2FKL A;  1MWP A;  2FK2 A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 2AGO A;  2PVP A;  4J9S A;  2UVR A;  2M05 A;  1KJ8 A;  3BA8 A;  4TV9 F;  1Y1V A;  3OUU A;  5D1O B;  3H0G G;  5KFE A;  3Q8P B;  3RB0 A;  5EOY A;  3JRW A;  2AGQ A;  3BA9 A;  4R8U B;  1EUC B;  3JSL A;  4O3N A;  4TQR A;  4FM9 A;  2UUC H;  2FMA A;  4QJF A;  3BQ2 A;  3EPI A;  4IR9 A;  2PN1 A;  1RK6 A;  3VPC A;  4FBT A;  5IYZ F;  4ED8 A;  4YP3 A;  3GTP A;  1MWP A;  4ED7 A;  3OSN A;  2BQR A;  5KFS A;  1N56 A;  4JV2 A;  3QZ7 A;  4J9Q A;  2VA2 A;  3HOZ G;  2CW8 A;  1KBL A;  2DLN A;  4QWE A;  5KFK A;  5FD5 A;  4LF5 H;  5KFV A;  4A93 G;  4RB1 A;  3RV3 A;  2NVY A;  3N6X A;  4I55 F;  2UXB H;  2NU9 B;  2FK1 A;  2PMZ A;  3BQ1 A;  1SCU B;  1GO3 E;  4O4L F;  2MCT A;  4EYI B;  1IOW A;  5C5J A;  4DV5 H;  3GIL A;  4A2B A;  4Q43 A;  4HNU A;  3RAX A;  1Y1V G;  2RGR A;  1V51 A;  3RB6 A;  2Y0S E;  1TWG A;  3U9T A;  4YHH H;  4BBR G;  4ECX A;  2NVX A;  4FS1 A;  1W96 A;  3R23 A;  4ME6 A;  2PMZ E;  2W7P A;  3IN5 A;  4OX9 H;  3T5K A;  4LF9 H;  3UQ8 A;  5LL6 b;  4J9R A;  3JAM W;  3BQ0 A;  3QFF A;  5DQH A;  4J9O A;  3GTJ A;  4JI2 H;  3N44 B;  3Q2O A;  3RTX A;  4PDB A;  2FLL A;  2VUG A;  2XCL A;  1EUD B;  5LYJ F;  1OWT A;  2CQY A;  3TQT A;  4AYB A;  3PW5 A;  1GSO A;  4JI8 H;  2R93 A;  5D1O A;  4R7R A;  2W9C B;  1GYF A;  4UCU A;  1SFO A;  4PWQ A;  4R8U A;  4LSX A;  1VS0 A;  4UFZ A;  1JX4 A;  1B04 A;  5EWE A;  2KSW A;  4F4W A;  4Q8E A;  5K2M A;  1AUX A;  1M0W A;  2W9B A;  2J6U A;  1TWA A;  1A9X A;  5KFB A;  1XMO H;  4IHJ F;  2JEG A;  2XGQ A;  3PO2 G;  1T3N A;  4O4H F;  2DPJ A;  1FKA H;  4EBD A;  3MJF A;  5JQW A;  2JEF A;  1UNN C;  1A0I A;  4XYM B;  3RJ0 A;  2I80 A;  3KAL A;  4MV7 A;  1I94 H;  2ZDG A;  3PZP A;  4YJ3 F;  4GC6 A;  4HNV A;  4LFB H;  4M9U A;  2CZG A;  5DG9 A;  4RB2 C;  4DUZ H;  3I4M G;  5IYD G;  2R93 G;  4J0M A;  3PW0 A;  3HB9 A;  5KFH A;  5DG8 A;  4X66 H;  2W6Z A;  2J6T A;  4LF6 H;  5CA0 F;  4QW9 A;  2YYA A;  4O3O A;  2WYO A;  4LH7 A;  5KFW A;  4A3E G;  3G8C A;  1N34 H;  4JI4 H;  1T36 A;  3GTL A;  4YB8 B;  1UC8 A;  5BMV F;  3VPD A;  4U6P A;  1WR2 A;  4ED3 A;  4IR1 A;  3MWD A;  2WB1 E;  1TA8 A;  5KFA A;  4JI6 H;  1DV1 A;  2W70 A;  1KJ9 A;  2R6F A;  2JA8 G;  2W7O A;  2R92 A;  3L2P A;  1B33 N;  2VOB A;  2W9C A;  1ZHS A;  4YR2 A;  4X62 H;  4MTD A;  1IBL H;  4JV1 A;  5T14 A;  1CQI B;  1GSH A;  4WBN F;  2V4R A;  3GTM A;  2R8K A;  4ED0 A;  5CA1 F;  2ZDH A;  5KT2 A;  2R85 A;  3EYY A;  1RJQ A;  3IG0 A;  1N33 H;  2IBK A;  4DL2 A;  2HJW A;  4I7H A;  4RNO A;  2R8I A;  2VQE H;  3MWM A;  3HOV G;  2AQ4 A;  1I7L A;  4YR0 A;  4MV6 A;  5C1O A;  5C44 G;  5IWA H;  1S0O A;  4DL6 A;  1I6U A;  1TWF A;  5IYC G;  1K83 A;  3HOW G;  3J7A K;  2BR0 A;  2X0S A;  3AYH B;  3ETH A;  4HQ6 A;  3V6J A;  5FJ8 G;  2UVU A;  4IRK A;  3PW4 A;  4A3G G;  1Z2O X;  1GSA A;  4LMY A;  5KT6 A;  3Q8R B;  4ECQ A;  1S97 A;  4RAZ A;  1S10 A;  2E2H A;  2XD4 A;  1CS0 A;  4ECV A;  1RYR A;  1EYZ A;  4JI0 H;  4B3R H;  5JVL A;  2VUM G;  4XX0 B;  2HVR A;  5KFU A;  4QWC A;  4JUZ A;  4ZOL F;  2W8K A;  3L4K A;  4DV6 H;  2R92 G;  1DIK A;  5L1K A;  2R86 A;  3GIQ A;  2W9B B;  4ED2 A;  3RAQ A;  1XNR H;  3ORR A;  2YL2 A;  2YZG A;  3ETJ A;  3JZI A;  3OUZ A;  4BBS G;  4ZHQ F;  2YS7 A;  4DLK A;  1Y1W A;  2Y0S A;  4A3M G;  4XYL B;  4ETS A;  2JEJ A;  4A3L G;  2P0A A;  2UUB H;  4LF7 H;  1VBH A;  1WSC A;  2FPI B;  1TWH A;  3PW7 A;  1EHI A;  2V5A A;  5KFG A;  3DF7 A;  1XMQ H;  1GLV A;  4MV4 A;  4ECU A;  4RB0 A;  3RF2 A;  4NXM H;  2NU6 B;  1DV2 A;  4EFB A;  2JA6 A;  1EZ1 A;  1BJT A;  3KHG A;  4A2A A;  2W57 A;  4MV3 A;  3TIN A;  4YAJ B;  3GID A;  2FP4 B;  4YJ2 F;  4EGQ A;  2J6S A;  2YU9 A;  4O2B F;  2FKL A;  2RDI A;  4IWY A;  2OWO A;  3N43 B;  4RAY A;  5FPO A;  4RNN A;  3ORQ A;  3N40 P;  1BNC A;  4O2A F;  2PBZ A;  3J80 W;  4F4Y A;  4DL4 A;  4FBU A;  1P8L A;  4O3Q A;  1Z2P X;  2DPI A;  3FDS A;  4DL5 A;  2Q2T A;  4EEQ A;  2JA7 A;  4UCO A;  3KXY T;  1TAE A;  5KFT A;  2V4Q A;  1Y1W G;  3GTQ A;  4G3I A;  5J2T F;  5KFY A;  5L1I A;  2R8G A;  5C4X G;  1M0T A;  3HKZ E;  1ZET A;  1AN7 A;  4ZQI A;  2W6M A;  4F50 A;  4A3J G;  1VKZ A;  2VPS A;  1K1Q A;  5F9L A;  1IBK H;  3PVX A;  3NGD A;  5KFN A;  3GII A;  1JDB B;  4YBZ B;  3U9S A;  1JLL B;  3H20 A;  4QIW E;  3GQC A;  4B3T H;  4LFC H;  4Q44 A;  2I8C A;  2HGS A;  5KFP A;  4GKK H;  2JA6 G;  3RBD A;  3V4Z A;  4CC6 A;  5C8Y F;  3GIM A;  3WO1 A;  1S0N A;  1ULZ A;  3K3V A;  5KFX A;  5KFZ A;  4J9N A;  4M7E A;  3I4N G;  5KG1 A;  4J9P A;  1HNW H;  2R7L A;  2UXC H;  1S0M A;  2ALZ A;  2UVV A;  4WD3 A;  5KT7 A;  5L1L A;  3H4B A;  3R5F A;  5CB4 F;  2W71 A;  3KAK A;  2RF4 A;  5KT3 A;  4RZR A;  1KEE A;  4HNT A;  5KFI A;  3RB4 A;  2HHH H;  3GTG A;  2R8J A;  3H3V H;  4LH6 A;  3GTO A;  3GIK A;  2CKZ B;  5KG3 A;  2C22 A;  3GTK A;  2W6P A;  2VPQ A;  1KC7 A;  2C28 A;  4CC5 A;  4C2M A;  2WB1 A;  4F4Z A;  1FJG H;  3LML A;  3EPG A;  2JA5 A;  2NU7 B;  2IMW P;  3J81 W;  4DV7 H;  3HOX G;  4JV5 H;  3T5H A;  4UCR A;  1L2Z A;  4GLX A;  1W93 A;  3PW2 A;  5JVD F;  2AGP A;  5KFR A;  5DQI A;  4XZ3 B;  2GPW A;  3RV4 A;  4BY7 G;  1FVI A;  3R5H A;  4JV0 A;  2ZJT A;  4U7C A;  3G6X A;  4ECY A;  4AQY H;  1O75 A;  2XC9 A;  3GIJ A;  1N32 H;  3MFI A;  1KJQ A;  4JFN A;  1B6S A;  4O3S A;  4F4X A;  5LMU H;  1ZQ7 A;  1B6R A;  3M9O B;  4DV4 H;  2YZN A;  5KG4 A;  1N48 A;  3BJY A;  5D8D A;  4Q0Y A;  2RGV A;  5LMN H;  1PX2 A;  1XDN A;  4J9M A;  2NUA B;  4GC7 A;  1J5E H;  3V4S A;  1Y14 B;  5JUM A;  3GV5 B;  2C35 B;  1XNQ H;  1CE8 A;  2VQD A;  2C2R A;  1SYX B;  1S03 G;  1HR0 H;  4EBE A;  4QW8 A;  4DUY H;  5J2U F;  4ECZ A;  5KFC A;  4ECR A;  4C5A A;  2W6N A;  2HVQ A;  5DLG A;  1K1S A;  4O3P A;  1S68 A;  3WO0 A;  5KFJ A;  2R7N A;  5BR8 H;  2YRW A;  3TII A;  2JA5 G;  3OSP A;  5LA6 F;  1GGO A;  1I3Q A;  3I12 A;  3G6V A;  1Z2N X;  5KG5 A;  3OHA A;  4ZI7 F;  2OH2 A;  4GKJ H;  5LXT F;  1T94 A;  4BY1 G;  2CW7 A;  5BPF A;  5C3E G;  5DLF A;  2IA6 A;  2C2E A;  2B63 A;  2R7Z A;  3JRX A;  4HYK A;  4A3D G;  1HNZ H;  4PQD A;  1AUV A;  2WE6 A;  5KFF A;  2VQF H;  3V6K A;  3GIP A;  4KHP H;  3E5N A;  2WDT A;  3PR5 B;  3Q1K A;  4IAJ A;  5KFM A;  3OHB A;  3PN1 A;  4DR3 H;  1M6V A;  1PK8 A;  4NLG A;  4DR2 H;  2R84 A;  2W6Q A;  5KFL A;  3C0F B;  5H80 A;  4O3R A;  4TUY F;  1WH2 A;  3MR3 A;  3SE7 A;  5KFD A;  3GLK A;  1WCM A;  2I87 A;  4UCS A;  5C1P A;  4L1K A;  2XCA A;  4MV9 A;  2R8H A;  2V58 A;  5L1J A;  3VPB A;  3WNZ A;  2WAQ E;  1RJR A;  3K3P A;  4Q45 A;  3KHH A;  4RUA A;  5JH7 F;  2W6O A;  1C30 A;  3BAB A;  2UVW A;  3R5X A;  3N8D A;  2YW2 A;  1V4Y A;  4MAM A;  4X65 H;  2ASL A;  4IZO A;  2FK3 A;  4DR1 H;  2XIG A;  4EFE A;  4RB3 C;  4A3F G;  4JYA H;  3VMM A;  2ZM6 H;  4NXN H;  2B63 G;  4X64 H;  4QWA A;  5L9X A;  3V6H A;  2R7Z G;  5KFO A;  4RUC A;  5F9N A;  3K5H A;  4I4T F;  4QWD A;  4ECW A;  2O03 A;  3BG5 A;  5BPH A;  2HVS A;  5KKN B;  5GON F;  4JI5 H;  3HKZ A;  4O4I F;  2BQU A;  1KJJ A;  5FD6 A;  3KHL A;  3KAJ A;  1S9F A;  1DGS A;  1N36 H;  2ATL A;  2FE3 A;  2R87 A;  1ZHQ A;  4IRD A;  4Q8F A;  2FPG B;  2IP4 A;  2YRX A;  4DR7 H;  1E4F T;  1R9T A;  2ASD A;  2GLT A;  4QIW A;  5D1P A;  4ECS A;  1WCM G;  1JXL A;  3GV8 B;  4BXX G;  1RJP A;  2JEI A;  5EWG A;  4ECT A;  1HNX H;  2VR1 A;  4Y8V B;  5HBR B;  3M9N B;  1E4E A;  5DQG A;  4A3K G;  4JI7 H;  2R7K A;  5DG7 A;  3FKI A;  4UCV A;  3HOU G;  1IOV A;  4DV0 H;  1UC9 A;  3BAA A;  2YS6 A;  5I47 A;  2XCP A;  2FJZ A;  1VBG A;  4RZQ A;  2DWC A;  5KG6 A;  3TQ1 A;  2QYZ A;  5KG2 A;  3HXL A;  4DR6 H;  5KT4 A;  5DGA A;  2VA3 A;  3RUP A;  5KG7 A;  4EGJ A;  4JI1 H;  4C5C A;  1JIH A;  3QZ8 A;  3H40 A;  1X9N A;  4EBC A;  5DGB A;  4ED6 A;  4DV3 H;  5EWF A;  4DL3 A;  2E5L H;  3RB3 A;  4MA0 A;  5CAE B;  4IRC A;  4MA5 A;  4I50 F;  2FB9 A;  5FLM G;  2E2I A;  3F8N A;  2GPS A;  3MR5 A;  5FLX W;  3SI8 A;  4QWB A;  3CVZ A;  2JA7 G;  3KHR A;  3Q8S B;  4FS2 A;  4J9K A;  3FMA A;  2FPP B;  3PR4 A;  4FU0 A;  4AYB E;  3FKI G;  1BXR A;  3K5I A;  2R82 A;  2XGP A;  2FK2 A;  4HR7 A;  3RGX A;  3G6Y A;  5KFQ A;  2YCH A;  1MZB A;  4RNM A;  2ASJ A;  5LP6 F;  3RGZ A;  4DR4 H;  5LOV F;  4E4T A;  5KX5 F;  4EG0 A;  4LF8 H;  3MR6 A;  2FLN A;  5IP7 G;  4B3S H;  3JSN A;  3MFH A;  2V59 A;  2ZDQ A;  2YZM A;  3UFX B;  3RIZ A;  5EDW A;  3T1H H;  3GV7 B;  4J9L A;  4EEY A;  3CQZ A;  4LF4 H;  2J9G A;  4DV1 H;  3L4J A;  4ED1 A;  4C5B A;  4A3C G;  5FPR A;  1M7J A;  1KJI A;  4LFA H;  2QK4 A;  1JKJ B;  5IYB G;  5EZY F;  4YQW A;  2FLP A;  4EYH B;  2Q2U A;  3M4I A;  3LP8 A;  3HOY G;  3MR2 A;  3T1Y H;  3H0G A;  4APM A;  4DV2 H;  3Q8Q B;  4DR5 H;  2VUM A;  5HV6 A;  1E4G T;  3N41 B;  1RYS A;  3OTO H;  4DL7 A;  2W8L A;  2RDJ A;  1IBM H;  4UCT A;  1CQJ B;  3RFC A;  3HBL A;  4B3M H;  4BWS C;  3H4D A;  2UU9 H;  5KG0 A;  4YAK B;  4YR3 A;  4MV8 A;  4TQS A;  3N42 B;  5A2Q W;  1RK5 A;  4IWX A;  2W9A A;  2V9W A;  1E4E B;  4YY3 H;  2WAQ A;  3T5L A;  4MV1 A;  2C2D A;  3M9M B;  4K0K H;  2C00 A;  4A3I G;  3LWB A;  2WTF A;  5KT5 A;  3T5J A;  1TWC A;  4RU9 A;  4JI3 H;  2F4V H;  2OLS A;  1VAJ A;  2DZD A;  1V9P A;  3RBE A;  2AU0 A;  2NU8 B;  3PO3 G;  1JDE A;  4TV8 F;  3MWE A;  1BGW A;  2DIK A;  2SCU B;  3TIG A;  4LSA A;  3KTM A;  2R7M A;  4MTE A;  1I7N A;  1I50 A;  2UXD H;  5IT9 W;  1C3O A;  5IP9 G;  2UUA H;  4A3B G;  1SEI A;  2BQ3 A; 
#chains in the Genus database with same CATH homology
 4JFN A;  3KTM A;  1OWT A;  2M05 A;  2FJZ A;  2FMA A;  2FK1 A;  4PQD A;  2FK3 A;  2FKL A;  1MWP A;  2FK2 A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...