4GR5A

Crystal structure of slgn1deltaasub in complex with ampcpp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
463
structure length
451
Chain Sequence
b'SNPFEEYDGGHVVLTDALGRHSLWPAGIAVPAGWSVRHGTDSREGCLAHIEHHWTDLRPTRAPAGACVHELFEAQAARAPDAVALLHEADELTYGALNERANRLAHRLVGLGVAPGTLVGVHLERGFDMVVALLAVLKAGGGYTMLDPQFPVERLALSLEDTGAPLLVTSRPLSGRLTGTTTLYVEDAGNLATGVGPEDVACVMFTSGSTGRPKGVMSPHRALTGTYLGQDYAGFGPDEVFLQCSPVSWDAFGLELFGALLFGARCVLQSGQNPDPLEIGELVARHGVTMLQLSASLFNFLVDEVPEAFEGVRYAITGGEPASVPHVAKARRDHPALRLGNGYGPAESMGFTTHHAVVAGDLSGTALPIGVPLAGKRAYVLDDDLKPAANGALGELYVAGAGLAHGYVSRPALTAERFVADPFAGPGGERMYRTGDLARRRADGVLEYVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-ribosomal peptide synthetase
molecule tags Ligase
source organism Streptomyces lydicus
publication title Structural Basis of the Interaction of MbtH-like Proteins, Putative Regulators of Nonribosomal Peptide Biosynthesis, with Adenylating Enzymes.
pubmed doi rcsb
total genus 145
structure length 451
sequence length 463
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF03621 MbtH MbtH-like protein
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gr5A02
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 4gr5A01
5BSRA 4GS5A 3E7XA 4D4GA 4FUQA 3L8CA 4FUTA 2PSTX 2VZEA 3TSYA 3T5CA 3U16A 4E5DA 3RG2A 4RVNA 4W8OA 3C5EA 5KEIA 4ISBA 1V26A 5BSUA 4PZPA 2Y27A 3GPCA 4GR5A 4R1MA 5BSMA 3WV5A 3IVRA 3DHVA 3ITEA 4GXRA 3IERA 4IZ6A 3VNRA 3R44A 4DG8A 3B7WA 4DG9A 3U17A 5GTDA 4LGCA 4OXIA 3DAYA 3NYQA 3NI2A 3LGXA 5D6NA 2GPFA 4IR7A 3A9VA 3IPLA 3IESA 3VNSA 1V25A 3EQ6A 3T5BA 3IEPA 1ULTA 3FCEA 4D57A 2WD9A 3E7WA 3O84A 5BURA 5JA1B 2MYYA 3E53A 2Y4NA 2Y4OA 5BUSA 4R1LA 5BSTA 5E7QA 3FCCA 4R0MA 3T5AA 4G37A 3WV4A 4D4HA 4D4IA 2V7BA 2KHRA 4D56A 3PBKA 4GXQA 4RVOA 5DWVA 3NYRA 3QYAA 5BUQA 3O83A 3VNQA 5BSVA 3ETCA 3RIXA 4M46A 4GR4A 3G7SA 1GH9A 5BSWA 4WV3A 3WVNA 3O82A
chains in the Genus database with same CATH superfamily
5JC1A 3BZUA 3U7QB 1C14A 3W2TA 1A3CA 1SG9A 1H5UA 2C5BA 2VPTA 2F9FA 3NGMA 2NUTA 1EP3B 5CLFA 1NQOA 4BCDA 4OLJA 1EX6A 2V6MA 2FSVA 2PZKA 2OFWA 2XMZA 3VYRB 4WDQA 1JHMA 2FHSA 2QYSA 2VJBA 1TTHA 4QBKA 2BH2A 5DBEX 3GLGA 1KI9A 3AV3A 3PEFA 3PYXA 1VL2A 1Z45A 2DR3A 1XROA 4PR3A 4D44A 4RUKA 5DULA 4QEZA 1RAGA 1KKLA 1CYDA 3LUHA 2V7PA 2WHQA 3EXEB 4PHFA 3OZUA 4Q05A 4YAUA 5AW1A 4TM8A 5AH0A 1CRQA 2QTCA 2ZT6A 1M0SA 4JLUA 3TIFA 5B7QA 3FBWA 3DOJA 3IP3A 3RQIA 1D7OA 4WGFA 5SYAA 1XZBA 4MVJG 1CULC 2ZUCA 5ALLA 1LRKA 2R8EA 2C94A 4LDNA 3TZLA 2QA5A 3ZWPA 1PVDA 3WA6A 4Y2HA 3MBOA 1JTFA 1EE2A 1U3WA 1YB4A 2ZOSA 1CUUA 1M54A 2XLBA 3GAZA 3ITEA 1IIBA 3P2EA 3TMYA 1C30B 1PQ4A 1ULUA 1PNTA 4DB4A 1JDTA 1VGVA 5AVOA 3WDMA 1YRWA 2GYVA 1DT3A 4WNAA 3PF9A 4R4JA 2H9YA 3ZTYA 3GGOA 4G09A 2M1XA 4LGCA 4EI2A 1YMVA 4PHHA 2D5IA 1WD5A 4CT5A 3EZNA 4KN9S 1BFKA 2QN6A 2D4HA 2X7HA 4CQNA 3WQBA 1JG7A 1OGYA 3R6LA 1ZH8A 2A5YB 1G41A 4B6EA 1KYIA 1W581 4CMBA 2FRVA 1HQCA 3CLSC 4Z4HA 2W0SA 1REQA 1L8LA 1XMVA 4EUSA 1AKWA 1JHRA 1GUZA 3M6FA 4MICA 4QJIA 1KE2A 1UBNA 2FEAA 2OBNA 1EM6A 1IHPA 2IUYA 3W5HA 1QVRA 3AU9A 3TNDA 5E6SB 1Z7YA 5IFKA 4HEJA 5KTKA 5K3CA 2X1MA 4P3YA 2B6NA 2CNWD 4QD3A 3H9UA 1HORA 4Q4AA 2IYUA 4G36A 2H17A 4ECAA 3MXOA 1NKVA 3U13A 1BX3A 2J7PD 4HMPA 2VOEA 2AS0A 4WZZA 3WGVA 3DVLA 4DRZA 4JI2B 2MSKA 1XA4A 1QFYA 3K20A 1NN1A 4NEQA 5AJYA 1NXWA 1Z2DA 1Z39A 3LSTA 2HNKA 2JIOA 3MCWA 4HYQA 4LG1A 1QTIA 3BXHA 3KKMA 2PUFA 2WQ6A 1EQUA 4MKGA 1YBHA 1RQRA 2G9UA 3CVVA 2HFKA 4TX1A 5CG2A 3GVXA 5FPQA 2R8BA 1ZVMA 1E2PA 4P0TA 5A0VA 2FSSA 3AZQA 1IHDA 4XWGA 2VSNA 1UT5A 2NTVA 2AIRA 5D1HA 4BN4A 3ZS8A 2A2ZA 1E2HA 1TLFA 1ZM3A 1FL9A 5ALFA 3GARA 2BKEA 1PU2A 4KLCA 2WU4A 2X23A 1MNAA 1SQ0A 2FDXA 2GM3A 2VDOB 3I58A 2X9VA 3TLMA 4X1IA 5F5NA 1T9AA 5CH8A 4CR8A 5EINA 5A2GA 3T12A 1OPXA 4RU1A 1GP2A 3O75A 2VAXA 1E9VA 1QCCA 5J58A 2OAEA 4MUYA 3WK8A 2O8DA 2LGJA 4GAEA 4UBOA 1ATIA 2R1UA 2G4VA 2W2NA 3EGCA 1ZMTA 1JDBB 2EQ5A 3BE8A 3HCRA 5KTNA 1GPUA 5L95A 2BELA 3LLMA 4U3JA 2EJVA 5EIBC 5BSKA 1O4VA 3ER8A 1J2TA 1E2EA 3L7NA 4ESVA 4O4HF 5DYGA 2R2GA 4J03A 4U2DA 4XZ3A 5DLDA 5H3CA 5DLPA 1NL3A 2VTKA 2YXPX 4DZTA 2E6KA 2GPTA 3JZIA 2VZEA 2ZJZA 4PC7A 3U7RA 4Z3DA 1YKFA 1YF3A 1F8UA 5EXPA 3UQZA 1GDTA 1WP9A 1N92A 3NEYA 3NNNA 1PRYA 5IWAB 5C5DA 1GQRA 4NYMQ 4P7BA 3D7KA 1HTTA 3BQNB 3BICA 4JVNA 1BO6A 1QKKA 5ITZB 3B60A 1NW5A 3H6KA 2B7CA 1T8SA 3IMKA 2SCUA 5CXUA 1RYZA 2VKTA 1JU4A 1WX1A 3CW9A 3K92A 2J4CA 4Q4JA 3HWRA 4ED9A 1P7VA 1BXGB 2I3AA 1SUWA 4K6FA 4ZVNA 4KLAA 1C3OB 1QRAA 2D0DA 1GKKA 4YRCA 1VBKA 4Z1OA 3OQOA 1DFGA 3O7WA 5EI5A 1T5HX 4HWOA 4XVHA 4ZDWA 2HLDA 4CQMA 4XPIB 4LTMA 3FB4A 1G19A 1ZJ5A 5CDFE 4ZCPA 2IW1A 1L1RA 5BSHA 1DX9A 2RC6A 4QUEA 2SBTA 3A1SA 3DV0A 1IL0A 1UXJA 4CIXA 1PT9A 2FVXA 3ND6A 4JH0A 2OVFA 1GNSA 1SC4A 4XTRA 4A16A 1LPMA 4JS0A 4UOZA 1T6ZA 4LI3X 1Z4JA 4MQUA 2AZXA 1NJ5A 3ND9A 4XUCA 3RC3A 5J23A 2GILA 2CFOA 2JIRA 2Q4BA 2RBKA 2VAPA 3UMYA 1H66A 2JFFA 4IKEA 3FVTA 1T1JA 1UFKA 3ZR4B 5CTJA 1T91A 3M6LA 4CYMA 4EHJA 3PTAA 5BQOA 2HMUA 2PGNA 1D9XA 1HQDA 1UM9A 2W9XA 3KOYA 3MGCA 3SQNA 3MWEA 4J3NA 1WPGA 2EV9A 3FPFA 2FZWA 4RBNA 4R7TA 4B85A 4CR7A 1YULA 3R5HA 5G2OA 4EB0A 5A4KA 4Q7LA 1UZLA 4B8YA 1AK1A 2IY8A 3MIIA 3GUZA 1GKUB 4HDSA 4WN3A 3AZOA 1ODJA 1Z2AA 1YJXA 3B9BA 3GFSA 2Y4OA 3TM4A 1P6QA 5IKPA 4K7JA 3ZJUA 3K9QO 4ATNA 4F1JA 2WFLB 2V0GA 2HX1A 1JAHA 2GUGA 3I9V1 2G1UA 3D6FA 4OSEA 5EJFA 5JHGB 4EGCB 1RJ9A 1HE2A 1GSIA 2HBRA 1Y1KE 4FLEA 4R68A 1XDGA 4XARA 4XQCA 2OXIA 4YDHB 2HM7A 1WXEA 1L5VA 1S01A 3VC7A 4ZEMA 4WOBA 3ZHVA 4E94A 3CIOA 3UK6A 1Y0BA 2QQGA 3A1NA 3CKYA 1SULA 2WC1A 1RABA 1F6DA 4GPD1 5KQRA 1G1AA 4N0QA 3JALA 3THWA 4ZVQA 1CVLA 3HP7A 2OZPA 3OZAA 4RH1A 5T6BA 3KLBA 3CF6R 1J0EA 1E79A 2O4CA 3VH1A 1N2HA 1YGYA 2XX3A 4QIHA 4GUDA 5JQGF 3MJHA 5BNWA 1T4BA 1PLKA 3W5CA 3AF6A 1W93A 4JHLA 5ARCA 3VQTA 2WKRA 1BWPA 5HBRA 5BOVA 5ALSA 4EBBA 5KKCA 3DJFA 1XWFA 4ZO7A 1NOIA 3OPQA 3RFTA 4M0MA 3DULA 1WHSA 4YO7A 1P7ZA 1Z8FA 4ZC8A 5CDHA 4R69A 5I48A 2O2HA 5DSXA 5E9WA 4BKOA 5JS7A 1QB8A 4F4FA 1FQWA 3G2HA 5HA5A 2P6OA 3KYDB 5KIAA 1SH7A 1Y42X 3ELWA 1GPLA 1YQDA 1IQPA 3HI6A 3TIIA 4YR7A 5CDSA 1YCHA 1N6OA 1FOEB 3UICA 1QF6A 4WLOA 4A91A 4YHHB 3B5JA 4WEOA 3FPEA 4B3TB 1S96A 2ZU6A 2J3DA 1ZVVA 4QTYA 3KOOA 4QOEA 5K0BA 1U8EA 2JARA 4H0FA 4I55A 3F5DA 2XKJE 2NU9B 4E07A 2QLMA 3AQIA 3Q9SA 5ERXA 4ZKEA 4XJTA 3GEPA 3OX4A 3QNWA 4WKPA 3RH0A 1JLSA 4HH0A 2IVZA 3DBLB 3QUBA 3H19A 2JFBA 2ALJA 4M1WA 1R0ZA 4DNPA 2OHJA 4E4TA 1P0FA 3WS7A 3I2JA 3OPYI 2PFSA 3SIXA 5J2UA 1ECPA 4IXDA 3EFOA 4HCJA 4WXMA 1UIMA 2VPYA 3T0FA 1FFDA 4RTKA 3DBOB 1E69A 4KR7A 3LJKA 1RRKA 1P7PA 3KK0A 1HKHA 1O8CA 1JEQB 2FUG1 4BIMA 1BCRA 2H54A 4RTLA 4RV4A 1W0KA 1Z7GA 1Y3BE 1UKVY 1CIVA 1GTMA 2Z3WA 5AKHA 4BLUA 3USZA 1MOQA 2RBEA 4TN1A 3IVAA 4HJXA 1A9YA 2BFCA 1H6BA 1BE1A 1UDRA 2MHCA 4FFBB 4IL5A 3C41J 1QHEA 1HE8B 1VJCA 2PUJA 2J8ZA 4D81A 4YRMA 1M6YA 4AUMA 2D3WA 1KJ9A 2PFKA 1IQ0A 3GMDA 1UMBB 3JVUA 1L1FA 1OLSB 4RDCA 1HO3A 1P4JA 2H4ZA 3B1FA 2QAIA 3G9TA 2JGAA 2WKPA 3T3PB 1V8BA 3TD9A 3TTYA 4L9RA 3U4QA 3N0XA 2HO5A 2QEQA 2FF5A 3G7UA 2VPZA 1MOPA 1K5PA 2UUBB 521PA 5DM70 2Z4RA 1JQ5A 2WJVA 1E0SA 1JFTA 2YZMA 1JE1A 2PWZA 4OX9B 1YS6A 4TS9A 4W9NA 3UFBA 2RGBA 4L9WA 4P3KA 2I9PA 3WLOA 4UZFA 3P9KA 1XDZA 2VZ9A 3H97A 3LW7A 1ODFA 4G0OA 2WY2D 1BMTA 5BYAA 2IX3A 2C3MA 5JNVA 1E5TA 5K8JB 4BTVA 1BRTA 1I51A 3D3WB 2FXVA 2ZIZA 4FZRA 1R0XA 2HBZA 4PQEA 3DXZA 2Z2KA 4IVPA 4RPCA 2ONKA 2J85A 1MA0A 4G4GA 1AKEA 3VC1A 3PVZA 2QUBA 2IRWA 2REQB 1Y3IA 3QA3E 3KUXA 3OOJA 1LA2A 4RVOA 3A6JA 1FDOA 4JLAA 1OPRA 1QYIA 2J5QA 3GYGA 4NLLA 4LHXA 1GL7A 3OJLA 4GUAA 7AT1A 4GSLA 1I1NA 3E23A 4HDOB 3COPA 1KWKA 4B3SB 1GRVA 2GLXA 3QWIA 4ZTBA 1H6CA 2WJAA 4DEYA 1ZXXA 2ID4A 5CDGA 4Q15A 1N7GA 2BFBB 2FPIA 2XVZA 3I2IA 2I54A 3JPWA 4LYDA 2QL5A 4S2EA 1C8KA 2OBBA 4G1FA 4NCKA 2RHWA 4DWOA 3VA7A 5JBNA 5IZCA 2UYCA 1SNYA 4INPA 2WFLA 3HEBA 1MFPA 4O25A 4X93A 5K0LA 3L8GA 4QARA 4B81A 1BA3A 3ABIA 2QI9F 4F7DA 4NH0A 3FDZA 5JZSA 1RJ9B 1U0JA 2PXHA 3AJ8A 1AQUA 4BNUA 4TTPA 1DBVO 1JXOA 4B40A 1L5RA 2BFFA 1MLDA 3NALA 4HZUA 4QUDA 4YRTA 5AK6A 3V42A 1XXHB 4RW0A 2G8NA 3T5CA 5JDIA 5IK2A 3HRIA 4TTIA 3C4JA 2PZBA 1ZIYA 2JCSA 4GX5A 4KDCA 1GG5A 1NT2A 1P2DA 4W5JA 3HYCA 5YASA 3UT0A 2X3FA 3H2BA 1ST3A 1MJ5A 5K51A 2HA5A 2HA7A 2A3NA 3HEAA 1Z5NA 4OM7A 3T9AA 3HJFA 3GPDG 1WA5A 3HBMA 1NQWA 3BX1A 2VHTA 1ZLYA 2MCFA 1HT2E 3FUVA 5HTKA 3CRRA 2WJWA 4EGQA 2VA8A 4D0NA 3MILA 4FCCA 3OCJA 4K9SA 4QFCA 1ZJ4A 2P41A 1UT6A 3BXZA 5AKYA 2H0QA 5U4QA 1XTZA 4XVUA 2PUAA 3DEJA 4AWAA 3P45A 4JP5A 3ORHA 2C4MA 5MN5A 2IHZA 2JAOA 1MJHA 4BX2A 2ZT5A 3O26A 5D86A 2NP7A 1AKVA 4RQTA 2INGX 3ZDBA 3A8TA 2Y1FA 4FFPA 3WYNA 2FX2A 4RPKA 3GLIA 1T3ZA 4AF7A 3BDVA 2YJ6A 3PICA 2QZZA 4WXRA 5DO9A 5EZYB 4IUYA 3QLTA 1DBQA 3KE8A 4FYPA 2XGSA 2J6BA 1A2QA 3MQ2A 1DWOA 3BH0A 1AF4A 3NHZA 2VNHA 5EP1A 3U4HA 4LF6B 2I2XB 1G9SA 2B1JA 4YRZA 5LFAA 3RGWS 2F3TA 2JF0A 4Y2RA 1FFXB 3STUA 3BGVA 4NXNB 2CFTA 4UTNA 3QELA 4BUCA 3TTSA 5I9LA 4RKFA 1JXMA 1ZVJA 2JLSA 4WUTA 4YJ2F 2NVUB 1J0BA 2JAQA 2GRUA 5CXSA 2WQ7A 1KMMA 3KXDA 2PD6A 2WSSD 3EUWA 4LZNA 2ZB8A 3CHYA 4NBTA 3IMGA 4Z54A 4NFSA 2OLJA 3SHQA 3HKBB 2H5IA 2I1LA 1GHTA 4FM9A 2P0YA 1FQOA 3UMSA 4EHIA 1T0IA 3PT9A 4XSHA 3W8EA 4MIYA 4HQNA 1SQSA 1U8AA 3IKLA 4XWWA 3IA2A 4CETA 2Z6AA 2RKOA 3AFHA 2Q99A 3VJKA 4RSHA 4YCSA 2JD2A 5A04A 2NXCA 4KU4A 2OBXA 4EVRA 1L5QA 4KR9A 1KMHA 1DV2A 4EW6A 2AOTA 1FSFA 3G5MA 4IMJB 4KNYA 1BE8A 4FU0A 3CR3C 3ESBA 4WNIA 4HP8A 4HXYA 1Z15A 4Y9TA 3WKBA 3BWEA 4CEHB 1VSBA 3B70A 2IYLD 1DIAA 1KO5A 2FW1A 4M54A 5ENZA 1C9JA 2Z2JA 5CB8A 2UYHA 1QE3A 3UGTA 1MV8A 5B4VA 3ZHQA 3UJ3X 5CG1A 1NWHA 4M0FA 2WI8A 1DAGA 2R47A 1KY2A 3EQZA 1K8QA 4LCEA 4LJAA 3E7XA 3JZDA 2Q2OA 3VSBA 5JLJA 1B6RA 2AE1A 3LMKA 4L8LA 3KJIA 4I99A 2LCIA 2A9QA 3FTNA 1O57A 1S0UA 2FSUA 3LKBA 2ZSEA 4XDZA 5KTMA 5FR1A 3UJ7A 1RQPA 2Y0PA 2VF8A 2ZRFA 4LMRA 3C5VA 2HYIC 1J21A 2P9BA 3G0OA 2C0QA 2M9MA 2NYRA 2X5KO 4C4XA 4Z4FA 2UXBB 4BRWA 2EBFX 5E38A 1OOEA 4RETA 2IYQA 1R6TA 1P7YA 4ZN6A 2AJ8A 1F0KA 2QG6A 3HZRA 3ZH9B 1M1ZA 2IYNA 1A9ZA 4GSKA 1T5IA 2AT1A 3MJEA 3OFNA 3JY6A 4FZ5A 5JIBA 1IN4A 4UE6A 3QY0A 3DOUA 1EUCB 2V0CA 3FDXA 4V0OA 2CLSA 1UQTA 2QK4A 4G24A 1HEYA 1W5EA 2ZSJA 1T6XA 3MGGA 3FYDA 3VU3A 4EA9A 1YAJA 5LP6C 3L7AA 3E7DA 1VL8A 4OA8A 2XCTB 4YH1A 4L76A 1ORHA 1QNFA 2W58A 4KQKA 1J8QA 1W4CA 3GMSA 4AG6A 5JXWA 1C0PA 1W5FA 1JHUA 1N6HA 1SOAA 2Q49A 1YFKA 3FUTA 4OM8A 4MPDA 4JA2A 1Q1GA 3LOPA 5IJ0B 1RJFA 4RKQA 1H93A 1U0LA 4ZD6A 5LQMA 3KHTA 1KVUA 4HY3A 4M7RA 4OGWA 4R7ZA 1VBNA 3VPCA 1U4NA 5EXXA 3ZY5A 4AS3A 1G2QA 2EQBA 2N0SA 3VYVA 3UMVA 2IYAA 2RONA 4P6VF 5AM3A 4GQIA 2C7QA 2QTWB 1JPUA 4X85A 4GFDA 4WXHA 4PW0A 1HF3A 3KQLA 2B2NA 4RHUA 2P1ZA 2XB2A 4TXHA 3R9KA 4BVAA 3LUPA 5G0VA 4CW7A 2CN1A 5IBRA 4O0MA 4PGHA 4R71A 2GKGA 1E2GA 3NW9A 4UZSA 1JBKA 1OAOC 3B1WA 3TRFA 1U9YA 1OFHA 3HABA 3KJGA 2C2YA 3M9LA 4FFLA 4CG1A 2GXUA 5LC1A 1PR4A 4C20A 4MCAA 4HNVA 2PZLA 4X8MA 2XWQA 4MKZA 5J4HA 4GE0A 2QM3A 1II8B 3UZUA 3HU5A 1KH2A 1YCDA 3UG6A 4IGFA 4CTMA 2QX8A 5JAPA 1E2IA 2GPBA 1IBLB 1EA7A 4OQQA 4RK5A 4CMEA 1VRVA 4Q7QA 1WMEA 3P4XA 5TQJA 5BMVB 2ZLBA 3A3OA 2VBFA 3FZGA 1XHLA 2ZWOA 1Z75A 3A4YA 5CVCA 5B6IA 4RX1A 3U56A 3RF6A 3RYHB 3PR2B 1Y8RA 2OCYC 4PCVA 3NJ8A 2EOAA 5TARA 5I5GA 3QWAA 4CKEB 2NO6A 2FUNB 4ND3A 2GAIA 3PQDA 3AEQA 5FA8A 2RHTA 3QELB 5KOJA 4OK5A 1D04A 3T7RA 3RS5A 1J9EA 1G4HA 2E55A 3KELA 5L9AA 2HO4A 2WF8A 3R9WA 2JANA 4G26A 2HXYA 1M1YE 2W6ID 4KH1A 3H5VA 5LNK6 5U9CA 5IASA 3COJA 2FXIA 3ZWNA 2ZK7A 2DWOA 3UKJA 1D5CA 4ZCRA 1VG0B 2ZE6A 3K5WA 3W5VA 1F6WA 1T2UA 1QYRA 2DPGA 3EISA 1ZN9A 1CFJA 4MQFA 3CLUC 4WK2B 3WAGA 2OXCA 4EVSA 5JQGB 2O3UA 1VRCA 4IDBA 1KMNA 1Y3CE 1DV1A 3DTYA 5LPNA 3NO4A 4BMVA 5IVHA 2I9KA 1Z2PX 5G0UA 1MT0A 1KZ4A 1UBFA 3SCZA 2Y99A 5HKBA 1MXHA 1QXSA 2BGTA 4LKOA 1LFAA 4RGQA 3V7NA 3ZCSA 4CLXA 2Z9DA 5AQ1A 4MKFA 4ZRNA 3DHVA 2WG2A 4CCWA 4HB2A 4RY9A 3FNIA 4FCTA 4DC0A 5JJLA 1IOLA 4IZ6A 3EVAA 4IIDA 1V4NA 4FYXA 4PX5A 1XVLA 3O9MA 1A5AB 4YFYA 5TX7A 4DPMA 3FIUA 4IIFA 2I33A 2CMFA 3J7AC 1MF7A 1C9EA 3IQXA 5KWJA 2QTLA 1G9XA 3TR5A 3IT1A 1LTQA 4OG2A 1NXVA 5BV2P 1FTQA 1NAHA 1GJRA 4ZOAA 5B3AA 2OCLA 1L4KA 3F6CA 3TYXA 4AYTA 4YRDA 2Y0DA 1EVLA 1QIIA 1K6XA 1NRWA 3MUNA 2Y0BA 1OXXK 1UMKA 2QAJA 3GRRA 2O5VA 3IR5A 5AW5A 1EDOA 4BXOB 2JI8A 5LN1A 5KTTA 2ACEA 3QXSA 1KGSA 4EG1A 3H7IA 5DIFA 2W2KA 3HU2A 1V3QE 1QZZA 2AJBA 5EOVA 3QX8A 4ZDJA 5IJ9B 5AM0A 3EIFA 4RMJA 4ARZA 2D2FA 1UH5A 2Q6KA 3ESYA 2QRLA 3WP0A 3TXYA 4IGKA 3RE1A 5DGXA 5ALVA 1CUCA 4D80A 3SY8A 1KFBB 5GONF 1A5ZA 1BGWA 1F2VA 3AONB 4CJXA 5ECYA 1OBVA 3LOUA 3RASA 3WKDA 2XQGA 4TRMA 1Z0UA 2R8ZA 1M34B 4ARSA 3CNBA 3SC2A 3S68A 2HV8A 1SKBA 5A6SB 2OGUA 4MPPA 3UANA 5K0FA 3HNPA 2RI0A 4HH4A 4UM7A 3MTDA 1L4EA 1VIDA 4GYYA 1HNNA 2CLOB 5AK0A 4LNHA 3G8YA 4JGBA 4MWOA 3Q7PA 1EAMA 3HJUA 3N39C 3PL1A 3QX3A 1R10A 4IIUA 4JI7B 1RYHA 1OTYA 3V1NA 4UNQA 1WUYA 5KOYA 1W29A 4B5LA 4Z3OA 1C50A 4J9VA 1NUUA 1H3FA 5KPDA 3IP5A 3AEUA 3QKSA 1W30A 2A9JA 1JNXX 2WJ4A 4HATA 4MVJE 2QD1A 1MJFA 3CVUA 4M1KA 4BO1A 3CCFA 4QTZA 3BMNB 1XYGA 5A3SA 3K94A 3NTXA 5IDYA 3HU1A 4CL8A 3KZXA 2XBLA 3AR5A 3P4YA 1GSHA 2PS9A 2CLIB 2XCIA 3HDGA 4GRAA 2W2TA 4GWLA 5HPYB 1IXZA 3OOWA 3CRNA 5HJEA 1YZKA 2FR8A 3X3HA 3ANTA 4O6VA 2Q4RA 3FSRA 3VU9B 5EZ5A 1JMYA 1I3NA 2HTFA 3WLSA 2GK4A 3X1XA 1B41A 1XEWX 1PR6A 2OTCA 2ZBFA 3MCVA 3FOAA 2J9ZB 1HLGA 1ZUWA 3CEMA 4M7WA 3NEPX 1P2FA 3EVZA 5KC8A 1JEYA 2WYIA 2ZCJA 1HQKA 1LX6A 1TMKA 2Y93A 1PK7A 1U1CA 1VIYA 3K1JA 1O6FA 4NNOA 2P2SA 1NVKA 4QLBA 2ZVJA 4MV4A 4P2BA 3SS7X 2IWRA 1AE1A 1RC0A 3Q0TA 4ZT6A 1B42A 4OFZA 5FL3A 3CLVA 2DFVA 2PGOA 1O94A 1VG9B 4J0QA 1OYWA 1D4FA 1B3BA 3SVLA 2G71A 2X6RA 4TSFA 3N0VA 5HM6A 2B61A 1A04A 2N1BA 3NOQA 3I53A 1OTXA 6YASA 3AF3A 1CNMA 4P35A 2HK8A 2JIMA 3JAKB 5EEHA 3AR2A 2WZQA 3N6XA 1F8FA 1R6BX 4BV2A 2A7XA 5L3VA 1T0BA 3SQOA 1EXNA 4R2WA 3GRZA 4GKKB 5JAHA 3ADBA 4I1VA 3I61A 1P29A 3TSCA 2GEUA 1IZ7A 5DEOA 1AZTA 3B9PA 3AUXA 3RCBA 5LIPA 1Q83A 1IAQA 2XNSA 3CRZA 1JSZA 1QZTA 1R64A 4GE3A 4OHUA 5ALYA 4JQYA 4YQFA 2Q6VA 4NZ9A 3SFTA 1V7CA 2AVNA 2K4MA 3FPLA 3SQLA 4NPAA 2YWCA 3Q85A 4GKBA 5IDVA 1IXKA 4CDGA 1GAXA 4O4HB 3HNOA 1LLDA 4EFMA 4UHDA 1GG9A 5E1DA 3M6MD 2OCAA 3Q3GE 1XZKA 4OREX 4U9HS 3DTVD 4CHTA 1H2YA 4Z0TA 1THTA 3FYHA 1G8HA 1JWBB 1KSHA 1UODA 2XT0A 2QVBA 4FT2A 4Q03A 3C4QA 5JAQA 4AY3A 3C45A 4UNSA 1KPHA 2VJAA 1BW9B 5DNWA 1ODIA 1PJSA 2YNMC 5CVUA 1BMQA 4RTRA 4UPVA 4V24A 3OEWA 2EFEB 2C1XA 1HA3A 2G0NA 1XD2A 2J9FB 3C3JA 3SYMA 3KRTA 5BRJA 4GPZA 1A9TA 3ZI4A 4QRDA 4OAPA 5EXSA 1V1JA 2AB0A 4KDEA 2VWPA 1BROA 1RI5A 1XA0A 1YMQA 2C2GA 2DBQA 4AROA 4XLLA 3TR0A 4FNOA 3L43A 1ZIPA 4QBGB 3K1TA 3VOTA 2AQKA 2VJMA 1NR1A 4FB4A 3L0PA 1KVRA 3TJMA 2X41A 2CHEA 3N58A 2QMOA 2GBFA 1ELOA 4GR9A 1ZRMA 1TO2E 3IRVA 4JJ8A 3GBVA 2W37A 1IAVA 3VGPA 3VV3A 1DG9A 3IEVA 2QNRA 2BFDA 5IBQA 1JEAA 2IPAB 4FE7A 4BX3A 3IGFA 1ZOIA 1VG8A 2D54A 1S8AA 3CLKA 3GMTA 4MB0A 5IEBA 4LF5B 4P53A 2CKMA 5K03A 1KP2A 1J2JA 5TEVA 3FMVA 5JZOA 4DQXA 5AUPB 1QGZA 2ECQA 2QJTA 1KSGA 1YDGA 3KKQA 2WR8A 2DPLA 4XRRA 3AMVA 3DCYA 2BGUA 2P4SA 1YZ3A 2D4AA 4JLOA 4NAVA 5C1BA 5LDDC 2DUWA 3SZUA 1Z18A 1UP4A 4PNPA 3UB4A 1RMYA 1E4OA 1B7GO 2DZDA 4GP6A 2AJLI 3LQQA 4B8ZA 1EVIA 1Y5MA 1ZGAA 2EG9A 2WWRA 3LK7A 2NV2B 1FRZA 2PZFA 1G7SA 3GUHA 3QUCA 5C0OE 3IUYA 2FG5A 1BQ4A 2A35A 2N1MA 3TE6A 4B3BA 4QPDA 4GM1A 4TRNA 2Z6QA 4LPSA 2FI1A 2KWIA 1N2OA 2UVDA 4OPMA 4RSRA 5HKOA 4EG8A 2HSJA 1RLMA 2GAAA 5F2OA 3DBHB 1O96A 2QMYA 1XKXA 3FW1A 3QOFA 4QHTA 3W8RA 2PRJA 4NH4A 1SAYA 5DI9A 3ZCXA 2HK6A 2N42A 1IWOA 1Q6ZA 2CYAA 2XF8A 3B8EA 1SA0A 1XOIA 3SXPA 2NUAB 5HF9A 4C6RA 4PZLA 4OLHA 3EMBA 4NE7A 2OAGA 5CGQB 1Z28A 2FP4A 4GYJA 4N7RA 4IOLA 2AC2A 1AV6A 2VYND 3LXMA 1IZ9A 3WAJA 3UAGA 2FUCA 2AR7A 2X5OA 3JQRA 4OK3A 5K3AA 4FHCA 4TVBA 2HDWA 1F2DA 2G04A 2ONYA 1I5OA 1O9BA 1EB8A 2W8ZA 2KBEA 3IAM6 1KJQA 1THGA 2HI0A 2PV7A 5AXDA 5HIKA 2BUBA 1ISPA 4R1NA 1XJ5A 3NBAA 4FJ0A 3JQEA 3EBPA 1TJPB 1N75A 2NN3C 4B6JA 3ZVNA 5IYZB 4RULA 3WK7A 5CFLA 4JEHA 3OD5A 1ULZA 1BE0A 3A14A 1IZYA 3ENQA 3NRJA 2WVJA 3LX5A 3I28A 3RYFB 4B17A 4W5OA 2VTEA 3B53X 3U7IA 2QIOA 1L5KA 1QGAA 1GYPA 3KXPA 1J1ZA 1DMRA 2FSGA 3EGOA 2EBUA 2IUUA 4BGDA 3JARA 3UCEA 2HU5A 4AJNA 1GTVA 3KQYA 4JR1A 2OZVA 2GVDC 1FJ2A 1XD9A 1EP2B 4ZIRB 3NT5A 2D13A 2PBRA 3TBFA 3BN3A 5I9IA 4JGGA 2OQRA 4ARCA 3ORQA 3MWFA 1NI5A 4Y1RA 5CB4F 1GOTA 3FLEA 5AYVA 1AKYA 2WTEA 1MX9A 2ZYWX 3AHCA 3UCXA 1O7JA 4OHXA 2YHIB 1P2UA 2D7JA 2VT6A 2WU0A 1ICEA 2FEPA 3ETGA 4I6JA 3ZX4A 4BKUA 1GGNA 3FWYA 4I9NA 1KWGA 1I4EB 1TFRA 2HV9A 2H6EA 2VUHB 3FWPA 9MHTA 4YAKA 3PNKA 3CIFA 2O7QA 4URWR 1DX6A 3IPAA 4WNYA 2DVMA 1RI1A 4P0QB 3UB3A 1Y1QA 1DC6A 3O8BA 1POXA 2GNAA 2I76A 1PS0A 3ZCUA 5ISMA 3HJBA 3Q6IA 4KFRA 3VKVA 4J1TC 4JBNA 1AM4D 1ZCJA 1YL7A 2WD7B 3WGKA 4IAOA 2GD6A 4NAUA 3LUCA 1TM3E 1I4TD 2PZAA 1QX4A 3LM8A 5E9JA 4ZT5A 3W5AA 4R40A 4G4SP 1Q57A 4UMDA 1J8YF 1PD0A 5DGIA 4CLRA 2H5JA 4JC5A 2V65A 3I2FA 2N3ZA 4KQCA 1Q7GA 3OT4A 4I4LA 2XSZA 4GLJA 5DM4A 4CF7A 2B94A 3EE6A 1EGHA 3D8UA 1V8FA 3AVPA 3FFXA 4DLSA 4DMHA 5B6JA 5BN3B 3TQCA 1XEFA 4N47A 2VWQA 3QM1A 2HF2A 1T6YA 1OZAA 2E9SA 3ABZA 4CDRA 1XD2B 1HSOA 1FNMA 2J9FA 3LPCA 3QPAA 1FIUA 4K9RA 3Q2KA 3AFGA 1G3MA 2IY9A 3N0WA 4G8DA 1IU9A 1R4MA 4YLGA 2AN9A 2EAUA 2YS6A 2ECFA 4PNZA 4OI1A 3AR9A 1JI0A 1L5WA 3FLMA 4WCDA 1DKLA 3EEFA 3ZCVA 3O8OB 5JS1A 2H4YA 1YUBA 4REQB 8OHMA 3MD9A 3ZV4A 1I9GA 1XF9A 2P9GA 4YYZA 3G59A 3W1VA 5EIHA 3Q1KA 3MS4A 3JRWA 1OX5A 2JFVA 3VVBA 1P81A 1W47A 2C20A 1RCTE 1YNOA 3N2YA 1UEIA 2ODTX 5CYOA 4MZDA 2PBFA 2OV2A 4M87A 1JQBA 1C1DA 3PJFA 3A26A 1AKQA 1KI2A 4D8VA 3A6LA 4I0WB 4DVGA 2G36A 4EHLA 3KXKA 2N9UA 5L7WA 3L8DA 4F3RA 3D4PA 5FWAA 3QBEA 4C14A 2NVOA 4H2DA 4X45A 5K6AA 1E1LA 1RWOA 5F5XA 3RUDA 1SXHA 2HSZA 1PHPA 1T8PA 3S3TA 3UW1A 3V2HA 1H6DA 1S2GA 4JSRA 1X7GA 1IZZA 3B2NA 3PEEA 3U7JA 3VU8A 2TMGA 1S4QA 3QLUC 4QSHA 2ZP1A 1UOPA 3K09A 2Z5LA 2R4UA 3F71A 4CV1A 1SXIA 2JFNA 3G17A 2H18A 3ELDA 4J0GA 2P7IA 5JALA 1DAIA 2XZLA 3ZPXA 4FMDB 2CUTA 4QELA 4WUVA 4GGPA 1XU7A 2BE9A 3L1IA 1E63A 3DOCA 2PS3A 1TM4E 4FX5A 1NDUA 1VPLA 1ONOA 2VNIA 1WSDA 2TYSB 3T3IA 3BJZA 1VMAA 2ZIUB 4WLNA 4KXUA 4UEKA 4ICIA 5G40A 4U7WA 5C4MA 1OE0A 4NHOA 4Z9BA 3SC3A 1I3LA 2IUEA 2TS1A 4A5SA 1CUJA 2DBVO 2Z43A 3FNFA 1Z63A 1MRZA 4HN9A 2Z3ZA 4U63A 4WBXC 4RA9A 1Z4KA 2IXEA 4JQCA 1GKYA 2G80A 2YQZA 3LL7A 3ZCPA 1DWQA 4R81A 4RGBA 5HRAA 1WVGA 2WZDA 4ILKA 2NTEA 3UMGA 1K4KA 3EZLA 5J2TB 4E2WA 2X22A 2NXNA 4EF4A 2PBZA 4EHKA 4HNRA 1I2ZA 4HDQB 4J0JA 4G1BA 3GZJA 4YALA 1AK2A 1V5GA 2OO7A 3VU9A 2Q9BA 2GJ8A 2B4KA 2GPJA 2PZMA 2WWHA 4IYJA 3TX2A 2L82A 4ER6A 3QXHA 5A5GA 5KVSA 2PNJA 4I1PA 1LWNA 3KS9A 4GNKA 4WBSA 4EF6A 3ZQKA 2JC3A 4JMPA 3S1AA 1LV8A 4HRVA 1XP8A 2DUJA 4RMHA 1T2NA 3JV7A 3JYLA 4QPZA 1FSPA 1M73E 3N87A 3PD1A 3ZLVA 5JROA 1DQZA 2LWIA 4G8CA 1C5KA 3DYVA 2RHOA 1QIHA 3HXMA 1DQPA 4TMVA 1SIOA 1XCPA 2AZ4A 2IU6A 2R85A 3GVCA 2WUFA 2CMHA 4PSCA 1KOLA 4GOND 3OTWA 5DW3A 4O8CA 4UTRA 3PWZA 3M5WA 1G3IA 3OZVA 1TYZA 1KEEA 2CNKA 3PR1A 2ZUTA 5IUJC 1K3TA 3FDJA 3OZFA 1NJ6A 4P08A 2CLDX 3LX6A 1KEZA 4PPGA 3LIPA 2OEPA 5JEDA 1P31A 3LYUA 4MYUA 4P4SA 2ZZNA 1T0JB 4UEOA 3IEKA 3TQIA 2OY0A 4PC2A 1FTWA 1VHTA 4Y8VA 1JVBA 3V3TA 3WLNA 3ZV7A 3UF0A 4B84A 1FW8A 4BLWA 5IBPA 5C4IA 3BB4A 4IDQA 1DDIA 2CBZA 1H1LB 4BB5A 5SZKB 1SBHA 3KKEA 3VFDA 2AZTA 2CVOA 2YBDA 3A6HA 4FUTA 4NECA 2BPOA 2BGKA 1Y1SA 2P35A 3NHMA 4IQFA 5F78A 1ZIOA 2X77A 3CUYA 3GPLA 4J2HA 3JWGA 1T1IA 3UYKA 4DILA 2QPAA 3T3DA 1M6NA 4QYMA 5TE9A 4V03A 2PU7A 2VXBA 1U28A 3E1SA 5LBTA 4I4TF 1GUBA 2IPMA 3TRKA 5CU7A 4EB8A 1JS1X 2JLVA 5LMCA 4IH4A 3TGLA 1BQ3A 1L4NA 1EBBA 1G6OA 1M3SA 2ZVQX 3CZCA 4HVTA 3H87A 1LRLA 4IHAA 2CGEA 4F6CA 5IRCD 3ZN2A 3V1TC 1YS1X 2DFKB 5D01A 4WFKA 4MUMA 3HVHA 1XO1A 2IOHA 4H18A 1ESDA 4B31A 1YFJA 3HCBA 1G2OA 3EQ8A 1JUDA 1KDZA 4B3HA 2Y1XA 3ES9A 2V7WA 1SVKA 2R1VA 3OVMA 2J6HA 5JWHA 1H1DA 3W34A 2HCFA 5BYKA 2J3LA 1V0JA 3ROQA 4OQYA 1E3QA 2G5PA 4WY2A 3Q7IA 3ZIAA 4JX8A 4YT8A 4JEUA 1OIWA 4F5EA 1OXUA 4X20B 3DZFA 3BXFA 5T4EA 3DUFA 3QKRB 3TRDA 1EHIA 1OH5A 1Q1ZA 3FOZA 1OXVA 1FP6A 3EF3A 3TUZC 4TUYF 1QFXA 2CEKA 2J59A 4ZCMA 4G0WA 1XDBA 4U5XA 5JSQA 3EXHC 1TO6A 4GZMA 1L6RA 1B26A 2OCBA 4JKOA 1QRRA 2R4QA 1YNSA 1ZICA 2BFBA 2FPIB 2ZAOA 3FHOA 3QQPA 4DXHA 1KO4A 1KP9A 5FDFA 5IJZA 3A4TA 2VHYA 2PJDA 3LPNA 3IEPA 4ES6A 2CXSA 3BXPA 3HKDB 3UEOA 2PEYA 3DM5A 4ZOBA 1UZMA 3N7AA 3BJRA 3ONNA 5ADUS 2JLUA 3RRXA 2WA1A 4OYHA 4PONA 1R15A 5D1NA 1LCIA 1FDRA 3DE6X 1KTVA 3GCDA 2Z8YA 5BORA 2A5LA 3TCXB 3ET4A 1QBKC 1MJNA 1SBZA 3GFOA 4WN9B 1E94E 3H11A 1GSAA 1RWQA 2D0IA 2Q1YA 621PA 1TKBA 1X7YB 3IV6A 1D1SA 3S5UA 5KREA 3GVHA 3HJHA 3VSEA 4BECA 1N33B 4HWGA 1W5AA 2MINB 3AZPA 4HADA 3VISA 4DMGA 4W5TA 2VQEB 3PIIA 1MAUA 5DRYA 2ZUBA 1SOWA 4BKPA 4K1LA 3JYNA 1CEEA 4BUJA 3OWOA 2XHZA 3SQWA 1QGUB 3E81A 4YMIA 2ZAGA 2H63A 4XTCS 5B37A 1DKRA 1N2GA 3P0JA 4IM7A 1Z4PX 2B1QA 1FQKA 3ETCA 1G6HA 1PBTA 3LDFA 4RFSB 4TKZA 2L2QA 1RYEA 3L1VA 3GA5A 3UJAA 5KDDA 2AXQA 3IVGA 2GPAA 3EODA 3HZHA 4BJ6A 5JECA 3UCFA 2RHRA 2WEKA 2G40A 2GEDA 3WVNA 2FMIA 5AKJA 1T4CA 2DWQA 4IRXA 2IF2A 1T4MA 2JCXA 1RYDA 2JGMA 2PGDA 1P91A 2WNSA 2HEGA 4Z3KA 1ZH0A 1C9NA 2QT9A 1TYAE 4C0XA 4K9OA 5E4YA 5LZ2A 3PUHA 3VPHA 2HF9A 4PSAA 3WLEA 3NBZC 4QJBA 4A92A 3LDGA 4HFJA 2FQXA 3PV0A 2Q1UA 4JV5B 3ICQB 4B3FX 3OZBA 3RIMA 4LJSA 3Q6NA 3TMKA 3W6PA 2QRPA 1HT0A 3WK6A 2Q4OA 3M2PA 4E5PA 4TMFA 1TA4A 4LIPD 1FMFA 4D9EA 3C5EA 4ZREA 3GLUA 4PLVA 1U6KA 3FHLA 2JA1A 3CN9A 3I9JA 1DO0A 4R1MA 5ER6A 3H1AA 3AP3A 3U3DA 4CTNA 4Q9NA 2R1ZA 3ZDQA 1TZ2A 4N3AA 4ND8B 1YONA 5CPBA 4HK4A 1X1QA 3WNQA 4OJQA 1RKVA 3KWMA 1GKLA 2R86A 1R50A 1JSCA 3W3AA 1VP9A 5FAKA 3OPNA 2BEJA 1VDZA 3JQGB 3ID6C 3EZXA 3WLFA 7REQA 3KPUA 1V43A 5G41A 2JHPA 4YDSA 1GT6A 4O2RA 3U0BA 5LVAA 2AOUB 3OCUA 1X77A 4B4OA 2EX1A 5FI0B 3UAVA 4MJ7A 3TX6A 1SOMA 3S1LA 2GF9A 5D3KA 1CP2A 3P5BA 4KOEC 3F6PA 1E2UA 2JCGA 4IDOA 3G9XA 5I9SA 4YY3B 4YRBA 5JS8A 1PL0A 2BH9A 4AQ7A 2QNIA 1FS4A 2VN8A 1EFPB 2CKDA 5GP1A 3TKLA 4FT4A 1KBZA 3KZ1E 4HTAA 4DR1B 4S1NA 3LBHA 5F2NA 2AW3A 3ABRB 3RIEA 1F4VA 2MYUA 2ZB3A 1TKAA 1G38A 1P17A 2NUTB 3E03A 3L7KA 4J7XA 2O0LA 1AN9A 3THYA 3T1OA 3K4PA 2DX7A 3AIOA 1PR2A 2X2OA 3EZGA 2PGAA 3H99A 1K8XB 4DLAA 1CQJB 3I8OA 4ZYZA 1K06A 4WKNA 2Y4NA 4L50A 4L95C 1V8DA 1Y8CA 2FV8A 4YYEA 2PA3A 5HCIA 2C4UA 2OHGA 3GP8A 3BMCB 5GONB 2CUNA 1M74A 1A9OA 1JZSA 3ABSB 4UC0A 1TCVA 4ZQGA 2MYTA 2AMFA 1Y9EA 2NPFA 2PL5A 2EX4A 3G0IA 4HL6A 4EI8A 1M66A 3LVRE 4HN2A 4HPXB 3TW6A 4P93A 1CUYA 3E2PA 3FYTA 2BR4A 4F12A 4NMXB 1Z22A 3B48A 4G4SO 3FA2A 4WASA 3O73A 4WIAA 4AUNA 4O5AA 2CY0A 2GZ1A 4Y2YA 4F91B 5J63A 1FUUA 4C4RA 4KGXA 1Y8QA 2R00C 4LOLA 1YJCA 3AG5A 3IALA 1EXVA 4OHPA 3V1MA 2WTBA 3ADKA 2YR0A 3C0KA 1UIRA 2OAP1 2ZE5A 4BKRA 5B36A 1SVNA 2V3WA 2H9IA 4GMXA 3ILVA 4A0HA 1V5IA 2GXSA 5CMLA 1RMQA 2A78A 1KFEB 4O4JF 5EUMA 5BNFA 2BGNA 4D3ZA 5JCXA 3K8QA 4NF2A 1GTZA 1E59A 4DREA 1JLLA 1QZ3A 4LE1A 4BN5A 2X0KA 1FX0B 2YBEA 1T1GA 3CJQA 4TMTA 3GHHA 5C5IA 1WOMA 3H5TA 3UPTA 2DR2A 1TK9A 1JZTA 2H4FA 4N0EA 2XH8A 4YAJA 5ALXA 2UXDB 2NP6A 3K1AB 3TI7A 1RMTA 3PF8A 1QK5A 1VA4A 3KLOA 3KUDA 3Q1LA 2Z6VA 4ZEOA 2DYKA 5A5EA 3U16A 2QX6A 1I4LD 2DEUA 3CA8A 3LKZA 5JU6A 3HGQA 5C8ZA 1MPTA 4MVJH 5FD8A 2NSDA 4PG8A 3NUQA 4CV0A 1YDMA 4UTPA 1GCOA 1GNTA 1WEHA 4WBNB 1JEDA 3B36A 1P62B 4RA9B 1KI6A 2CF5A 3UGQA 3GDGA 2MMGA 1W4LA 2A3RA 3HUTA 1P39A 3IQGX 3JD1A 3KOUA 3NIDB 1UK6A 5CA0F 4OAOA 1VYTA 1X7ZB 1V1MA 3PFBA 4PSUA 5FKJA 5ILQA 3SLGA 4E5NA 1DKPA 1HYEA 1Y9AA 3PPYA 1XMPA 4OQPA 3QKSB 1U0RA 4R9UC 3V7FA 3WWZA 3G5TA 4LXUA 4ZCLA 4EY8A 4OFBA 3O47A 2NZYA 5HJ7A 1G8AA 3NT2A 3FYSA 2XE4A 1U0FA 1K7CA 5FNVF 1XLWA 2R5FA 4DCGA 3L06A 5FCDA 3T7IA 1B73A 3MNFA 4LY3A 4HQFA 5DGCA 4JXXA 4P81A 1OFTA 3AW8A 3CUTA 2RH5A 1XPOA 3RKRA 1GAWA 4TUYB 3WKEA 3DEKA 5D5HA 4RTNA 4YCLA 3ZDZB 3JSAA 3PGJA 3V7YA 4HUTA 1K86A 2JJ2D 1QTRA 1LPBB 4KPYA 3JQ8B 4F96A 1QU3A 1F4LA 2VRBA 1E8DA 4Y9DA 4XDYA 5CDUA 1WTCA 4N39A 2EG5A 4U8HA 2XMQA 1BXZA 2EKDA 2J1LA 1YE3A 1WXFA 1SPBS 4G5GA 1DCTA 1OFUA 4KV9A 2NTNA 3E58A 2R7AA 1IK4A 3HQ4O 2O2JA 2LIPA 2HUNA 1U7OA 3N2LA 1J23A 5G02A 5K2MA 1R00A 1PR9A 2W6QA 1TK2A 3A3YA 2C8LA 3SOPA 4EG3A 5B7GA 2XZDA 1JLMA 1IOZA 4KQGA 3W5JA 1N5LA 1SCBA 4K2AA 2W6CX 5C80A 2V3CC 3VHXA 3QKIA 1H0RA 1YJQA 3JAKA 4KCGA 1UBMS 4R84A 5L53A 4NBVA 1GITA 1SVOA 5SY9A 3LF1A 1U81A 4W82A 3AFOA 5JO0A 1CETA 3J7TA 2HCBA 2B2XA 3F6YA 3F90A 3GNQA 4EHNA 1BQEA 1KH3A 2E2WA 1KMIY 3U4AA 4ADSG 5HXAA 3RT9A 7GPBA 3VPBA 1KORA 4NCIA 2L17A 3A04A 3OM1A 5DB4A 4B71A 4ER5A 3VNQA 2G88A 4YECA 2VI5A 1JU9A 1PZNA 4CTOA 3EXAA 1E2KA 2O14A 3A31A 3WQHA 3ZOKA 5KX5F 4F5WA 1Z6QA 4X9XA 4BMPB 3PX2A 3QEKA 5E1MA 3O9VA 5GZ6A 3K72B 4LRUA 5AVVA 3LF2A 4RD3A 3TQFA 4M99A 4YMUA 2BTQA 3QU5A 4FILA 4MUBA 4LWQA 2O07A 3BMCA 1MC4A 4EYQA 1SHUX 5ICCA 3NHJA 3C8MA 3IPYA 1QBGA 2E87A 4ZK2A 1IRIA 1YHZA 2O50A 3L7BA 4URVR 4FKBA 4YAWA 3F7NA 5EWMB 2V6JA 3BS4A 3LIIA 3OQIB 5H83A 4D9KA 4F45A 5JRZA 2BGJA 3DONA 3HH8A 5F3RA 5A5VA 3LBAA 2I3DA 2XA1A 3EGXA 1WB6A 2LKDA 2JIBA 1IUOA 4WLUA 1H9BA 1N2BA 2V96A 2YJGA 2ZS7A 1DLJA 3HSSA 4MV6A 1ZZGA 3LOQA 2L0XA 5A3VA 3K2IA 5IVKA 1CUIA 4ZU6X 2NO1A 1RQLA 2CJYA 1IPHA 1FTNA 2O2SA 4DIBA 1MAWA 3OUUA 5IVPA 1ZFNA 1T5BA 5DK6A 2L19A 1MX3A 5TQ0B 1K6JA 1C0KA 3T34A 4KMOA 5FNVA 3BORA 1NW4A 2QD2A 4NMMA 1NY6A 4NOMA 4RYLA 3R7LA 5CFMA 3ZZMA 2O8EB 2ZQ5A 3VTAA 1X1RA 4XXHA 1OGIA 5K8CA 3Q8KA 3LA6A 1NQUA 5AICA 5ULLA 3JX9A 1Y3AA 2HCTA 3UV3A 4EHFA 2DGDA 1NOKA 2ONZA 3INRA 1THMA 4M49A 5AKZA 1JYFA 3IAFA 4V3CA 1IXSB 5DZSA 1OWLA 1WSBA 1XNRB 2RHLA 2OOSA 3BKXA 2MTBA 4BWFB 1PS8A 3R0XA 4ER0A 4LXXA 5D6NA 5DM0A 2JFUA 3UWMA 2H7XA 5EUCA 5HQ3A 5KYTA 4IR7A 3ZU2A 2JJ8A 1RZUA 2OC9A 2XGGA 1TDJA 3IPLA 3KZMA 4LOIA 4KI7A 4YCMA 4X65B 2Q28A 4ZMRA 4XWKA 5JPCA 2DH5A 2WAMA 1UFOA 2O0KA 1BS2A 1FX1A 3THRA 5TJHA 1AHPA 3PDCA 2QZ4A 3MTIA 1H3EA 4F2WA 1O5OA 3QTBA 5AR1A 3N6VA 2V4ZA 5IG2A 4DV7B 3SHFA 1WUHS 2YIVX 4DJFC 3HHPA 2FFQA 3BRSA 5LYJF 2P9FA 3BMQB 3PC3A 4KQWA 4LRTB 3I9LA 3BTSA 2W6PA 5G1OA 1KYXA 1T9HA 2FW8A 2V58A 1HR0B 1N6KA 3FPSA 2GCOB 2A0KA 2RH8A 3LZDA 1ENOA 1YR1A 3EB9A 2CF6A 3OWHA 2PS1A 1K5DA 4R6WA 4QU0A 2QRZA 3DMTA 3NWJA 3QVXA 4H7EA 3WGHA 4K6OA 1W4BA 4PXYA 5EJAA 2KI5A 4RTJA 3LCJA 4LWZA 4WXYB 1PJQA 4RPIA 1XRJA 4D4LA 1EFRA 3DF7A 2F62A 5JAOA 3Q12A 4V3BA 5BUQA 4L8YA 4W7HA 5DEIA 1U8UA 2OCKA 2YMPA 2VF5X 4OGGA 4RZXA 4BZXA 4RTMA 5LXTB 2ZBUA 4YBRA 1GL9B 1RXIA 3GJ6A 3PA8A 4R8VA 2NTJA 3NMUF 2WVHA 2QORA 3JQGA 1S9HA 4H3KB 1NVBA 3FPKA 5JXJA 2WABA 4KVGA 4DTIA 5D84A 1MT3A 1XL1A 1Z83A 2GK7A 1T36A 1P9RA 2PWBA 4KDFA 4QWWA 3Q5EA 1PVVA 4KSBA 5LDGA 2WWTA 3W9SA 2O2IA 4BOYA 2AFIB 3GP3A 4BE4A 4PIPA 4R0VA 4LHYA 1R6XA 3X1JA 4EB3A 4B4UA 3KL4A 1I8TA 3H05A 3BCRA 4PLTA 4P98A 1X7HA 3WXBA 4PNEA 2G3YA 1E1QD 3N8KA 4Q19A 3A36A 5CNMA 1A7AA 2UUAB 1CUVA 4C22A 1L7AA 3M4JA 4OQNA 4AFNA 1ZVKA 3LT2A 4ZO9A 1VHJA 4EAAA 3FUWA 4CL3A 2FLWA 1ZU4A 3VJRA 2H1SA 2N47A 3CJRA 1DKNA 4NPHA 1W0JA 4GI5A 5BWCA 4ML3A 4BV8A 4HKTA 3MRSA 5LZ5A 4DRYA 2QD3A 3ZZNA 1GEGA 4NYJR 1XZIA 2LW7A 2R00A 2FQWA 2ZRDA 4MS1B 3TF5A 2BCJQ 3UMRA 1SVWA 1Y80A 4LJ8A 2YWGA 3DYBA 5GQSA 2ZTHA 4BBJA 7YASA 1VBMA 3MB5A 7ADHA 2AMJA 2WPDD 4IDCA 4LFAB 1KE1A 4KQEA 4E03A 2ZS9A 1EINA 2QTAA 4J7UA 3URKA 4OFXA 4X61A 4J91A 2HJHA 2E1RA 1Z74A 3TAHA 1SXJE 1IPEA 3ECSA 1T4GA 1YWGO 3BMOA 1C1XA 1Z2CA 1IMJA 4TV9B 1P5RA 3JRNA 1ML3A 1E66A 3TK1A 4EG6A 5BW8A 1H3NA 4A6XA 3L6CA 1KIFA 3N59A 2GJSA 2E4YA 3ZXUB 3MINA 1EP1B 1Q1NA 3ASZA 3W3AH 3QLJA 2LZ0A 5FL7A 1T8RA 4ZT7A 1UCFA 3MOSA 1VE5A 4FI3C 4AP6A 4EFNA 1RLOA 4JUFA 1JH9A 4O2AF 4D8UA 1BKSB 2P8SA 4AWBA 4DM4A 3HJCA 3WB2A 1BJRE 3R3JA 2B8JA 2FPWA 2GETA 5TY0A 3RYCA 2D6FA 3FCSB 3CH4B 3D6NB 2FWNA 3BMXA 1KBQA 4QJ4A 1PZGA 2AK2A 2CB0A 1W19A 3O90A 1TYDE 3H5IA 4IGIA 4DZZA 3L6RA 4KFSA 4E1AA 4FGSA 1WVMA 2ZJBA 2GUWA 1P2SA 1G9TA 1MABB 3F96A 3ZDRA 1EJ6A 2I3ZA 1AQJA 5TMEA 4LVNA 4JI4B 4JITA 3K05A 1SHZA 3PFWO 4X91A 2FFRA 2NADA 1Z0IA 3DEFA 1XCMA 5DJ5A 2DPYA 3WBFA 3Q41A 5BR7A 5L51A 1FYVA 4D6YA 1YZHA 5CVEA 2VHVA 4RF4A 5HQ3B 3AO0B 4PN7A 4RH0A 4DR5B 1JN0A 2HL6A 2ZRMA 1L5SA 2CSXA 4QRHA 3ROFA 4R6XA 5EIXA 2V7UA 1RE1A 2DR0A 2YINC 3E9EA 2QTMA 3B85A 3EULA 3GUUA 4Q3NA 3C70A 2YFKA 1EJBA 4IP0A 1FRQA 4DB2A 1MORA 3WHPA 3HGTA 3V34A 3T35A 4BO4A 3K53A 3UKOA 1Y5LA 4WCFA 1MC8A 4QBFA 2B2CA 3C7TA 2LBPA 3VZPA 2FPGB 2IOYA 4MYHA 3G0HA 4QAQA 2ZBGA 3L01A 1OQAA 3HRKA 1M8JA 4W8GA 2ZVPX 5DGHA 2R0QC 1G98A 4M6WA 4H16A 1E5XA 3AF1A 3TZEA 4BHTA 3L8FA 4PX2A 3ETJA 3KAJA 1F2UB 1A8UA 3VM6A 1KJWA 3MMSA 3JARB 4Y9RA 1UUFA 2QU8A 5EJGA 3LP8A 3WJ7A 4DMMA 3W1WA 4QVKA 5BMOA 1NLYA 1JDJA 2WYWA 4W1SA 4FBMA 3T0GA 1Q11A 1YHYA 2P2ZA 1P9WA 3EVDA 4TUYA 1KQPA 1TE2A 1JQ3A 2V7EA 3ROXA 2XXAB 3C3MA 3NJRA 2M6SA 3O2NA 3SFZA 4DAOA 3FF1A 3I6QA 4J7CA 1R5JA 5JANA 4M9UA 1QP7A 1I3KA 3RABA 3VAZA 4IFBA 2J3KA 1EWYA 1QKJA 2PMFA 5C3UA 4TLDA 3CM0A 3EA5A 3EMDA 2OQVA 3RS8A 2OVBA 3IJEB 1N2SA 3WJAA 1E89A 4YCNA 3A2KA 4PY2A 2G0TA 2J9GA 3BGDA 5CR9A 1Z0JA 3GRFA 1EVEA 4IO1A 5JJBA 2CD7A 2LR0A 3A1FA 5JNRA 1JA1A 2AFVA 5CK5A 2JJMA 1TLTA 3N2KA 3NTRA 1PGQA 3U17A 1IY2A 2P1DA 4TXLA 3V7WA 4ETIA 1PO7A 4G67A 4BQIA 2EF1A 4B09A 4FB5A 2XRYA 3MN1A 4PAWA 1E8MA 2AI3A 4HX5A 2H1CA 4TVOA 3VO1A 3I4CA 1MTZA 1XZQA 2NQTA 4X6LA 1K08A 3AJ9A 3RC8A 1FLVA 3FKSD 5HOQA 1Z8DA 4RF2A 1XC7A 3H4IA 1FNDA 4FDVA 4OO3A 1TT5A 2Q5HA 4R16A 2I8CA 3C2QA 5CHYA 3SBOA 4WL0A 1M2KA 2FOIA 4N5MA 1K27A 4RCYA 3UQYS 1H1LA 3I9FA 1QHNA 4I8IA 1U1GA 5T3YA 3S2IA 3STTA 3H04A 3W78A 3JQAB 5C51B 3EH1A 3NV9A 1TTPB 3QV1A 3KYCB 5JSUA 1WZ2A 1UAYA 3NOXA 2CWDA 4Y2JA 3PHGA 3HVJA 1FJGB 2BBSA 1QZXA 4EA8A 3A4IA 1TZBA 3A1TA 4XIJA 3ACDA 4LDAA 3DTVA 5F52A 5AIBA 3IT2A 3DHEA 1OLUB 2FSHA 4QRIA 3MOGA 2ADMA 4J1SA 1DJMA 3PQFA 1EUZA 1YA4A 2GF2A 2Q3MA 3LCRA 4PYLA 4AZ3B 4LJLA 2VRCD 4X64B 2ORYA 4C0HA 1MO2A 4U7HA 4ESOA 5K7SA 3CZRA 1W94A 1E2JA 3DZ8A 2I29A 4WNAB 1EYZA 3N70A 3U39A 1V11A 2X6TA 5E7QA 5L3SA 2RD2A 3GR6A 3D3EA 2MSCB 5EZQA 5EQDA 2EEZA 3DL4A 1M7HA 2WSBA 2FFJA 4UU8A 3TDMA 2I4TA 3T3OA 2RHHA 3O8DA 3QI7A 4E1BA 3O5AA 3JQ6A 1GLVA 1QIFA 3OURA 1JTEA 4Z8YA 1GGHA 3DPIA 2EGHA 4PLGA 1QORA 2P75A 3EGWA 4RIEA 3U3KA 3ZNOA 5EP2A 3RTBA 4CTKA 1IN8A 1WO8A 4H7DA 1CEYA 2KE5A 3DZBA 4GPBA 3GEHA 1CDDA 1LWOA 4B46A 3FGNA 4URFA 3ZI0A 3DLCA 3Q7EA 4GPIB 1LVGA 3X2SA 4DUYB 1R6UA 2C9ZA 3BM5A 3F78A 3WYDA 1EQ2A 3LX4A 2VQ6A 2KB0A 3OLZA 4E3ZA 2NAPA 2BMFA 2A1TR 2YZ7A 1MVNA 4XVQA 1FQJA 3OJXA 1NKSA 2XDQA 1G8KA 1QDEA 4TKUA 1UPCA 4M1TA 3TSWA 5B55A 1RM4A 3IQEA 3IUBA 3JR3A 4OK6A 3OZSA 1S2MA 2ABWA 1ZRSA 4HMOA 2YY5A 5F4BA 3F0TA 3VZSA 4C5AA 5K0TA 3Q2IA 2FSPA 5CW1A 4U9IS 3U4QB 1KKMA 5EGSA 3OE7D 4ZZ2A 4LTNA 4DR3B 1E4VA 1NKTA 1E3TA 3P32A 4IIYA 4BZWA 2W8BA 3EDCA 4C4YA 3OFSA 2D7DA 5FR2A 1YR9A 1CJKC 2W6JA 1M1XB 3G2KA 2JLCA 2V45A 3AWDA 1RJEA 4UVHA 1NBAA 4ZVPA 3S7TA 2Z5FA 5BO5A 4OYYA 4MVJF 5FB3A 3ZJVA 1N5IA 3SC6A 1KOFA 3CS3A 1Z2NX 2E4UA 3PD7A 1PQPA 1Y5NA 5BSUA 1ABBA 4C7OB 2CVZA 3B13B 3BRWD 4FBLA 4L9SA 1QP8A 4PGFA 1P44A 1GWNA 2XQJA 4PYMA 3H17A 2REQA 1BGXT 2ACVA 3BA6A 3CSUA 1VE3A 4GXRA 3R5SA 1CR6A 1U3UA 2H9AA 3GDHA 5LD2B 4MDEA 4Z9XA 1WNTA 2BFOA 1SR8A 4KXXA 1F48A 1KU0A 4BJ1A 1RI3A 4OXYA 5AW2A 1RC8A 2H1OA 2J3QA 4UOEA 5KOHA 3T15A 4E22A 5EVJA 4O63O 3TSAA 1KERA 2VBIA 4RK6A 1QE0A 3SEQA 3KB6A 2B4AA 4BVFA 1VBFA 1XNJA 1JG6A 3FR7A 4L8FA 4KNVA 2H2FA 2ISSD 3HJGA 4D45A 1YVDA 2VAMA 2WE7A 3L7JA 4EHDA 1Q0TA 1BC5A 3GLRA 2J7PA 5FTLA 5H0IA 4Q0MA 2VP3A 3RYHA 4E0BA 4HAOA 2BCEA 4BLPA 1U0SY 4N40A 2H4WA 2O54A 1KZ9A 4UAGA 3R24A 2Q5IA 1Z6XA 3FNEA 4IVQA 4TWIA 4MP3A 4TLLB 1U8CB 1NNUA 2V6IA 2BL4A 4O5OA 1FE8A 3L8EA 1L2TA 3ZHUA 2AA3A 4L1KA 1N8NA 3HVIA 3NTUA 4FYVA 3BL8A 4F2GA 3OO0A 1Q77A 3NHKA 3OX3A 4JEIA 3CB2A 2HLPA 4UTOA 1XCGB 3IAUA 3HLKA 4M2LA 3QE9Y 5AVXA 4HQLA 4I4IA 3FOFC 1IBRA 2BZ0A 3W7AA 2UU9B 1Y3FE 4B2IA 5EHQA 1L4YA 3LPAA 1VE6A 2A58A 2HJRA 4IYRA 4U7FA 1YVUA 4MEJA 4XM1A 3OBBA 5B4TA 3I3OA 4RLHA 5EIOA 4R8KA 3NAQA 1WMSA 1WZCA 2MR6A 4PLFA 3TQHA 3JW8A 5CB6A 3BFKA 1F0NA 1TZCA 3B38A 9ABPA 2PU5A 2A5JA 2R1TB 4PINA 3VR2A 5MN6A 4CF6A 2CDCA 2GBGA 2HU7A 5FTMA 3EGVA 3QYAA 5FNZA 2F00A 3RLIA 4ZVLA 3A3KA 1SN7A 3KNZA 1OZFA 4WXEA 3KYCA 2PKWA 1GG8A 1EMDA 3DZHA 3ZYCA 5TJ9A 2Q8NA 1E7QA 2W4QA 2ZB7A 3G2MA 1E20A 4C3ZA 4PN3A 2OCPA 5DTRA 1NLUA 4CZ2A 5C1PA 1SG0A 5JCOC 2ZDHA 1JBEA 3K15A 3M7IA 1E79D 1YQTA 4UXJA 4CQMB 2BHNA 2CVQA 2VSOA 1W52X 1XDWA 3M8KA 3F5QA 3EPJA 3KJEA 1FPQA 1G7CA 1RPNA 4ZQIA 1OV4A 1U9CA 3EIHA 3H9QA 1ZONA 1GFZA 3V1LA 3LQYA 4KYTA 1RTKA 2QL7A 4BVLA 4LGVA 1H2RS 1NX6A 3R09A 5JPIA 1TX4B 3BTOA 4YIHA 3I3SR 1ZR4A 3TM5A 1KGDA 5DN6A 4LC1A 3R5FA 2PD4A 5F7JA 3ZY2A 3FUCA 3UC5A 1H2EA 3GGSA 2UZ1B 1JMKC 3E15A 4UXIA 2P5UA 2RC5A 2ZXFA 1S2DA 2BEVB 3LCMA 1MC5A 4N7BA 5EMJA 1QV6A 2JLBA 3RJTA 2GO1A 3T9BA 4RVNA 1FA9A 2Z3VA 4FOPA 1YKGA 5ALEA 4B7CA 4C7KA 3THWB 3T3EA 4ANFA 2HQRA 2GYWA 2HWWA 1LSJA 3AUSA 2PXCA 4PZPA 3K7EA 1LJUA 3PIDA 4JIMA 2QVYX 1Z6PA 3FWKA 5BWMA 4L08A 2HSWA 4JCCA 5K0CA 3RTEA 4K05A 1LSUA 5TVGA 4CF4A 1E1CA 1RAAA 2IUFA 3AL2A 4CFZA 2OWDA 4BYGA 3LPLA 3KSRA 2YFYA 4AI6A 4NMHA 3OU6A 1VC2A 1JEOA 3ZUPA 3OJOA 4MVJI 3H18A 2VRNA 1KK2A 1FYFA 1NSYA 2R6CA 2XB9A 1R5NA 3EDYA 4UNPA 3DQQA 5K1ZA 3U9SA 2WJJA 4MVJP 4PO9A 5KQGA 4OIMA 5B1SA 1QGUA 1VFPA 2I1QA 5HS6A 1X15A 2PZ8A 3QBDA 2SKCA 1TCAA 2WIKA 3S8EA 3EWAA 4ZI2A 2XOKD 1U31A 4AKEA 5MFPA 1Y8AA 2VAVA 4FIZA 1TKRA 3TOZA 2VJDA 4CM6A 3NDJA 1LEHA 4US1R 3GELA 4S3MA 3NHSA 4DWWA 1HNXB 4E32A 1HKUA 3LI2A 3UT6A 4AJJA 3S81A 2J9RA 2XQIA 5CX1B 1H05A 5KCMA 4YEDA 4EOGA 4BQSA 3K8OE 5JJKA 1UC8A 4LAFA 1ZA1A 2GVNA 1YBMA 3MW8A 2I6FA 3EMVA 3O6VA 1GN9A 4AKIA 1D09A 1B00A 3D6JA 5E3IA 3RSFA 3MBKA 1P18A 1JQAA 4Q47A 1OAAA 3OECA 4YCDA 5A9RA 3CLSD 5KDOA 3ZDCA 5E95A 3LBNA 5I7WA 1Z8NA 3UA4A 3JQDA 3DDZX 2UVQA 3D3KA 4RNCA 4EYKA 1QQTA 2QGNA 1DCKA 2OR3A 4RXUA 2EHDA 2JJQA 3LK6A 5BMVF 2CCGA 1VM6A 1UPTA 2IZ6A 3EFOB 5KAPA 4ZQCB 2IP2A 3D7NA 4Q1FA 3R0VA 5C2JB 5JCOA 1CY7A 3CO5A 3HR7A 2EZUA 1OWMA 3KTFA 4FD2A 4ZV7A 2C77A 4O08A 1TZMA 2LIVA 1KY5A 2FPUA 3GQBB 5E1OA 3FX2A 3Q3VA 3T3NA 3FGOA 5A0FA 3HA7A 1HYHA 2BP7B 3K32A 1FB5A 1JDPA 2CNBA 5A3RA 5JR3A 2C2KA 2P2LA 1NJ2A 4B2PA 1KJJA 1OZ0A 1DTWA 2DUNA 1NVMB 3O4GA 4P36A 4WHMA 5JS2A 5HRUA 2C5HA 2A9PA 4NCAA 3AFIA 4NCJA 2M32A 2W83A 4UBLA 3A6FA 3CT6A 2X8AA 4C1BA 1E5LA 4RL6A 4RE5A 3I62A 1SZDA 4J3JA 4G0VA 4MV9A 2X7JA 5F3DA 3V32A 4M9SA 5LSAA 2REXB 4YI3A 2CXRA 5I4BA 4HWPA 5GJCA 1RZVA 3DO8A 2H2IA 1HZZA 1G4AE 2G9QA 2Y9PB 4HDRA 3N2KB 3H4VA 4WT7A 3FMFA 3T3HA 2FEKA 1QFSA 3VYSB 5HS4A 4H0NA 5TIIA 2EF0A 2Z1NA 3R3VA 4UTXA 1QPZA 1BMFD 5KTPA 1NDQA 3JTMA 4H6XA 5J1SB 4DCSA 1PIWA 4F3YA 2NWQA 2ZCVA 3KCNA 3LP5A 1KIAA 3K5PA 3VVLA 2XHEA 1F3LA 4BO9A 2QVLA 4ENRA 1PWEA 3FMPB 1XZFA 1C29B 1M0WA 3G1WA 3NHUA 3Q72A 4GZ6A 2FJ0A 1IEVA 1RCUA 4M21A 2J30A 2R1TA 4QU5A 3RK4A 1WHTA 1JYSA 4OXXA 2F9LA 1RQ2A 4XM0A 1WPXA 3N3AC 1VI6A 3RD5A 5AD1A 3LY5A 5ICSA 4FSDA 4TLBA 3Q98A 2DCUA 2ZR8A 3X2EA 2IYSA 1QFMA 8ADHA 2J46A 1EXWA 4DPLA 5HUHA 1WBBA 2YCBA 4GEGA 3NFYA 1VZ2A 3QHAA 1RCFA 4QGGA 2G5GX 1QZUA 3D43A 2QPTA 3FF4A 3M4ZA 4URXR 2JLWA 2FYTA 4BAGA 3R3YA 4EDHA 4Y6PA 3U3ZA 3QNUA 2F59A 3PG5A 4L27A 5L3QA 3NORA 3H0KA 4ZOLF 5F12A 1WKVA 3VPFA 3GLTA 3SVZA 3F3SA 4H17A 1RBQA 3VNVA 1JT2A 4NBSA 4DLLA 1J4AA 2FEXA 4BQRA 1D8TA 1X1EA 1AY0A 2JS7A 2YW9A 4BNHA 4UFPA 2EU8A 1YE5A 1H4QA 3VH4A 1HNWB 4AY2A 2WJ3A 2VK8A 1OFGA 3EW9A 4LI0A 2IS4A 1JR4A 1R6DA 4R98A 2CVHA 3JSXA 1PSWA 2PMDA 1E3SA 3OPYA 2KX7A 5E2IA 1VXRA 3ESZA 1KI3A 3R2JA 1J0AA 2PSEA 5A71A 4A15A 3LLVA 1CS4C 2BLLA 4KIUA 2ZR0A 4IPTA 1SKYB 2D06A 4RD6A 4CIBA 2Y0EA 1UJBA 5IARA 4A8JB 2OWEA 5A7FA 4DV2B 1PQYA 4R2LA 1SIUA 4PYOA 3A7EA 1CNEA 1Q7RA 4ZO4A 4JC8A 1OSNA 3KPJA 2O8VA 2W2XA 4AWXA 5EN4A 1NW3A 1FSSA 3G8BA 3LXXA 1Y4DE 3CQ9A 2QE6A 3RLFA 4U9UA 5HK9A 3D9QX 5FBWB 4A26A 2GM5A 2AWNA 4HFNA 5HK8A 5FFMA 1KARA 2OFPA 3B6JA 5TS3A 4HVLA 3HA5A 1FTGA 4PBSA 3ADOA 1FVFA 3GOQA 3H1TA 4HDMA 3CEHA 4O0LA 5FT9A 4ZPJA 1PP4A 4DV3B 3R0JA 4DE5A 1ODKA 3AB8A 4JNKA 4P4NA 5DHTA 1MH9A 4NYIQ 4MJLA 1Y1LA 1RWXA 4MQLA 2M1ZA 4YRJA 4M1MA 2TECE 4PSKA 5CFNA 1WJGA 1SD1A 3IUMA 3LT0A 4UQPA 3UJ8A 3ZDXB 4FGJA 1XTBA 2NGRA 4R8LA 1N9GA 4HI0E 4RK4A 4EY4A 2H4XA 3NDIA 1O97D 2QRVB 4MLCA 4OHFA 4MTCA 3T52A 1QX3A 3RTCA 3PLNA 1BWQA 5G3ZA 4RJKA 1EK5A 1NW7A 3RAPR 4NCHA 1FFXA 3WMRA 2B4TO 3C1UA 1TU0A 1JIUA 1UKCA 4Q48A 1W36C 2JRCA 1Z0KA 1HNZB 2DLCX 1Z33A 2WF9A 3OLCX 2DH6A 1D2CA 2PUTA 3DVRX 2CDNA 4HF7A 5DT9A 2XYRA 4BGIA 2ZYAA 2VHQA 3G2PA 1J56A 1KDOA 2J4FA 4BUZA 5AFSA 2QDXA 3BXGA 3PDHA 2ZUEA 4B3GA 1P9OA 3LS2A 4IMPA 1UOOA 3A9SA 1GA4A 3CV3A 3VI3B 2IE0A 3DVAA 5KEIA 4NFYA 4ESHA 1SKAA 2XTZA 3JZFA 3D2CA 3BJEA 1SY7A 5LYJB 1SXJA 1QKIA 1A7JA 1WW8A 3KOMA 3KBOA 1XZ8A 2X1LA 2WPDA 3G5AA 4MI1A 4DPKA 4ZQFA 4L2IA 3W1EA 2FJPA 4P54A 4P5PA 4JVSB 5LCXA 3QK7A 3VOSA 1DJOA 1ZD8A 5CPFA 2NUPA 2IP1A 3KLPX 2W5UA 2R96A 2LPMA 2PX3A 221PA 2ZS8A 2JHAA 4K9QA 1KJZA 4OAQA 1NBMA 1O4WA 1BHO1 1BWRA 1SUSA 5FO0A 1RWVA 3RU7A 2DECA 2WVGA 3GRCA 2D2EA 3PTLA 2Q3HA 1OX6A 3EX7C 1Y6FA 1N9KA 4HSEA 5AXBA 5DVZA 4J6EA 1P80A 1Q1EA 2CYCA 3IIEA 4IW3B 4ND4A 5T4BA 3SR3A 5JATA 5BR8B 4I5IA 2WTMA 1R9MA 1NE7A 2CHQA 4AKGA 1NP3A 4D41A 1YRYE 2VJPA 3HFGA 5TS2A 3G68A 2GYYA 2PKQO 1PWHA 2VKQA 2O52A 3NTOA 4OBWA 4YRGA 2H85A 1KSFX 3LC2O 2IPNA 1NMYA 4MWEA 3UNXA 4B80A 3RNOA 3CLUD 2Q5FA 4JBYA 4HG2A 1M2VB 3EHEA 3Q3EA 3U9TA 5EZSA 1H6AA 2R7LA 2XNDD 1P0PA 2OGTA 3NANA 4OKIA 3BGOS 5F51A 1L5YA 2GVZC 2PL1A 4DBLE 2BMWA 1JVSA 5DYNA 4S04A 2DSTA 2LCFA 1Q5PA 2QXYA 4M0PA 4MQ4A 1P5FA 3FI9A 1CV2A 3R7WB 4BRSA 4MAFA 1GA1A 2DTXA 3G1TA 4D0GA 5E0OA 3R4VA 5KDLA 4G5QA 3WDLA 1NJ1A 2GS9A 3ZDAA 1GQSA 2ZTUA 3D7SA 1YCFA 1VGRA 3K2EA 5I4KA 3O4IA 3HY3A 1SZPA 1NUQA 4XA8A 3WY9A 3AOGA 4JR0A 1OD6A 1PV2A 5T7BA 4EFLA 3MRVA 1XZLA 2GCNA 3ND8A 3QBJA 4HAVA 4HWTA 1YJ5A 1M1NA 2QYTA 3A28A 3A0UA 3BFJA 3VOBA 4B6QA 3L7IA 4OUDB 1QCDA 3EDRA 5EZYF 4XR4A 3T9CA 3OJFA 1X2EA 4UJ3A 4JI1B 4JJ6A 1MG0A 1VA5A 2MWMA 1KQFA 2W2KB 4LJ7A 5DWVA 4BO3A 1XT6A 4IDGA 1RRGA 5IJ9A 4RAOA 4J6FA 1ETHA 5KHOC 4FJ1A 1C7QA 2WWYA 5DH9A 1CJCA 1PQUA 1Z26A 1BIFA 1X8KA 2KW5A 3PYMA 1D5WA 1UR5A 3K3PA 4GX2A 4FKMA 1Z47A 5GGYA 4A0GA 4PAMA 1CUWA 9ATCA 4UE3S 4C29A 2ETVA 4MRNA 2H57A 1P0QA 1QVZA 2RAPA 5A9TA 4ASUD 2CHVA 4BRZA 2V97A 2GAFA 4EWLA 4YRPA 4XIGS 4XQ0A 1INLA 2ZPUA 1TVCA 2BEWB 3Q9LA 2VJCA 4EHBA 2P68A 2ZR7A 4DLYA 5AJZA 1RRVA 1RWBA 2H4HA 2R48A 3C15C 2OO5A 4KWHA 3OCWA 4RESA 4Y3UA 1KDYA 2AJTA 3MSXA 3IH5A 1ML4A 3ER9A 1XJQA 5JYBA 3TD6A 4MW1A 1NF9A 2R97A 5TXGA 2G5CA 2PQ6A 1TQHA 2JBAA 3UHJA 3UT5A 3K09C 2WNHA 3DB1A 1U7HA 3L77A 3PPIA 3STXA 1PEDA 5FA6A 1AMUA 4COKA 3ZLBA 1GEEA 1E3LA 3HZZA 4LF7B 1YR6A 4PQGA 3WGGA 1G55A 4U2EA 2EZ9A 3U0VA 4FR0A 1V2HE 3WP1B 4A8TA 2RSLA 1HH4A 5DHAA 2K7ZA 4UUOA 1N7JA 4CM3A 1ABEA 8GPBA 4I50A 1M6HA 2C59A 5A9SA 3QPVA 4JWTA 1M34E 2EKQA 1IBKB 2BM9A 2BZSA 2OC4A 4RYDA 2B1IA 2Q4TA 4UHHA 2OENG 1D07A 4MYTA 1IM8A 4N6GA 3MIZA 1O6CA 5NULA 1SCNE 1XALA 1M2FA 3WWCA 5G4KA 1IMOA 2RB5A 3L5KA 3MK31 3PHBE 5TV2A 5A2QA 3DEZA 3E84A 1XPJA 1GRQA 4B34A 5T5QA 4GL2A 3SBEA 1T10A 2EFJA 4Q3LA 2QG4A 1DDGA 1D9ZA 3KT8A 3LWNA 5KSOA 1J5XA 4DEVA 5ITSA 3I05A 4WFIA 3TD2A 1PDOA 5K4HA 3O2SB 3F67A 3A9UA 1E0KA 4MUJA 3KL2A 3RK0A 3L4BA 2BJHA 2RK4A 1ITZA 1TEVA 3AHEA 3PXBA 3RTGA 2OXRA 2PSDA 2BY4A 1QWOA 1LDGA 2REBA 5EHIA 2W2MA 3BL5A 4RHXA 4R1QA 3B2EA 1V4VA 1NXTA 1S1MA 4FYMA 3AHDA 4YONB 1CQXA 5LA6B 1Z8HA 2C2WA 3K0FB 5ALRA 3SS8A 3JZMA 3FJOA 3YASA 4NG5A 3JRXA 2VOJA 1IY9A 1F5NA 3JD4A 4OD0A 5LQJA 3K0CA 4IEFB 4IRUB 2ATIA 2E3JA 5AI4A 3L4KA 4CQLA 1WUJS 1TZJA 4DUGD 3R7NA 1H94A 1CERA 5CXXA 1U8FO 3C14C 3R6WA 1VLZA 1XMJA 3DEIA 4N1AA 3ER6A 3THXA 1F4PA 5EQTA 2VHEA 3TS1A 4JOBA 3LTNC 1QG4A 1D03A 2EWMA 2IIPA 2WA2A 2V7TA 3H4MA 5IAEA 3U48A 2WU8A 1UINA 3EGIA 4GXQA 1UQUA 3OZXA 5HW0A 4QT4A 1DXOA 4CIAA 4Z4IA 1J42A 2CNNA 1FLDA 3HGMA 1XQVA 1CB7A 1KIMA 2DFDA 3IMEA 3VSAA 3E27A 1OX4A 2B8NA 2FWPA 1U8ZA 5FHQA 1JMVA 3ZD8A 3W2FA 1D2NA 2UVPA 3GV0A 3WIBA 3DBRA 2XYHA 3IOYA 2P0AA 4C21A 2UXCB 1P74A 3DHNA 1U28C 4IIXA 4M8NE 5B64A 1PYGA 1RBZA 4P5DA 3B9QA 3FCOA 3H9EO 1ZLXA 3INNA 1NFFA 1C2TA 1L4FA 1ZHFA 4HDNB 4ZIRA 5JUWA 1W8DA 3GZ4A 5JD3A 3ZNQA 3ROGA 1L8AA 1FY2A 2E1PA 4LQCA 2OLEA 2ECOA 1JNYA 2VK1A 4R41A 3FZQA 1HTBA 4UCQA 5F76A 1IEXA 4GPTA 4M9ZA 1FFEA 5FPYA 2N46A 1E2FA 3EZ9A 3FFWA 3WZLA 2XW6A 1B6TA 2HREA 4ZI5A 1E61A 4BQOA 1H69A 2HHLA 4QC2A 2J3JA 3PE6A 2BWJA 2P40A 4G3XA 4LYJA 1JIVA 4MUIA 2QL6A 5K3BA 1BDJA 1J20A 2LUOA 1ESEA 4U02A 4BMSA 4DRXB 3DNFA 4C2AA 3RC1A 2BFDB 3ASYA 3LUBA 3AP2A 4QTUB 4WZBE 1AQ6A 2PQ2A 3E70C 5E4FA 3VJMA 3SBXA 1Q14A 5KX5A 4OQLA 1J2UA 2BSQA 3AF2A 1PW7A 1EFUA 4AY5A 5IDWA 1U2DC 2YWFA 4GZ5A 4I36A 4MAAA 5EMLA 4D42A 2JAWA 4WN9A 2ZRGA 3VNBA 2PJUA 3IIKA 2P4UA 1Z6ZA 2PUVA 2HC9A 3U3RA 1FRVA 2CJXA 5A7HA 5SY6A 3PC7A 2R87A 1CUAA 3ODPA 5D3MA 3P26A 1EE9A 3IS3A 4DG9A 3IEMA 2Z95A 1K8YB 4GM4A 4RD2A 3DAGA 1QRUA 1PQWA 5EMHA 3IIJA 4RDXA 1IVYA 1H2WA 4M1QA 4MVJA 2GN8A 1X1SA 1WL8A 3IEXA 1UBRS 4PLYA 2JFOA 3MTBA 3QIVA 4EUHA 3A58B 1CDZA 4E2FA 1SBTA 2GR9A 2GPNA 3DBHA 4EA7A 5BWNA 4XCQA 5ICGA 3FZEA 1A8IA 1R88A 3AY0A 5CLHA 1BXRB 4UULA 5AO9A 4KQ6A 2WMOB 3FGZA 5KJ6A 1F8XA 3R4CA 4FBGA 4MVYA 2QRMA 1CTQA 3CZ9A 3L79A 3DC2A 4MWBA 4C7MA 2D0PB 3IBCA 3DC7A 5FWXA 2CE7A 3PKIA 4YIKA 4DA8A 3RVJA 1GU7A 4N9QA 3SXJA 4A4DA 2X1VA 2IK8A 3HLYA 1IM2A 1K2WA 4Q3DA 3IYLW 4TLEA 1XIVA 3HDHA 1L7PA 3DJYA 4G9EA 4IBOA 2XXJA 3FN4A 2ZKIA 3ZCQA 5BUSA 1XRNA 4A5OA 1P7CA 1AVTA 1UZUA 4EG0A 5IPFA 3DDWA 5HZMA 1Z25A 3K0AA 2ONJA 2WIGA 3TTWA 3U4CA 4M7PA 5I3ZA 4TTTS 5IBCA 3ZHBA 2XPCA 3RVBA 5JAIA 2O8CA 3C5HA 2BBWA 4N8EA 4E51A 4ZVOA 5K0EA 4GYKA 3DVAB 3H83A 4ZWNA 4GG1A 4IDPA 3GT3A 4DT1A 1D4ZA 3B7PA 2F9MA 5GV7A 2HN9A 3I37X 3QNMA 5FUBA 3HEMA 3V4LA 4ETMA 1SXJB 3M5PA 4PX3A 1PSZA 2V4UA 1XWWA 4M76B 3W3ZB 2PUEA 1NUPA 3PQ5A 1JDNA 3UXYA 4QREA 1U65A 1N6LA 3LQKA 5MDHA 2X19A 3K6JA 4P7KA 1CRWG 1WPRA 1IHOA 1TB4A 5AJHA 1JKXA 1UFVA 1UOEA 2IPXA 3A6GA 2HY7A 3KLMX 4MA5A 3KXLA 2PZJA 3PJEA 1N9ZA 4CKWA 5BN4A 4KE7A 5KJFA 2VSQA 5MFZA 3UMFA 3G7SA 4NE2A 1PFWA 4UTZA 2M6KA 4JC0A 3QVSA 2JFYA 1K9SA 3P9QA 4OJKA 3O82A 1UJNA 5F2EA