The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
121
|
sequence length |
435
|
structure length |
430
|
Chain Sequence |
EQAGTATAENHPPLTWQECTAPGSCTTQNGAVVLDANWRWVHDVNGYTNCYTGNTWDPTYCPDDETCAQNCALDGADYEGTYGVTSSGSSLKLNFVTGSNVGSRLYLLQDDSTYQIFKLLNREFSFDVDVSNLPCGLNGALYFVAMDADGGVSKYPNNKAGAKYGTGYCDSQCPRDLKFIDGEANVEGWQPSTGIGDHGSCCAEMDVWEANSISNAVTPHPCDTPGQTMCSGDDCGGTYSNDRYAGTCDPDGCDFNPYRMGNTSFYGPGKIIDTTKPFTVVTQFLTDDGTDTGTLSEIKRFYIQNSNVIPQPNSDISGVTGNSITTEFCTAQKQAFGDTDDFSQHGGLAKMGAAMQQGMVLVMSLWDDYAAQMLWLDSDYPTDADPTTPGIARGTCPTDSGVPSDVESQSPNSYVTYSNIKFGPINSTFT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
cellobiohydrolase I catalytic domain
|
publication title |
Three-dimensional structure of a thermostable native cellobiohydrolase, CBH IB, and molecular characterization of the cel7 gene from the filamentous fungus, Talaromyces emersonii
pubmed doi rcsb |
total genus |
121
|
structure length |
430
|
sequence length |
435
|
ec nomenclature |
ec
3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end). |
pdb deposition date | 2003-08-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00840 | Glyco_hydro_7 | Glycosyl hydrolase family 7 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Distorted Sandwich | 1,4-Beta-D-Glucan Cellobiohydrolase I; Chain A | Glycoside hydrolase, family 7, domain |
#chains in the Genus database with same CATH superfamily 2A39 A; 3CEL A; 1EG1 A; 4D5I A; 4D5Q A; 4ZZV A; 4CSI A; 3PFJ A; 4XNN A; 4ZZU A; 1A39 A; 4ZZT A; 1OJJ A; 4GWA A; 4P1H A; 2CEL A; 1Q9H A; 4V20 A; 4ZZP A; 4IPM A; 4P1J A; 5CEL A; 2RFW A; 2XSP A; 1Z3W A; 1OVW A; 1OJI A; 4XEB A; 1DYM A; 1Q2E A; 2Y9N A; 2V3R A; 1CEL A; 4D5O A; 6CEL A; 4OVW A; 1H46 X; 2YOK A; 4C4C A; 3PFX A; 2RFY A; 4V0Z A; 4V1Z A; 2RG0 A; 4D5V A; 3PFZ A; 1DY4 A; 1Q2B A; 2YG1 A; 3PL3 A; 4HAQ A; 1Z3V A; 4UWT A; 1GPI A; 1EGN A; 1Z3T A; 4D5P A; 2OVW A; 2V3I A; 1OJK A; 4C4D A; 4D5J A; 4ZZQ A; 4CEL A; 4HAP A; 7CEL A; 5AMP A; 4ZZW A; 3OVW A; 2RFZ A; #chains in the Genus database with same CATH topology 2A39 A; 3CEL A; 1EG1 A; 4D5I A; 4D5Q A; 4ZZV A; 4CSI A; 3PFJ A; 4XNN A; 4ZZU A; 1A39 A; 4ZZT A; 1OJJ A; 4GWA A; 4P1H A; 2CEL A; 1Q9H A; 4V20 A; 4ZZP A; 4IPM A; 4P1J A; 5CEL A; 2RFW A; 2XSP A; 1Z3W A; 1OVW A; 1OJI A; 4XEB A; 1DYM A; 1Q2E A; 2Y9N A; 2V3R A; 1CEL A; 4D5O A; 6CEL A; 4OVW A; 1H46 X; 2YOK A; 4C4C A; 3PFX A; 2RFY A; 4V0Z A; 4V1Z A; 2RG0 A; 4D5V A; 3PFZ A; 1DY4 A; 1Q2B A; 2YG1 A; 3PL3 A; 4HAQ A; 1Z3V A; 4UWT A; 1GPI A; 1EGN A; 1Z3T A; 4D5P A; 2OVW A; 2V3I A; 1OJK A; 4C4D A; 4D5J A; 4ZZQ A; 4CEL A; 4HAP A; 7CEL A; 5AMP A; 4ZZW A; 3OVW A; 2RFZ A; #chains in the Genus database with same CATH homology 2A39 A; 3CEL A; 1EG1 A; 4D5I A; 4D5Q A; 4ZZV A; 4CSI A; 3PFJ A; 4XNN A; 4ZZU A; 1A39 A; 4ZZT A; 1OJJ A; 4GWA A; 4P1H A; 2CEL A; 1Q9H A; 4V20 A; 4ZZP A; 4IPM A; 4P1J A; 5CEL A; 2RFW A; 2XSP A; 1Z3W A; 1OVW A; 1OJI A; 4XEB A; 1DYM A; 1Q2E A; 2Y9N A; 2V3R A; 1CEL A; 4D5O A; 6CEL A; 4OVW A; 1H46 X; 2YOK A; 4C4C A; 3PFX A; 2RFY A; 4V0Z A; 4V1Z A; 2RG0 A; 4D5V A; 3PFZ A; 1DY4 A; 1Q2B A; 2YG1 A; 3PL3 A; 4HAQ A; 1Z3V A; 4UWT A; 1GPI A; 1EGN A; 1Z3T A; 4D5P A; 2OVW A; 2V3I A; 1OJK A; 4C4D A; 4D5J A; 4ZZQ A; 4CEL A; 4HAP A; 7CEL A; 5AMP A; 4ZZW A; 3OVW A; 2RFZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...