1GH9A

Solution structure of a 8.3 kda protein (gene mth1184) from methanobacterium thermoautotrophicum
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
b'MYIIFRCDCGRALYSREGAKTRKCVCGRTVNVKDRRIFGRADDFEEASELVRKLQEEKYGSCHFTNPSKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8.3 KDA PROTEIN (GENE MTH1184)
publication title Structural proteomics of an archaeon.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09082 DUF1922 Domain of unknown function (DUF1922)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 1gh9A00
4GR4A 2MYYA 2GPFA 2PSTX 2KHRA 5JA1B 1GH9A 4GR5A
chains in the Genus database with same CATH superfamily
4GR4A 2MYYA 2JNEA 2GPFA 2JRPA 2KHRA 2PSTX 5JA1B 1GH9A 4GR5A
chains in the Genus database with same CATH topology
4GR4A 2MYYA 2GPFA 2PSTX 2KHRA 5JA1B 1GH9A 4GR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR4 A;  2MYY A;  2GPF A;  2PST X;  2KHR A;  5JA1 B;  1GH9 A;  4GR5 A; 
#chains in the Genus database with same CATH topology
 4GR4 A;  2MYY A;  2JNE A;  2GPF A;  2JRP A;  2KHR A;  2PST X;  5JA1 B;  1GH9 A;  4GR5 A; 
#chains in the Genus database with same CATH homology
 4GR4 A;  2MYY A;  2GPF A;  2PST X;  2KHR A;  5JA1 B;  1GH9 A;  4GR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...