4GR5A

Crystal structure of slgn1deltaasub in complex with ampcpp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
463
structure length
451
Chain Sequence
SNPFEEYDGGHVVLTDALGRHSLWPAGIAVPAGWSVRHGTDSREGCLAHIEHHWTDLRPTRAPAGACVHELFEAQAARAPDAVALLHEADELTYGALNERANRLAHRLVGLGVAPGTLVGVHLERGFDMVVALLAVLKAGGGYTMLDPQFPVERLALSLEDTGAPLLVTSRPLSGRLTGTTTLYVEDAGNLATGVGPEDVACVMFTSGSTGRPKGVMSPHRALTGTYLGQDYAGFGPDEVFLQCSPVSWDAFGLELFGALLFGARCVLQSGQNPDPLEIGELVARHGVTMLQLSASLFNFLVDEVPEAFEGVRYAITGGEPASVPHVAKARRDHPALRLGNGYGPAESMGFTTHHAVVAGDLSGTALPIGVPLAGKRAYVLDDDLKPAANGALGELYVAGAGLAHGYVSRPALTAERFVADPFAGPGGERMYRTGDLARRRADGVLEYVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Non-ribosomal peptide synthetase
publication title Structural Basis of the Interaction of MbtH-like Proteins, Putative Regulators of Nonribosomal Peptide Biosynthesis, with Adenylating Enzymes.
pubmed doi rcsb
source organism Streptomyces lydicus
total genus 145
structure length 451
sequence length 463
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF03621 MbtH MbtH-like protein
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gr5A02
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 4gr5A01
2Y27A 5BSUA 5BSVA 3WV4A 4G37A 4OXIA 4FUQA 3IEPA 3O83A 3T5BA 3DHVA 3ETCA 3TSYA 4WV3A 5BUQA 3NYQA 5KEIA 4M46A 3C5EA 4LGCA 5BSTA 3E53A 3DAYA 4GR5A 4R1MA 4RVNA 1ULTA 4GS5A 4D4GA 2MYYA 2V7BA 3T5AA 2GPFA 2VZEA 3RIXA 4W8OA 4DG9A 4E5DA 4GR4A 3VNSA 4D4IA 5JA1B 3U17A 2Y4NA 3U16A 4R1LA 3IPLA 4RVOA 3G7SA 5DWVA 3FCEA 4D57A 3WV5A 2KHRA 4R0MA 1V25A 3NYRA 3WVNA 5BURA 2WD9A 5BSMA 3E7WA 2PSTX 3PBKA 5BSRA 3IERA 3T5CA 4D4HA 5BSWA 4ISBA 1GH9A 3EQ6A 3VNQA 3O82A 5E7QA 3R44A 3VNRA 5GTDA 3L8CA 4GXQA 3IESA 3LGXA 5BUSA 1V26A 3GPCA 4D56A 2Y4OA 4GXRA 4DG8A 4PZPA 4IZ6A 3A9VA 5D6NA 4FUTA 3O84A 3NI2A 3QYAA 3RG2A 3IVRA 3FCCA 3E7XA 3B7WA 3ITEA 4IR7A
chains in the Genus database with same CATH superfamily
4CQMA 4LV8B 4HDSA 4PY2A 4J2HA 2R6ZA 5HK8A 4AS1A 2FEWB 3PT9A 2F3SA 4QQNA 2J0SA 1V6SA 3V7YA 5HMLA 3IEPA 3LZDA 5CDSA 2YDXA 4FT2A 4K9QA 3TGPA 2DLNA 5A4MS 4YS6A 3N70A 1A8UA 4NPHA 4FM9A 3UXEA 1HMPA 1CJTC 4WV3A 4RQBA 1PK8A 4RO0A 2BCJQ 2VJPA 2JHCA 5EHGA 4DJTA 4Z6KA 3PHHA 2BHRA 3F6CA 2J3MA 3PXCX 4QICA 1KIMA 2ECQA 2RCNA 2QP3A 4X95A 3WYAA 2JCSA 2ECKA 3W1VA 4CFSA 1O0SA 3KVOA 1ONBA 4Z8YA 1YZTA 1V48A 2NO5A 3HJRA 2ZTSA 2CFIA 4ESHA 4X1KB 3E84A 4B32A 4MDFA 5JS1A 4ZT6A 3OEYA 1H85A 1QB8A 5B4TA 3VPAA 1D0IA 4D4KA 1PZFA 1TUBA 5TX7A 4MJ3A 1NZFA 3ECSA 4I46A 3LYUA 1EA7A 1VHLA 3ZWXA 4L28A 3MLEA 4J1NA 3TTYA 5AW8A 1ZICA 5NLLA 1L7OA 1JJVA 2YBEA 1QFJA 2R97A 2ZK7A 4FKZA 4RXMA 5KAPA 5KC9A 2EBWA 1AMNA 1NI5A 2XD9A 4OLHA 3ZX5A 1GTG1 1C29B 5CVUA 2BEJA 2PMBA 4N5IX 2FOXA 3IKLA 2O50A 3IULA 1W0JA 4PM4A 1STOA 2J5XA 4XPIB 2OY0A 1JTVA 3EFEA 1E5DA 4GW3A 1O58A 1AN0A 3AY7A 4G0UA 1I32A 1LPMA 2VPTA 5ER9A 5LU9A 2BMDA 3BIFA 5LOVA 1CHDA 2WTXA 2CT8A 1OH8A 3CEHA 1RD4A 2DTEA 4B4KA 1YBAA 2EIXA 1L5VA 3H1TA 1ANKA 4KAXA 1P5JA 4J6EA 3EODA 4LYFA 4NHOA 2O19A 1J2EA 5K8IA 1G18A 1TU3A 3CWZA 1OFIA 4RSRA 1M1YB 1Q7RA 4IIBA 1E6KA 4G86A 3GFTA 3E27A 3IERA 1IATA 4DC9A 5CCEA 1A9XB 5HGXA 5IK2D 2IBTA 3EH1A 1DX4A 1Q1ZA 1HGXA 3LZCA 1ZJJA 2BKLA 3KEGA 4P9NA 5FL7A 1EAYA 5HE8A 4ZJYA 1KFEB 1TK9A 3ETEA 1VG1A 1LPSA 1WUJS 2MR5A 3WLFA 1N25A 4W4TA 1RXEA 1X7ZA 5KWJA 1PNVA 4TS1A 3E9CA 4GVXA 1A5TA 4DIEA 3WO0A 3I2IA 1D2AA 2ZIWB 1UOEA 3C3JA 4BPRA 4ZV7A 3EXIA 4Z1OA 3KSZO 4R8VA 2Q29A 4YRZA 1RHUA 2Q3JA 2QJTA 3GNSA 1EFAA 3A05A 4B0OA 2DPLA 1P29A 5BW8A 1CJCA 2ATIA 5J40A 2BDEA 2CUNA 5TV2A 2G4VA 1SA0A 4UVEA 1B2LA 1VKHA 2XVZA 4LC1A 5BP7A 1OXVA 1UMDA 3FM9A 1E32A 4MVCA 3BTOA 1AMOA 2HK9A 1IAVA 2J9GA 3G0IA 4JUAA 2XUKA 1KBQA 1GKUB 1XD2A 1ZH8A 2Z2KA 3C45A 3DPIA 4CKEA 1PR2A 3LP8A 4Z4HA 2EKDA 5EHQA 1EI9A 5IXJA 4I1YA 4W8GA 1SCAA 4LMRA 5FEUA 2BGRA 4NSNA 2B4QA 4I1VA 2XE6A 3FIJA 4H6WA 4Q1CA 3OQ1A 5AKLA 1U0NA 1G98A 2A0UA 2ZAGA 3F97A 4JWKA 4WBSA 3L7OA 3O8BA 2X1VA 3TXXA 4YRCA 2GAAA 2DECA 3ZD6A 2MMGA 4XDYA 2ATEA 2NM0A 1RADA 4A36A 4LYYA 4C6TA 1XYYA 4EEKA 9LDBA 2Q5OA 4RZIA 1NHWA 4RPCA 2IGBA 1GLGA 4H7KA 4KODA 5DISB 3QE9Y 3VR4A 2XNKA 2ZSAA 3DOEA 3CG0A 4LHZA 4HHEA 3WB9A 2ONJA 2LW7A 3KJNA 1OJ7A 5G0UA 3FWHA 4QFCA 3CF4A 4AZ0B 4UM7A 4RFSB 5B1IA 1K7CA 1MB2A 1P6QA 2JFFA 1P39A 2VTVA 3FGPA 3SZMA 4YV1A 3WGUA 1XVAA 1E7WA 1V4VA 3ZWQA 3SQDA 2I6UA 4LY3A 4LRWA 4NMLA 2Y92A 4NBLA 1Y7LA 5TGTA 2OPHA 5C7OO 2V96A 1OLUB 2V54A 3D3QA 3GRVA 2OD7A 4LX0A 2PUTA 4N7JA 1TT5B 3PPXA 4HNAA 2BCGY 2G0AA 3DB2A 4BASA 2J08A 1P80A 2W4IA 5HGJA 2AOTB 1DTWA 2IXDA 2XCIA 3FWPA 2YRFA 3WE7A 3VNSA 3Q6IA 5AW5A 4NH4A 5HM6A 2ZWOA 5FWYB 4CF5A 4YAFA 1TX4B 4BFXA 4HTAA 4EYGA 2XVMA 4NAVA 4TV8A 1SCBA 2VYND 1PX2A 2DBRA 3DZCA 1FS5A 2UVPA 4PYIA 3K0AA 5CNIA 3LX6A 2N0SA 1VP3A 2QX8A 3VC3A 1BW9A 1QH8A 3KFLA 3NTRA 2XWPA 4ER3A 1HWYA 4K6CA 3IUNA 5FOTA 5F33A 1QYIA 3U09A 1I6MA 4AZWA 3ZWVA 1CY0A 1F9EA 1ECCA 2W6MA 3R4CA 1RXUA 3N86A 3AQIA 1BHSA 4J9VA 2E4YA 2HAEA 5DWDA 4CFZA 1YDGA 5F12A 1YJ5A 3BE4A 1PT9A 3NGLA 2RHHA 3OOHA 3BWVA 4QYXA 2HQ1A 3K05A 2QZ9A 1AHHA 5DNWA 3HSYA 4L8LA 5I9NA 1JFFA 4UAGA 2VP3A 4KUGA 2B0JA 2BV3A 3LL7A 2CLKB 4INOA 4HJRA 1KO4A 3ZYCA 3EG9A 3VSBA 1HEYA 2NQTA 2G09A 4FDLA 4DJEC 2V0NA 3TOZA 3Q6MA 3V4SA 4CE6A 1OFUA 1SQ0A 1JA0A 4LFBB 4AKIA 4ZVSA 1QQTA 4Z51A 1FMLA 2GZRA 3TAXA 2IUUA 5KTOA 5K03A 1RR6A 5BMVA 3O03A 4EA8A 1MRSA 1BDBA 3P2JA 1Y4UA 2V5AA 3OUTA 5DOZA 1U7WA 3GUCA 1CE8B 3CUWA 3BGOS 5ALGA 5IAGA 3VVBA 2QRGA 2IT1A 2ZSFA 1GT91 5T57A 5F7XA 5CD1A 5DM2A 1QCCA 4DT1A 3MJVA 1IOZA 1DKUA 1QVWA 5ERGB 1O77A 4OHXA 1JLKA 2QM8A 1RLUA 3DBLA 4BO3A 2C04A 3OSUA 4R7GA 1L1EA 4AL4A 1FFYA 2A5GA 3RYCB 2GCIA 3NETA 1QZZA 3UFXA 3W06A 2NV6A 1ESEA 3TI7A 3WWYA 1JHUA 1CERA 2CJWA 2H7VA 1I33A 1ZNXA 2HGSA 3COVA 4L0CA 4BTEA 5LNK1 4UC0A 1CQJA 3PGMA 2PHZA 3R9WA 2PS0A 4JK3A 3PJDA 1DBWA 1E8DA 2QVGA 3G5MA 1KY5A 1R50A 2H92A 2I7DA 1FUEA 5JAQA 1HY3A 2JHGA 3PXXA 2HR1A 3W4KA 1TO2E 4B33A 3RK0A 3VO8A 1PD0A 3C8UA 5INTA 1YC2A 2O2IA 1RPZA 1X7WA 1GEGA 2ZJ3A 3MS4A 2V3WA 3FMOB 1BIFA 1MHPA 3S1AB 3ABIA 3QVGB 4EHIA 2HPHA 1HSZA 1VSUA 2Q3CA 2J0VA 3IJEB 5JJCA 1NUAA 1CUFA 2FJ0A 2X2PA 3ECAA 3NBAA 2BFEA 4Y6QA 1TGYA 1DE0A 3M4JA 1KEEA 3E2PA 4WVLA 5AMXA 5FAKA 3ZJUA 2KS6A 2P69A 2Q27A 1XU4A 4E5YA 5KOJB 4QDZA 5DMHA 1ZLXA 2WM2A 1NOIA 3ZOKA 4NDZA 4Q7EA 2Z30A 3L05A 4KR7A 2R1ZA 2ZE8A 5AUQA 4O4LB 4WFQA 3KKEA 4AJ1A 5SZHB 4Z54A 1ZDMA 1AG9A 2BGKA 2JIDA 2OC4A 3KYJB 1NKVA 4RJJA 2XZLA 2QRMA 3BE5A 4MXDA 1H94A 4OFXA 2FCAA 1DWQA 4GS5A 1AB6A 1X3SA 2E4ZA 3C15C 3R09A 3HUUA 5CBKA 1TLTA 3HKEB 4U2KA 5E1DA 5E6RA 2ZJZA 4PPNA 4RA6B 3I9OA 1P62B 4CDRA 1P77A 3BHJA 1K86A 3TNDA 3ETHA 1T5TA 5JJIA 1TZJA 3O3OB 3ZUGA 4B7XA 1FDRA 3PTAA 3GF4A 3RFTA 2WF9A 2Y4NA 1THZA 5D1HA 3WGQA 5KJ1A 5GM1A 1VFPA 3DVRX 4ZAVA 4C9BA 2XWSA 2O7SA 2PX4A 2ZSUA 1JKXA 3NUQA 3RYTC 5COAA 1YDMA 1N5JA 1MW8X 2BSQA 4DREA 4Z4FA 1N1DA 2I2WA 4P32A 1RQNA 3IJ5A 5TVKA 1EIZA 1NP6A 2XHZA 1JYEA 4A6XA 2FWNA 3TJZA 4P58A 1IDOA 3AYZB 3ND6A 1H0RA 1C41A 3OHMA 1W96A 5CUQA 3S3TA 5JXWA 1JEDA 4I8XA 5JRJA 1RZRA 1I1QB 1UCFA 4IMIB 4RF4A 2YC2C 4DLUA 3OPVA 1KSGA 5C1PA 621PA 4RIGA 5F78A 4A2CA 4OPMA 1BXZA 3AM4A 4QT0A 5J2TB 3SKVA 1E2PA 2NUPB 3HRIA 4PNEA 1B26A 2JNWA 3SGLA 4B45A 3FPEA 4BNGA 3RSGA 1SXJC 2RAUA 3QLUA 4G8JA 2PUVA 4CMEA 4P34A 1JIIA 2PT7A 2VJMA 1XRJA 3QUAA 4ZK2A 5F2KA 3GFFA 3AUJB 3AZQA 3UK6A 1XWIA 4RHEA 5NULA 3I39X 4OI4A 1S4QA 3RE1A 3MWKA 4H77A 3K6SA 2YV4A 5DU2A 3DM5A 4M0PA 3AVWA 3BWXA 5CA1F 1X80A 3DGEC 1Z9BA 4JL5A 1OF1A 3FTCA 2V0CA 3P45A 4NYJQ 4PC6A 4OUDB 1Q57A 2C83A 3KSMA 2E5WA 4X7MA 5BXQC 3B9RA 3ZWMA 4LFAB 4ZEOA 1NC3A 4H1VA 3EW9A 3SJUA 3W04A 1A72A 1UBEA 1Z8FA 2AFIA 3MELA 3GDHA 4DRXA 1ONPA 2DU8A 2QXUA 3IEXA 1ZR4A 2ZUWA 4IM7A 3AR4A 4N1AA 1SOAA 3WMXA 2ASVA 1GA6A 4KN9S 3DMRA 1GADO 5L51A 5LQNA 4YRFA 1CV2A 4BLOA 2C2MA 1QIMA 2BMJA 2WD7B 4KI0A 2P40A 1BVHA 1TADA 1JGTA 3P7MA 3JVUA 5LQJA 1X7XA 2IE8A 2XRFA 3OT1A 3OQHA 4HZIA 3I5MA 3HA3A 4ZIRB 5JQWA 1AZLA 1BU8A 1DOAA 2Q49A 5JMPA 2QQFA 2VKTA 3HY3A 4O59O 4YAEA 5GONF 4DNXA 3C7TA 3F0TA 1O6CA 3N7TA 2XLCA 2Z4SA 4X93A 9ABPA 2YL2A 4ENUA 3GUZA 1EK5A 2ZRIA 5BYAA 2I6SA 2WYOA 5DBHX 3T3EA 5ALLA 1WEHA 1BEUB 4AJPA 1N6HA 2F4VB 3L92A 3B3JA 2BMEA 4G1CA 1IN4A 4UQOA 5M04A 5ANRB 3RRJA 1QQAA 2J9ZB 2O5EA 13PKA 1EKXA 2QTFA 3PWSA 4Q02A 3UC9A 5AQEA 4D4GA 1N36B 1SIWA 3RFCA 1JB1A 2II6A 3N7UA 4PSVA 2HDHA 3EC2A 4IMJB 2VZEA 2ZDGA 2P35A 1MAAA 1N2CE 4MHSA 2VWHA 4YJKA 1ADFA 1JQLB 2GAFA 2X14A 5BRJA 3TNLA 1GJRA 1U8CB 4YRPA 1NVVQ 4P22A 4UARA 3UXHA 3JYPA 1P61B 1QHGA 3T3GA 5IKXA 5KYKA 3MIIA 4K03A 1FE8A 3M4NA 4ZV4A 4PICA 5CIQA 5BYKA 5BWCA 5IU6A 1WJGA 3GFGA 3U7JA 1NDQA 1T9BA 3G79A 1OGYA 1P73A 1Z6AA 2CFSA 3DFUA 3LF1A 3VPFA 3ZK7A 4B6JA 1PX0A 3GJSA 1U94A 4B3DA 1D9XA 1J56A 3KYIB 3FUWA 4JA0A 2V97A 1FP1D 1FRVA 1TUGA 3HLTA 4FX2A 3ZCRA 2CWWA 2PZBA 4Y2XA 4N82A 5ALJA 4KQXA 1DOZA 4UNIA 4ZPXA 4JYAB 2J3HA 4RL6A 4QASA 3DLHA 2IZ1A 1HE2A 2PR2A 3IP1A 4Q66C 1XDDA 2X4LA 4N03A 4YMSA 4B3CA 3QU4A 4P5PA 4LZAA 2HSDA 1DQNA 4D4HA 3NAZA 1RMYA 2CVOA 3BC1A 1OSNA 1F48A 2WSSD 3Q40A 4QGAA 4M9RA 3WNDA 1UFOA 2R6AA 1AGPA 1HOXA 1YU9A 4RA9A 1ULBA 4KVGA 1KETA 4BX3A 2FZEA 3A2KA 3DQZA 4BVGA 1Z6ZA 2I2BA 3HGTA 3QOWA 1D4ZA 2JVIA 2W6ID 1PGNA 3NV7A 3GPCA 4GM1A 3WFIA 2HWWA 4B17A 4YPOA 1J21A 2B36A 2H11A 2J33A 4R54A 2V5VA 3CSUA 3I37X 3MSXA 3TZLA 3TSAA 3EOBI 3D6MA 4Z4EA 4NDNE 4ENRA 2FWAA 5IARA 3SWWA 3M34A 5F5LA 2G06A 3ONFA 5ES4B 2DERA 4W1SA 2OV1A 2PUCA 4FHEA 2DH5A 4GZ6A 1DWPA 2RB4A 3AVXA 2WC1A 1NF2A 2O8DA 3FETA 1N2OA 3IJPA 1PBTA 3V1LA 4N65A 4E11A 3Q87B 4I4TF 4CKZA 3GT4A 2W42A 4F72A 3EGIA 1Q91A 1IPFA 1JECA 2VRCD 1E20A 4OJQA 4TVOA 3R40A 1LBSA 3L9WA 4BUJA 1U6KA 1CIJA 2X5NA 2JIPA 1SBHA 1J0BA 2I62A 3KUKA 3DLBA 5CLGA 3IMFA 3LHIA 1P7YA 3D5TA 4R01A 4WI1A 3KOWA 4MR9B 4NS4A 2WTNA 3EULA 1WSBA 1C3OB 4RPJA 4BGVA 1V6AA 3D4OA 4NF2A 1TVCA 1N2XA 1H2FA 3BOSA 3OBIA 4AJ2A 4DBLC 2VHUA 4MA0A 5EY5B 1QIFA 1XLUA 5DO9A 5ALPA 1F4VA 2WIGA 3EW7A 3KHSA 1DPFA 4PZDA 4DM3A 3UYKA 2WQ6A 1KMIY 1NG1A 1IMOA 2Q0QA 4WOBA 2FP4A 1FFHA 1E64A 5B7GA 1PE0A 2J4DA 1N6NA 4PONA 1PNOA 4E3WA 4B8YA 2G4LA 3AFNA 3DAYA 3HWX1 2PAFA 2PL3A 4YGYA 3RV3A 5CEEA 2MCFA 2F9MA 3HJCA 4L02A 3JAWA 5LQRA 1G20B 4R41A 1QGDA 3O1IC 5GIPE 2WEKA 3KZNA 4RQUA 1H2XA 2R25B 2WDPA 4JBWA 2NU9B 1MRZA 5J58A 4YH1A 1Z3IX 3TMAA 4EMUA 3ILVA 1XP5A 2ZYGA 5SV2A 2HMAA 2W6OA 4R2WA 1S01A 5DMXA 1CDZA 1VKJA 3A4LA 4FZJA 4IHAA 4E5VA 4C7OA 5LZ4A 5KSPA 2PQMA 3P52A 2IYFA 2ZG6A 4G1UC 4X84A 4XDHA 5ALFA 3VPGA 4KNYA 1QV6A 1SK8A 5CYFA 1W85A 4ECEA 4G4SP 4CQLB 1U8AA 4L2IB 4IKPA 2M6SA 4CWAA 1QTNA 3OX1A 4CQMB 4HDSB 2GVZC 3JQ7A 3FJYA 2PA0A 3UHAA 1EDZA 2HSGA 1LU9A 2YXPX 3ANNA 1YJQA 2EYQA 3ENWA 2PX6A 2P1DA 1FP2A 3QFCA 3UMYA 1UBJS 3L9XA 3M1LA 2X8WA 1G3QA 2EHJA 2FZWA 2E7ZA 2DULA 2LDXA 2WKSA 4KLCA 3ADBA 1SC9A 2B8EA 2BTOA 2ZWPA 1NMQA 3DT9A 4NBUA 4GGMX 4OJYA 4YO8A 5KNBD 4AI6A 1T4DA 1LFDB 3MBKA 1D6NA 1M6HA 3P9NA 4DKXA 5BN5A 5TS2A 3KUUA 3DKVA 1UP7A 2RGUA 4PNHA 4YLGA 1YRBA 4LK3A 1Q83A 1L4LA 3P20A 4MPTA 1BS1A 2XB2A 4TWRA 1XD8A 1ZD3A 2GARA 3H4MA 4HQFA 4N12A 5COQA 4UCXA 3U62A 1OY1A 1YQUA 2AOXA 1RQ2A 3KDSE 4JGGA 4WA8A 1V9SA 3E8XA 3M6AA 4WY8A 3T1OA 2GSDA 2B1RA 4BAZA 4N6NA 3SVZA 4BP8A 4N18A 3QFSA 2BE9A 2JJ2D 3KAJA 2PPVA 3D3EA 1GIAA 3GMIA 1DIAA 4GXRA 1T8SA 3DEZA 3PICA 1ZVMA 1RMTA 2G88A 5EUCA 5FPHA 4ZD6A 1BFKA 2C8LA 2SKCA 1LTQA 1E2MA 3TF5A 4DR1B 2F43A 4QBGB 3H99A 1K6JA 3TRIA 3SHVA 5LR6A 5FYQA 3DFMA 3PENA 1G7SA 4OXRA 5U4XA 3FDZA 3VTKA 5AVUA 3L0IB 5DV9A 3NUGA 3NVMB 4HH0A 4HNGA 4UKDA 1ML3A 3E3OA 2HF9A 3CLSC 1Z8DA 3F3MA 4L6AA 5LOVB 2D2XA 2PVPA 6AT1A 3GBSA 5ADVA 4M0EA 3KPJA 3L4KA 3HCWA 4MWEA 1KO7A 1OI2A 3GU3A 4B3SB 2A30A 1G8JA 2HLPA 4QJ5A 1HDOA 2I4NA 4NCXA 4TLMB 2PM8A 1JXQA 3MS7A 3NQ41 3S68A 3FSEA 4UE3S 3F78A 2Z83A 4QOEA 2F3RA 5BSGA 1SQFA 3Q2OA 4TKZA 1YZ3A 1LK7A 3GARA 3ZV5A 4DRYA 4YRSA 5ITZA 4P7FA 1I3KA 2CXQA 3V8BA 2POQX 1ZBQA 2IRWA 2PV7A 3HDGA 3M8KA 4NOMA 2O0HA 2OZLA 1FUUA 1DQZA 3B2QA 3D6UA 3N5KA 4GMXA 4W63A 1Y1TA 4BE7B 3VNAA 1UM9A 2FSFA 3NYQA 3L82B 4LRSB 1OLOA 5A0VA 2IUYA 2GERA 2ZW9A 1X7ZB 2PL1A 5KNDA 2J59A 4FGSA 4W1RA 1QBGA 2WWHA 4GLLA 2A9JA 2GYWA 2RGAA 1AQIA 2H1FA 3EXIB 5HX7A 1IPEA 5I8ZA 1LVUA 1UANA 2I33A 4I6JA 1OROA 4NNOA 4AJEA 1ONOA 4MO2A 4V0OA 1VSQA 1L8XA 5IG2A 4J2TA 2RARA 1BJRE 2DC1A 3M3DA 5JMWA 1XF1A 4GUDA 4KMMA 4CG0A 2J30A 1NF3A 1SA0B 3QIVA 3LE8A 1FDWA 1UMDB 1NLFA 2YNMD 2QYSA 1Y3AA 1G5HA 1XQ9A 1FNDA 1JV2B 4BCBA 1UIRA 4D9MA 2A94A 2EOAA 1BE8A 3RTCA 1ZGGA 1XD2B 3LH5A 4IG9A 4CKEB 2AFHA 2JDID 2QVBA 3G1UA 2QLFA 2FFHA 1S7GA 1KDRA 2HLHA 3BZBA 3COWA 3KWLA 3Q7PA 3L6OO 4QYIA 4DZZA 4B9AA 1GQOA 4L4RA 1VZ2A 4BS9A 4QFMA 2AYXA 3IAM1 4K9NA 1XKXA 3AG6A 5KNCD 4W5RA 1GEEA 3AB8A 3V4FA 1BWRA 1E6CA 2JIRA 4GPZA 2G08A 4NG5A 1BA3A 3VR5A 4C6TB 3N0VA 1G1AA 2WZCA 7MHTA 3JTMA 5IJ9B 1XXLA 2NSJA 4FGWA 1IK4A 2P1ZA 2BFDA 2GO1A 3HDQA 3VOSA 4EHHA 2OQVA 1SBIA 2A3NA 3W6ZA 3T6KA 4Z2AA 3HB7A 1JJAA 2FX2A 4BPBA 2I2DA 3LF2A 3TIIA 1D4OA 3F6RA 3LC2O 4OEHA 5LLDA 1TF2A 3KE8A 2PU7A 2XDQA 5AHKA 3PLAE 1MD9A 4IILA 1V3QE 5ALUA 1UBUS 4DCGA 1OTHA 4EKGA 4ZV9A 1DAMA 1PZGA 3WISA 3D1LA 4MQMA 5ESXA 1XPRA 4H18A 3WIVA 3WIOA 2ORYA 4RXTA 4U0JA 3O47A 5A9SB 2PBLA 3FLEA 4MUMA 1SOWA 2H57A 5BNFA 3EK2A 3CLKA 3KWMA 4MH0R 1HZZC 3ABSB 3AC0A 4KK3A 3GGOA 4MW6A 4UFNA 2AW3A 2JLXA 1DTWB 3H8WA 1RQLA 1V2HE 1FUYB 4W6QA 4MK4A 4X5OA 2WZQA 2JKYA 4E0BA 4OY3A 1CRPA 4R1OA 4D02A 3MZ0A 5IC4A 2AW5A 1EB8A 1XZIA 1W52X 2WUEA 4JP5A 3AHIA 4TV8B 5G4KA 3HMQA 2G6TA 3D8NA 3LT5A 3WL4A 4AP5A 4C4SA 3GW8A 2AXQA 3EF3A 1BW9B 1QHYA 1QH8B 3TNJA 4ZI3A 2NG1A 3OQJA 5BY2A 1OD6A 2RGDA 2AK3A 2A78A 4DANA 2IUEA 1VOTA 1C7RA 1CYDA 3DMGA 2BGWA 1QQ6A 2VF4X 2WKPA 4G0QA 3OQIA 2BMVA 5EERA 4C2BA 2H9AA 4LF7B 2W83A 3HL0A 4IOKA 5LA6A 1PKXA 3U80A 4C4PA 4FFDA 3S2IA 5MFPA 4XLLA 1JFFB 5IRCD 4TRNA 3T1VA 1D5WA 2C29D 1ZVKA 4X0EA 1YUMA 3M4ZA 3EG9B 3O91A 3JX9A 4G9GA 4ZYUA 3U81A 4O4HA 4CMAA 2XSZA 2DBZA 1QCYA 1G8PA 2M2IA 4G97A 4XVRA 4RXUA 5BNWA 4GFDA 1A4RA 1YAJA 1M3SA 2O1XA 3PZRA 4KWIA 3LQFA 4LDPA 3AKZA 3E35A 5BMVB 1Z16A 4FYHA 2X0FA 1VI6A 4Q82A 2ZIZA 3DYIA 5CDGA 5TPZD 3EGWA 4EVQA 3HL4A 2XNDD 3A9UA 3HY6A 4U2EA 3KOXA 4A9AA 3VTAA 3ADDA 4MAAA 1PT8A 4P4SA 3SIRA 1L8OA 1RWPA 4QHSA 4WN3A 2I9KA 2RH8A 2IYUA 2OO5A 4KIGA 5LNK6 3H2ZA 1BYUA 3NJRA 4LJRA 3NHBA 4LJ8A 5IW8A 5BYJA 4C0SA 3AUUA 1W48A 1Q19A 1GGFA 4IP0A 4FSHA 3WMRA 3UFXB 3BHNA 1PJCA 2OBXA 2P68A 3R3ZA 6ABPA 4ZU6X 1GCIA 3FDIA 4QTUB 1XTQA 1CQJB 2YCBA 3AY3A 5AM4A 3RDPA 3L1UA 1TTQB 3DTVA 1Z5ZA 4KXWA 2C03A 3M5CA 2YMPA 4YXWA 4Z7NB 4RVOA 5AOVA 1XTRA 3I01M 1OTYA 4BHTA 1H2HA 1MJFA 2RGYA 1UXKA 4C3VA 2BFNA 4HS4A 2CZCA 2Q1UA 4Y9UA 5ALYA 3WO1A 5K8TA 5C18A 3AHEA 2EEZA 3C4QA 3EA4A 1N1GA 4K2HA 4K9SA 1YKGA 1RU3A 1TYAE 5DNAA 5EIBD 3RIEA 2YYZA 4PN7A 3LOUA 5CBPA 121PA 5ICGA 5M7EA 4DLWA 4ACAA 2Z9BA 4H0NA 2BFEB 1PNRA 4JI2B 3L7YA 4ZOQI 1NN5A 4BQIA 1PWYE 4DUZB 3T1QA 5JVDA 2QD1A 3MJ4A 1J1ZA 2YN4A 1G0OA 3GGCA 1AGXA 1TAHA 2BH2A 4OM7A 1MB9A 4HEA1 1ZRMA 1R9GA 4LXUA 3HZRA 2WJHA 3LBIA 4EELA 3O90A 5F3DA 1WCXA 2OCAA 4KV7A 5KOYA 1JSXA 2B7CA 1UQUA 3RT7A 4LHSA 5T67A 4GVLA 3H1BA 4AYWA 4AD8A 1GZHB 1QP7A 3OZIA 3FVWA 1DAKA 2Z3VA 5IYZF 4Y2HA 4CCWA 1E9CA 4UM8B 5BNTA 5E6RB 3BBPA 2Q5IA 2PQ6A 2F1OA 3P19A 3FKJA 4YQYA 5FWNA 3I6ZA 4D9BA 3LJKA 2IVZA 3I5UA 1YR1A 3L6RA 5FBWB 3CJQA 1L8QA 2WYUA 3EIQA 3N58A 1AXRA 3U7QA 1IY9A 1N4DA 3GLGE 2C4KA 3FIUA 3KQPA 4JZKA 5SYAA 2X9VA 4G24A 2P9GA 4B4VA 3N53A 5LM3A 1MIHA 1DS6A 3R6GA 3BCUA 3ZY6A 4N0DA 4E88A 4EGQA 4AO7A 3TLYA 5CB4F 1VGRA 4DE5A 3I53A 1KH3A 2HZBA 4LWPA 4CQMD 1E99A 4I1RA 2HF7A 1NOKA 1J0XO 5LCXA 3WFZA 3SKXA 4PZEA 4IHKA 4E03A 4PV7A 3D6HA 2PGIA 3D4IA 1CJUC 3VTZA 4ZCRA 5J63A 821PA 1QVVA 2ENWA 4CGZA 4LSGA 2WE8A 1YTLA 3EY4A 3UB4A 1WB4A 1JXAA 1N2IA 2W2LA 2ZPTX 4TKUB 5TGDA 3K70B 4OBEA 3AU9A 3TZ6A 3U9TA 3V8VA 3EE6A 3BL8A 1Y4AE 3WK4A 1KVUA 3IHKA 1YE8A 1ZR2A 4ZQCB 3V7FA 2BM8A 5JE8A 2F1KA 3ZH9B 2OKGA 2Z1DA 4RANA 4MVJG 2IEZA 5FBHA 2LRHA 2P4QA 2FPMA 5ESWA 2VJMB 1K89A 1AURA 4LBVA 3EVAA 3KT3A 4EKIA 5A5GA 2GN8A 5JLJA 1FSGA 1FRZA 1QO9A 3E15A 3B1XA 3ANMA 3ILYA 4XSVA 4DLXA 4DTIA 5JYDA 2PYZA 4ZVPA 1R0KA 4ENQA 1USGA 4LF9B 4NCAA 3K6SB 3EVNA 1RI5A 1BMQA 4HEHA 2QZPA 5JD5A 1T5DX 2GPTA 2XMZA 4GVPA 2FFRA 4KL8S 1X80B 3QXCA 4QODA 2A5DA 1AGYA 4PZ9A 3IDQA 4X61A 1HFKA 5ALDA 4UBJA 5IABA 4LJSA 4U2FA 3QKSB 4OUKX 3VVCA 2JD2A 3LCCA 3AVVA 4Q9AA 4C4RA 3Q9UA 4LYEA 2FWIA 2VQDA 4XCVA 2QMUA 2AFIB 3ZDRA 1W0JD 1TPZA 1JDZA 4DRXB 1ZI6A 2R96A 2WUFA 3PXAA 5I9MA 4ARVA 5HIAA 1W6UA 4DIUA 2QMQA 4B1FA 1SWWA 4C0LA 1R6VA 1DOHA 5GTDA 4IXTA 2F59A 1ZMOA 4DAOA 1GKYA 1P6XA 4Q47A 3UJHA 3PD1A 4WCFA 1SC6A 8GPBA 2VDMB 4NMMA 4HWPA 1X7XB 4WNCA 4QUIA 4E2ZA 2MYUA 1MB4A 1IUNA 3CIOA 3THYA 2DR0A 2ZTVA 4DXDA 2XRMA 3WADA 5EWLA 4YLYA 3G7NA 1T8TA 2ID4A 1LNSA 2NPOA 1I14A 3GWZA 4MPPA 2WD9A 3PNKA 2W4QA 3KZ1E 3PUXA 4G1MB 1SCIA 1THGA 2LD4A 4KXQA 4NAUA 4H4CA 2VJYA 4NIMA 4GGOA 2C0QA 5H81A 2WILA 4A6EA 1TF7A 2I76A 4LOKA 4F9TA 4DLVA 1U0SY 1JNXX 2CSUA 2A2ZA 3KYBA 3M6VA 4P3XA 4PRYA 5EVJA 1ZH4A 3JWEA 3U4CA 2W58A 3PNMA 4F92B 2XIJA 1RXYA 3RI3A 4TM8A 2F1HA 2B21A 1CS4C 3O82A 4FMCF 5KI6A 1DO8A 1GPBA 1RRFA 1PR3A 2GPJA 2HIHA 4P2GA 3TZBA 4IJWA 2ZIGA 4AP9A 3PNBA 4U02A 4D80A 1KEZA 3DOCA 3U9LA 4K81B 2X7HA 1XLTC 3UY4A 4A7PA 1UPAA 1MENA 2PSDA 2FPPA 1I51A 4J9UE 1USIA 5I7RA 3GRKA 1NVWQ 3C8DA 5FJIA 4BWVA 5JQGF 2NUTB 3A2NA 4PZPA 4OHCA 1LX6A 1A9ZA 1U3VA 1MOZA 1EP3B 1Z7GA 2A9KA 2O2XA 2R3SA 2AG5A 3CNNA 1QHIA 2X8LA 4WKGA 2IUSA 3NI2A 4TYMA 4C08A 4DBLE 1WZNA 1Z82A 3MB5A 4YECA 4CCAA 4CTNA 5DSZA 4CLHA 4ZCMA 1K92A 2J8ZA 4F85A 1GQYA 2Z57A 3URMA 1TU0A 4NBVA 2H63A 3DEIA 4KQMA 4LJ4A 1OPXA 2YFYA 4ZYLA 5K0EA 2ID7A 2ZIEA 4TWIA 4DXHA 3F46A 5LXTF 3FNBA 1ENYA 1NXPA 3PEFA 1K0FA 3QKRA 4O3FA 3VR4D 3CONA 2C7QA 2H06A 1OXSC 1DQYA 2UVDA 2VBCA 4UUBA 2O8EA 3P2YA 2JC3A 3H3XA 2IU3A 5E2IA 3S4YA 1NYLA 4UOEA 4JBHA 3J7TA 3MGCA 3MERA 2QJFA 1MO6A 1QHFA 4LOIA 4TYYA 4A8JC 4NK5A 1X74A 4AF6A 1BDIA 1XZHA 4C7KA 2AC4A 3HG7A 1SD5A 1SUDA 3N2IA 5I4CA 3HK2A 4TUYF 5GPBA 3W6PA 4BY9E 3LCUA 4AS3A 2R8RA 2A1UA 2BAGA 1CFZA 3L0OA 3MJFA 4MKZA 2RC6A 5DGHA 3BK7A 1UEJA 3GFPA 4J1SA 4LOAA 2MYTA 5ETJA 3HXOA 4Q12A 4X41A 5G3YA 4DCJA 2GS9A 1PV1A 3OM1A 3IH5A 3LQ4A 2AI1A 1Z75A 3PRYA 4J75A 4CL8A 1SVMA 1TMOA 2LIPA 1GITA 3OEWA 1RIFA 5DHUA 3WYCA 5GJVC 4RD6A 3EDYA 3EIHA 4JX9A 3A0UA 4NPCA 4QOIA 1XMIA 2WYIA 3S8EA 2JJYA 4OD0A 4QPDA 4E1AA 2O8DB 1J8FA 1I4WA 2UKDA 2XXJA 4XSGA 4Y9TA 4NR0A 2AZ4A 2FG6C 3E0QA 3QJGA 3W7AA 4M7OA 1A97A 1HMYA 1YS1X 3OJ0A 4E4TA 5ELXA 2I6XA 4GXTA 5HS6A 3FOZA 3IE1A 3DO5A 4FS8A 3EVFA 2VWPA 4UCQA 1ZMBA 3RSHA 1O95D 1TM3E 1KZ7B 3A1SA 3HCEA 3LPCA 4INZA 4HVTA 4WRRA 5LN1A 1ZUHA 3IBYA 3TOVA 3WV5A 4DMRA 2CL6X 4X6YA 4QKQA 1U9YA 4TYNA 2OD9A 4FXOA 5JZSA 9MHTA 4WERA 1WZ2A 1P9WA 4Y2JA 3DOFA 1K75A 1P18A 3L93A 2JNEA 4MEAA 1ND6A 4AK9A 3GCDA 1S8FA 1NRXA 1P7PA 3PQ3A 2FP4B 3KPYA 1KI2A 4OYHA 3TX2A 2DE0X 3OI7A 5ALQA 4YRIA 4D4MA 3D6JA 1VKOA 1ENZA 2IOFA 3ESBA 2IF0A 2V7UA 2TSYB 2C20A 2TMDA 3JAWB 1L5SA 4V1CI 1ZD5A 1BFUA 3CPJB 5EP1A 4KR2A 4EI7A 3RRFA 1F1BA 4LZOA 4E31A 5BSHA 1N0VC 3IESA 4YJ3A 5FYDA 5JFTA 4W1PA 2JA2A 3C4JA 1L5HA 3TAUA 1C1YA 2XUIA 4J0HA 2D59A 1OHHA 2J41A 1CZUA 1KRHA 2QTMA 3LXUX 1WP4A 1O9GA 2OAQ1 3TLXA 2A88A 2UZ3A 1W85B 4JUCA 3M6WA 3D02A 5ISMA 2OHVA 2QRJA 3V1TC 5DW0A 1Y4SA 3BFKA 5A4FS 4KO1S 1X13A 1PS9A 2PX8A 1QDEA 1SPXA 3L1IA 4ZYXA 1VPEA 4GDMA 3MN1A 2ZGVA 4U7TB 4C22A 3NDJA 1F4PA 1M75A 2RKWA 3C6XA 3DZKA 4Q15A 4QUKA 4TTRA 2PKXA 2O3SA 3DFIA 4JUDX 3TSWA 4LHXA 1V8FA 1IBKB 3JRXA 3OAAA 4JGIA 1MEJA 1VE1A 4MB2A 1CS0A 4A8TA 2FXVA 4HATA 3NKVA 2JEZA 3VDRA 3WQRA 4Q3KA 5CA0A 3DEKA 1SXQA 1N57A 1II8B 2LXNA 4JWTA 4JC4A 3E05A 3WL3A 4YYZA 3KJHA 4ZI5A 5GADl 2EZ8A 3QM1A 1T36A 4GSYA 4JEMA 1WNTA 4WUTA 4V1CB 3LT2A 3PNPA 5BN5B 2WU8A 1I7NA 1SC1A 3WA6A 5A6VA 3LT0A 4MCHA 4R8KA 1QQ7A 2R48A 2Z8XA 4JFRA 4CNQA 2ZBFA 4KJZA 3F73A 4C0HA 3AOEC 4GBED 2X7JA 5KVVA 4QVGA 4Z0HO 3TH5A 2IITA 4HLCA 1M6VA 4C06A 3FHTA 1LRJA 5KQRA 4MV0A 2WQ7A 1E8MA 1JDTA 1T3TA 2ZETA 3H9JA 4HGZA 4YREA 1PGOA 4A0GA 1C1DA 5DXAA 4ZVUA 1Z7EA 4MVJF 3AR8A 1PQPA 1JU9A 3CA8A 3NBZC 1PFWA 1EVKA 4FI3C 4RJ2A 4NECA 4FYIA 3ZDZB 3I73A 5KYWA 1EWQA 2FOIA 2WB2A 1XXHE 4UZSA 2FPIA 4EFKA 1RP1A 3GI1A 4JBLA 1J0DA 4KR9A 1ZJWA 2CHQA 2I7TA 4BQNA 1JRLA 3O31A 4OXQA 6NULA 3ER8A 3N2NA 4NCJA 4PFKA 4I9NA 3Q11A 4ZOBA 3FDZB 3AUSA 4XQGA 4JV5B 1T9ZA 3ETDA 1E9AA 1C3VA 1RM5A 2R7KA 2GK4A 4D8XA 2AVDA 2CLIB 4GL2A 5DN9A 4RENA 1NVVR 2ZYHA 5KJCA 1U8FO 2BZ0A 5AESA 1KFCB 1NBME 4RABA 1JXMA 4IAOA 3SOZA 3U3DA 3ZWCA 4DCSA 4Y6SA 4BUZA 4F12A 3QEKA 4KR0A 4KDRA 4OHWA 4ZVQA 1ATZA 1HEUA 1P7CA 2EGHA 4MHOA 4ZHQA 2O1WA 1NBHA 4DYDA 5ITZB 1KI1A 1NWHA 1N9GA 2QVZX 4MLDA 3GA0A 2YXLA 3FUUA 1C4KA 1DHTA 3ESAA 1VMKA 4US0R 3WGHA 3K70D 1FL9A 2OZLB 1HH4A 1WMSA 4EKNB 4JNCA 1MA0A 1Y5LA 1UM9B 2JFZA 3RS5A 2C54A 1RYHA 1VMEA 3TIVA 4EAAA 3CU5A 4HVAA 1J5EB 1OYWA 1II0A 1QCZA 2NGRA 5EGSA 1D4FA 1I30A 5LZ7A 3SXUA 4DV0B 3N07A 1LI5A 2PO5A 2VT6A 2VJAA 3HP7A 5GWXA 4RQTA 1CUWA 2ZR7A 3BF7A 3UOAB 1Q74A 3VPCA 2I6FA 4ADSG 4QZVA 3WC4A 4P08A 4YBRA 2DPHA 4TT8A 3QUTA 3NVAA 3WBJA 2VK4A 1B2RA 1V37A 4PLVA 5MN5A 3B6EA 1EEXB 3FBGA 4JP2A 2JLYA 2QTHA 1JNYA 3OMXA 3DP7A 1Z2CA 1NTRA 4DA9A 5B58C 3K8ZA 4QBIA 5AJVB 3W5CA 2DHQA 4PFJA 2AFHB 3EFOA 2PO7A 1R88A 4RU1A 1PR9A 5TNXA 2PKRA 3FI0A 1U1EA 2H5EA 1PWZA 3LL4A 2RGGA 3CT4A 4O1HA 1JDSA 3CG4A 1ZZEA 3SEQA 5ICEA 1LDYA 1PVVA 2GKOA 4KBYA 1O96B 1X8LA 2SKEA 4KIFA 3OURA 4YCNA 2W6JA 3PG5A 3G1WA 3PUKA 4YAKA 5JYEA 4URUR 2D7DA 3G82C 2OFOA 2IPMA 2YWRA 2YIDA 3MXOA 2YJNA 5AM0A 4EY8A 3CV3A 3DE4X 1CNEA 4ZVKA 4OYLA 2OORA 5HZMA 5KYVA 4QGBA 3R2JA 1N6OA 2BFDB 1L4KA 1E2GA 2PQ2A 5JH7A 2GD6A 4YONB 3H5OA 1IOWA 3LTNC 1H93A 4DCNA 3ADKA 4KYVA 2ZI4A 4UASA 1U7DA 1C7IA 1T26A 1LPAB 1TI7A 2JHPA 2XDQB 3IOMA 4FDVA 4Y2PA 4DQLA 1Y3IA 3F6YA 2XE8A 3JQRA 1RYNA 4UUMA 2ZJ7A 1WZUA 4LK2A 4YCBA 4YV0A 1G3RA 1X8KA 4G9EA 4BFYA 5EPUA 3W0LB 1B8PA 1GTJ1 4OL9A 4UJ3A 4EWLA 4F3TA 5JSZB 2OQ2A 4KAAA 3QV2A 5TMEA 4BMVA 4P4NA 4P4TA 5K0CA 3GAAA 5J4KA 1KGDA 3BKXA 5LU8A 1YVUA 3TVTA 2HSWA 3KBBA 2VK2A 5KYTA 3O94A 5FAXA 5K01A 5IBCA 1ML4A 2N1MA 4PYMA 5G4KB 1DQSA 1Z5PA 3VU8A 4P5DA 3EEYA 4EO7A 4BVLA 4ZI7A 1TMGE 4IEIA 4MCJA 2QG9A 5HEKA 3FYSA 5FWAA 1FDTA 4LDNA 2D06A 2DG2A 3INRA 1QU2A 1Y3FE 1N92A 2CN1A 3GGGA 3GLIE 1BKDR 1QVRA 3SZLA 4FGJA 4F2PA 1U0FA 1ZSNA 2YCLA 2GD2A 3ZHCA 2GK3A 3OQIB 4A23A 5HR5A 3I2GA 3KQUA 1E1NA 3ASYA 3L5KA 2RHDA 3P9RA 3IR5A 1U3GA 2PUFA 2VP9A 5G53C 2CVPA 1G3MA 1U7UA 2HA4A 1JA9A 2ZROA 3KVNA 4L57A 1V6CA 2FYTA 1P3JA 1WQ3A 5I3CA 2VT7A 4CMJA 2A9OA 3AZPA 3H5LA 3Q5EA 4YVFA 1UXJA 2M9MA 2KB0A 4HLNA 2PZJA 2J07A 4C5CA 3CRW1 3C1AA 3QEAZ 1P0FA 3AEXA 3AKEA 5DNCA 3NGXA 3O8LA 2GWHA 1EJBA 2EP7A 1JQEA 3R6DA 3DAFA 3M83A 4RADA 3FOEC 2EWVA 4K8RB 1QH9A 2HMWA 2X22A 1Z4PX 2QIPA 4AG3A 2XADA 1VCOA 3KALA 3NH6A 4GMDA 4J2OA 5EXDA 2OSBA 4P4SB 4WXYB 1IQUA 2JARA 4IWNA 3T99A 3BGDA 1EFRA 3U48A 4D3DA 4ZC8A 5KCZA 4JT4A 2PGDA 1H5QA 1W4RA 4R5MA 5TT0A 4O4LF 3IQHX 4Q9HA 3TINA 3WLQA 3A9RA 4LF6B 1YS2X 4XD7A 3HYNA 1VIYA 1N33B 2D54A 1QK3A 1TCBA 3DXFA 1WIWA 3I32A 1O8CA 4J6FA 3ZQJA 3LDFA 3S44A 5EZYA 4B44A 1BYIA 3DTVB 4V02A 2AT1A 1WVGA 5E38A 3BQ9A 1N2CA 2RGNC 1EXWA 3JRWA 1GPDG 4FUTA 5F7OA 1R15A 4H60A 4BWFB 1XZJA 4RVGA 5DLYA 4V0SA 1GN9A 1E79A 4IJMA 1DLIA 1GZDA 1KMQA 2R5NA 4X97A 1HE3A 2NMVA 5CBPB 1E1CA 1U7OA 2JZCA 1UMBA 3CEMA 2FJUA 2NNLD 3M81A 2FZCA 2W43A 4HEA6 1UXOA 1L5LA 4ALLA 4WKPA 4IS2A 3DAOA 3GCWA 1Z62A 1P44A 3T9EA 4YPVA 1DGQA 3LHKA 4PGHA 2IOYA 3INYA 5JSZA 5JVDB 3K71B 4PLYA 2NYUA 1H4QA 6REQA 3FNQA 3PGJA 3QVUA 4N01A 1RE1A 4DC1A 4URZR 1F7UA 1CYEA 3I9LA 2B4KA 4Q9IA 3SJAA 3E61A 4WJKB 1LH0A 2WJWA 3PGA1 3UMMA 1LZKA 4Y1FA 3NHYA 1SZCA 3TLEA 4Q0MA 3TLJA 5A4DA 1T6YA 2QD5A 1RTTA 1ZL2A 4J94A 3SR0A 5HK9A 3BVPA 3MUEA 2GF2A 2GOYA 4M89A 4A0FA 1X3LA 5BO5A 4KKXB 1Q12A 5CEJA 4B4WA 4G0ZA 5GM2A 3QLVA 1IWPB 3VO2A 2VNIA 3LECA 4IUYA 4V24A 4HDRA 1A9OA 3DV0B 4UTXA 4EGFA 3WWCA 4NCNA 2ZTMA 3U7QB 5DULA 4I5IA 3CCCA 2O2YA 3MOGA 5CNJA 5C4MA 4OLBA 1JTFA 4KC0A 1VLLA 1LY1A 1PFUA 1ZA1A 1H42A 3P0HA 3W34A 1C30A 2IHVA 1QPGA 1K3UB 2BGNA 2DB3A 2A0WA 2DWUA 2E89A 4IQ0A 4KLNA 1CUHA 4YY3B 2C9DA 1M8KA 4YJGB 4YHHB 1NU8A 4QQKA 1WU8A 1L5RA 3EA5A 3KJGA 3OPYI 3PFIA 3Q10A 1XEXA 5HIMA 2O20A 2JLAA 4GF5A 3COZA 3L7DA 3JV7A 1HDIA 1LXCA 4A91A 4K5QA 4CODB 4JASB 4QTYA 3AERA 1XEFA 2V45A 3FHJA 4B7CA 2V9CA 1DAIA 4KITB 2IODA 4QLAA 2ZREA 1A98A 2INGX 3O8NA 4X8HA 4B84A 5JAZA 4U7DA 1FP7A 2PUHA 4MIYA 4C07A 3GG9A 3S8YA 2RGCA 4AMZA 3C70A 3FFWA 3WMWA 3UQZA 5EXSA 1RAHA 2SHKA 6CHYA 3CPEA 1WCWA 4ZODA 3CX8A 4FWIB 3LBNA 1HEIA 2OC9A 3P9CA 3V2GA 1IVYA 1G2QA 1AF4A 4MW0A 5J43A 4CLXA 2GBLC 3HGMA 4DLKA 1OWPA 2VWQA 1YF3A 4DB4A 1FNMA 2CHGA 1GTL1 3QYJA 4EG6A 2WAAA 1W1UA 2P65A 1SUSA 1WCYA 1PSZA 2OECA 2QTZA 4IXDA 1QWSA 2R8XA 3ICWA 2P0YA 1U5AA 1DG1G 2P4HX 1W581 2BKEA 2HLDA 5A3JA 1JDJA 1C9KA 1NT4A 1N7IA 3NNNA 2RHBA 2BGTA 3OKFA 4Q3BA 4A8HA 5FOQA 1NF8A 5FX2A 1EHIA 2QZSA 2R66A 4JELA 1KI4A 4R81A 5BSFA 5J2UF 5FHQA 4I2NA 1TB4A 2NZUG 2PXCA 2YS7A 3JU3A 3PC4A 4KH1A 4D9EA 1S2OA 3PJFA 3OVMA 2IPLA 3QUBA 2KYRA 3NC4A 5F4ZA 1WW8A 3FMIA 1JKMA 3O8OA 1SGWA 3HJTA 4FFMA 4HCJA 2BZSA 4I3HA 3VAYA 5FB3A 1JIQA 3THYB 4MDEA 3PA8A 5K0BA 1M6YA 1M2GA 5EWLB 5KTMA 4TQ9A 5BPFA 3AILA 1YCGA 5LMNB 1R3DA 5LKAA 5EZQA 3ZKWA 4ETWA 1PU2A 1ORTA 4MI3A 5C5IA 1IRIA 2GBFA 1M74A 3GAMA 1VHTA 4ER6A 4ZT3A 3KFXA 3U3OA 3EUWA 2MINA 1KFKB 1L4BA 3R3JA 2VF2A 1DQRA 2JIQA 3VHQA 1DHRA 1KJIA 4UNNA 4Y2QA 5KNDD 1G19A 3PFHA 2ZBRA 2REQA 3IHWA 2WFMA 3RWOA 1BH2A 1KK3A 1RJDA 2UZIR 4EY4A 2ZIXA 4K9RA 1CDDA 3SDBA 4CCYA 3QEMA 4DBVO 4KHPB 2CUTA 4TMTA 4U39A 1XRLA 4QWWA 4KQHA 4ZOLA 2FPPB 3HBAA 4KVAA 3BCSA 8ADHA 2DUJA 3PHIA 4A0RA 2LUOA 4LCJA 5GGYA 2H1RA 4KEAA 4D96A 5BT8A 1E96A 3GFOA 1RE0A 4HS9A 4F8YA 2J9XB 1MQSA 3R7LA 1P81A 1QX3A 5G1NA 5LKRA 1VSTA 1KGSA 3PQ8A 4Q21A 4MVJM 4UU8A 2O5RA 3OPMA 2UYGA 3RUDA 1N8KA 1N75A 2TMKA 3LGAA 4JLUA 2VSQA 1NFRA 3PL5A 4WDQA 4DQDA 3F9CA 2MR6A 3MOIA 3MD0A 1SR8A 5LZ8A 3U3ZA 5EJ8A 5K4HA 2I3DA 4F6CA 2ATVA 3RBAA 3E4CA 3NTLA 4KX3A 4TKLA 2MYNA 4W5JA 3SPXA 4QAJA 2GA8A 1GAXA 1H3NA 3K8OE 4MKXA 3VR5D 3KV3O 1MB3A 3B48A 4EMTA 4DA8A 3E81A 3QKRB 1DJLA 1FDUA 2Z2IA 3LFUA 1NRIA 2XQKA 3FCEA 3LDUA 4LTNA 4A5OA 2VHEA 5AXAA 1U2DC 4LQCA 2X3YA 1ZSVA 1DCTA 2O8EB 1VJRA 2RB5A 3FKSD 3RK1A 1LDBA 3TLMA 2XYPA 4ZO6A 4FZ5A 4KWTA 3G13A 4OIFA 3FTQA 1YDEA 3GJ7A 3M1AA 4CXMA 1F8GA 2YVAA 3KXLA 2WHRA 2GILA 4MQ4A 4M9QA 2E9SA 4ZMRA 2XTMA 1QYCA 4FYWA 3T7IA 1QGYA 2A1UB 4MRPA 4IEFB 3DL0A 4YQFA 2Q45A 3WOHA 3ZDAA 5TQ0A 4PCVA 5DLDA 5ADUS 3HBJA 1RC8A 1ZH6A 2YZ2A 2Z8YM 4PPQA 3H0EA 3DW3X 4MQ5A 5HW0A 3UW1A 3HR4A 1OWLA 1Q1QA 5CB0A 4ZTZB 3RS2A 1UH5A 1RYDA 1TA9A 3DMPA 3C7CB 5IP5A 3TSCA 4XGNA 1JQJC 3DEJA 1U1CA 4WK6A 3AETA 3G2MA 2Q3MA 1OT5A 3M6MD 4KCGA 3A6KA 5K7SA 5KYXA 2IBMA 3PU6A 1SVLA 5E4TA 3PPIA 2YX1A 3X1MA 4MVXA 1D8TA 2P91A 4QREA 5AM2A 1M5RA 2P5SA 3IUSA 1OASA 5DCYA 1MAUA 2AIRA 5HKLA 3WNBA 1ZCFA 2HADA 2Z56A 4K9KA 1NN3A 5MN6A 4JJ7A 3QMWA 1VBKA 2H1LA 5C31A 4DCVA 1WO8A 4X8MA 3HMKA 3DVLA 4XB2A 3VM6A 4JD5A 2VYQA 2PSEA 4JXZA 2CLHB 2I03A 3S7TA 2CF5A 4F96A 1I2BA 2WABA 3AQ4A 3NFRA 4RV9A 1NPTO 4ZCQA 3TMKA 4F8EA 4IJUA 3QF7A 3KQYA 4L6IA 4L4ZA 4NESA 2G17A 2YWCA 5HTOA 1HQYE 1OE0A 3D8SA 2F6RA 4NZYA 1I6WA 1WXGA 2M6KA 3O6VA 3WJ1A 1TCVA 2Z4RA 4M55A 1M10A 1NBOA 1JLRA 1XR3A 1QFXA 1X9HA 3I6BA 4HB0A 4OHBA 4BMXA 4FKBA 5DRTA 5JC8A 2I8LA 3U7GA 4YJ3B 1WPGA 2XEDA 4YMHA 1JBQA 1OIXA 3RYIA 2M98A 1L5HB 4OQQA 4FFRA 1JXOA 5AHXA 4QRIA 1AXEA 3BUSA 1NDHA 2GHIA 3KPUA 5CCBA 2XUZA 3BFVA 1SZJG 1L0BA 3DA8A 4G6ZA 2D1FA 2QK4A 3NXSA 3VOAA 1JU4A 4XIGS 1FNCA 3B78A 3RUIA 3ZHOA 3DTVD 4OGKA 4EUEA 3QNUA 3WIEA 1JKFA 3BXXA 5IZCA 1P91A 3C3AA 3ED1A 5CIYA 3R7NA 1U4SA 3HRKA 3GCZA 2VP5A 2ZVDA 3A36A 4IV5A 5JPDA 4AC9A 1GRNA 4GOMD 2FWJA 3CEPB 4JMLA 1WSWA 1KOJA 1Q50A 1Y34E 2HK7A 1C0EA 4JVLA 4Q7QA 1CS0B 3I30X 1A76A 3NEYA 4JJGA 5CYGA 3I34X 2R6JA 4Q4HA 4LHWA 3TCNA 1U0TA 2JASA 5CA0B 3ZWAA 4I7EA 5AW7A 2DEUA 1SK9A 4A6DA 4GMGA 2WWVD 1GFWA 5DWVA 2Q3LA 1J0EA 1TC1A 5ALRA 1T36B 5LOVF 3NWEA 5ALEA 4ZZ0A 4MWOA 4OXKA 1M2VA 3MAJA 3GLFA 1KYWA 4B3IA 3IP6A 3FOFC 4QT4A 1LCIA 4FEEA 5T8KC 5JHGB 1T2CA 1BDMA 3FYHA 3FVQA 2GCPA 3MINA 1SVKA 2YDYA 1J42A 3FMGA 4UZFA 2DPXA 2C96A 3H6KA 3U0BA 5ELLA 1M6VB 4XYEA 3TO5A 3TBKA 1CEYA 4MWGA 3F4KA 5C8XA 4EQ6A 3RKUA 1XALA 3C3BA 5GAJA 4AG6A 5A5DA 3THXB 4NRDA 3ZJVA 1O9BA 3FN4A 5L53A 1WKVA 1DQPA 1QE3A 3K9BA 3QFFA 2ZT7A 4G1BA 1ZHFA 4ND2A 3OCXA 4CNBA 5KYWB 1HL7A 1W0KA 2D13A 3FAKA 4PAGA 3UA4A 3IDFA 4Y2GA 1FS6A 3N8DA 4TMFA 4DLNA 2YFKA 5IF3A 3U4QA 2BEWB 2QRVA 3Q2KA 1GPAA 2ZI5A 1TQHA 4AM8A 3V1MA 1ADBA 2DQ4A 1YASA 3DF7A 2D1QA 5HILA 5I9LA 4EJFA 3FOWA 4DMGA 2BGGA 1WPQA 3JASA 1XOIA 4RZSA 2WSIA 4PAQA 1I3CA 3L8MA 4UU1A 3NCTA 4B2IA 1YBVA 2JCXA 3PK0A 4BC1A 3QA3E 2CY0A 2O7RA 1SCUA 3A3KA 1O57A 4LXYA 5A7GA 1RJFA 1HZJA 1Z7YA 2E1PA 5AK4A 3DD5A 2GPNA 1AKMA 2EJTA 2VCYA 3QG1A 4PBRA 4Q1EA 1KF0A 1Y98A 2AD5A 3PQ7A 4TV9B 4KPEC 4I4CA 1KBOA 3E9MA 3GFSA 4G3XA 3VSEA 2QJRA 2HUPA 2OILA 4I08A 1OFTA 3A6FA 1N9GB 2W2LD 3BJZA 3L0YA 4NNPA 4RJLA 2XE7A 4ABTA 4G2TA 4KWCA 3QW2A 1U2QA 2D5BA 2FEKA 3EZYA 2FSGA 3Q7TA 3EBPA 5FFMA 3WLJA 4JOQA 3CJTA 4UNSA 1P9OA 221PA 3HJNA 4WK2B 4LRXA 1DV2A 2RAPA 3HVJA 2G9UA 4GI3A 2Q28A 4D0LB 3W5DA 3SYMA 1QJ4A 2CNLA 2IYZA 3KUDA 4N0PA 2C2GA 3H9CA 2WHEA 1Z5GA 3T7TA 2ZCVA 2WJ6A 3GH1A 2BBOA 4JDUA 3UHOA 4IDCA 3W2HA 3OM8A 4MICA 5DI3B 3AB3A 1XC7A 3KYCA 2HNAA 3NYWA 3U37A 1RAIA 3KTFA 3H7IA 4WX2B 4CLRA 3GRUA 5HDBB 2UAGA 2YW9A 4MV5A 4Q93A 4AUKA 3ERCA 1Z34A 3QYPA 4X3OA 3OSZA 5B4VA 2ISQA 2L17A 3OZVA 1DWOA 1OVGA 3I2YX 5FUBA 3U31A 1Z5NA 1JA1A 4MV4A 4DGQA 4AS2A 5FF9A 5HDQA 4MGKR 3FBTA 3DE6X 4GUAA 2LBPA 2Q3EA 3IOEA 3D2LA 4OBWA 4AZTA 3U7FB 2VPWA 3IO5A 3FPLA 1H3FA 3R7FA 5DBEX 4DQUA 4ZHSA 2BGIA 5EJ6A 3EHEA 1AKRA 3O1HB 1BA2A 2LCFA 2FI1A 3QU9A 2I7CA 4KO3S 4EG8A 1R18A 1TYCA 4L5YA 4CF4A 1YZGA 3EMKA 3UICA 2B92A 2YQ5A 4TV8F 2VXOA 3K8QA 3AONB 4BJ5A 2A4KA 1JDBB 2CMFA 4LRQA 1BN7A 2C5FA 1L7DA 1ORWA 4M2LA 3WX0A 5J4HA 1XHFA 3HCPA 3D3WA 3ROQA 2AJLI 3ICVA 4AZSA 4AKGA 3VVMA 2PZLA 3O4FA 4OAPA 4EB3A 1YNSA 5HRUA 1WDMA 1FXUA 1XDBA 1AS0A 1P1FA 2XRZA 1JALA 3KIPA 4EABA 1QK4A 1V25A 1FP4A 2GBGA 4AMYA 4CMCA 1PJ2A 3CF0A 1MN6A 3A32A 3KXPA 3VPXA 3K92A 5HKOA 4HYYA 1VL0A 4OGWA 3MVEA 4RY0A 4C7JA 3MJRA 4YUZA 2HKIA 3C5HA 4FFLA 2P2LA 2NO9A 4G0XA 4YUXA 2AN5A 4MITA 3DXZA 3KX2A 4ZRDA 5HTKA 3HNPA 4KE9A 2ZIFA 4LC0A 5DNVA 1S2MA 4HEQA 3ABQB 3DKRA 4MW5A 1MBZA 4WLFA 5BMVF 2WICA 4RC9A 1A7KA 2X23A 3OTWA 4OXNA 4X7RA 4ZI7B 4UPDA 4EG5A 3PPVA 5ARCA 1CUYA 3MCVA 4C30A 3OP1A 3V5NA 5TVGA 2CV1A 3SSAA 4DLPA 3BDIA 3REGA 1T6BY 2X4GA 5HYVA 4NULA 2BH9A 3SYLA 3WLNA 4IZ6A 4XOUA 5FUYA 3PD7A 2IUTA 4RGBA 3ZE0B 2WJVA 2XJ9A 1TOAA 3W3AH 4XIFA 4JJZA 3I9V1 3C1UA 1H6DA 2XOKD 4JHXA 4UUPA 2XF2A 2JIZA 4X6LA 5I9SA 3BQNB 3MWFA 4BYMA 2QIOA 2MHCA 4YN3A 5AHRA 5EYPA 2R9VA 3G88A 4GT1A 1SFRA 2WUGA 4TWZA 3S0JA 4A6PA 1ICEA 5FOWA 2O3UA 1GA1A 3NWOA 4RD0A 4DIBA 3PXGA 3UK7A 4MRNA 5ICSA 1Y42X 3PHJA 2PA3A 3R6TA 1Y81A 2D2FA 2G83A 4Y1EA 3X2SA 3R4VA 1XAHA 5JBQA 2H65A 2IQ5A 4NQZA 1MNAA 1BMFA 1Z0SA 2KPOA 1DJQA 2J6HA 4OHPA 2PBFA 1JIXA 1P3Y1 3MLAA 3OWHA 2ZWVA 3D6NB 1MFPA 2RG1A 1XRQA 3AXSA 3LPLA 4IV8A 4DPLA 1J07A 5F7ZA 3UJ8A 5BWNA 2OYCA 3IAUA 1SU6A 2WG0A 3BXHA 3BK2A 2CDBA 2Q9AA 3HWRA 4FCVA 4PNZA 4GMHA 5DIFA 4YMVA 2C4MA 5D6OA 4URHA 5ICFA 3ER9A 4JDPA 3AINA 5JV5A 1ECPA 4WEQA 4Q5IA 2NXWA 1D7AA 3EMDA 1MZVA 1Q7EA 4D81A 3QPAA 4UQLA 5EZYB 4OA8A 3CLUC 2BSAA 1XCJA 3ZDDA 1T0IA 2CLLB 1UBNA 3KT8A 1O5OA 3IO3A 3NWBA 5EIEA 4HMOA 1N2CB 3Q15C 1QUFA 2QGFA 2HGZA 3PQCA 4XDZA 1GGVA 3KLBA 5EJEA 2ISSD 3PCXA 1TM4E 5JPIA 3TGWA 1BRTA 2AMJA 3C39A 4YI5A 2NYVA 2YQZA 3QWHA 1E1CB 1UMBB 3RRXA 1PLLA 2FPOA 3KKKA 3KS9A 5FV7A 3HH8A 3SE0A 4P3OA 1XLWA 2E4WA 3NEPX 1GKIA 3SOPA 2EVWX 5F4BA 1E4EB 4FE7A 3W78A 6REQB 3L18A 2R85A 4IVPA 1YUBA 4EL0A 2POCA 3GDGA 1L5GB 2Q7OE 1X19A 1L2TA 4MUXA 4D57A 4EL5A 3WLPA 4PXYA 2Q6TA 1TKCA 1G4AE 1K5DA 4KFTA 5BURA 4R98A 4RIEA 5I8PA 1D1QA 3EPLA 3H86A 1KU0A 3ORFA 1Y3DE 2DY1A 3HVUA 4PEVA 3GP8A 1C9MA 3P97A 3WA7A 2JJMA 1JLLA 2VT3A 1HE8B 1P9NA 1WUIS 1NI4A 5JSQA 2I34A 4HC4A 5DCLA 1WV1A 1A2QA 1OYVA 5L4LA 3ENNA 1JEOA 5CG1A 3DKPA 2CF6A 3IEKA 3BTUA 2W90A 1X1CA 3TQSA 2O5CA 4G5QA 1HYQA 4J76A 1OHHD 2VBIA 4FCTA 4IVNA 5FBKA 2MWMA 3WQHA 3UENA 4A1FA 3RHFA 5FOXA 3V1NA 5BUSA 4DIKA 3VR1A 5ITWA 3AUTA 5DYTA 5C5EA 1GZ6A 3IT0A 1T5BA 1DC7A 1WHTA 3CB4A 4K9PA 2WJIA 2RG7A 1A69A 4FBMA 4KGVA 2Q3FA 3OPQA 4MKFA 1U8EA 4KMSA 4MB0A 1DCFA 2GPSA 4JFAA 4JROA 4X66B 4YIKA 1Z5VA 1DAOA 4K6KA 4RCVA 2IOQA 1ZQ9A 2WB4A 3K9WA 3RWMB 3OMWA 3UMRA 4ZVTA 3P9QA 3WBFA 1GILA 5CM2Z 2CMKA 3N2KA 4UE6A 5AI0A 1CQIB 4CRWB 3WYBA 4EFMA 4YRJA 1AKWA 2UZ1B 3IEUA 3OZWA 3EDOA 3MJHA 1XRPA 4WL0A 4PBSA 2UXDB 2CVZA 3QLTA 3AERB 3DCNA 3WLKX 4GU5A 1WDTA 4YV2A 4BNMA 1KK0A 4QXOA 4IHJB 4N0QA 1JT2A 1VE9A 3FCOA 3SZGA 3QQ5A 5K2OA 3ROMA 5BQ3A 1T8YA 5D85A 1C5KA 1AHNA 2KI5A 5DT9A 1NYRA 2QRQA 3FTNA 2KQUA 3ACCA 3EQZA 3DHVA 4OFBA 4Z5XA 4W5QA 1ZVQA 3QW4B 1UBRS 2A5YB 1A5SB 1C4OA 1NVGA 1YK0A 5DYIA 1QSGA 1OOEA 3BIJA 3RIMA 5COBA 3X1XA 1T1GA 3ZBQA 4BMSA 5ARDA 1XVLA 5AOCA 4D0GA 1Z6GA 4HGYA 3T4UA 2HCRA 1DL5A 2IY7A 4TL6A 5C8VA 3ZY4A 2VPPA 3ZWPA 2BMAA 3DULA 4ME6A 3ECCA 2ZP1A 2O05A 4RTSA 2JAHA 1TF5A 4UXJA 1XN4A 3RUAA 3WP1B 4DNFA 3DW1X 5K4GA 4GR5A 4XGIA 2DKNA 2F17A 2HCFA 4GXNA 4PZCA 3UWPA 2B2CA 1OKKA 2VJBA 5I51A 1N32B 3H9BA 3HA7A 3L0DA 2IW3A 3O2QB 1DBSA 4YDHB 2EFCB 3H13A 2O0KA 1HQDA 3FW1A 4IJKA 2O5VA 3R7BA 4HLUC 3MGGA 4C1BA 3JQAA 2D5CA 2VWGA 5B37A 4E3ZA 1G66A 4GPTA 2BI7A 3O8OB 1JIUA 3K9CA 2YR0A 1CY4A 4CIVA 3L1JA 2LV8A 1OGJA 4EHAA 5K9ZA 5CFPA 3AEZA 4LFCB 1G5FA 2ZRPA 3G7UA 1PEDA 4V0NA 3VISA 4LN1A 2RHLA 2PFSA 1LBTA 3EARA 3NEJA 1QIIA 3H0CA 3ZKWB 3CISA 1E92A 1PKEA 2XPCA 2ZRCA 4Q4LA 4WPGA 4I5DA 2C3PA 4KGDA 1CUBA 1H8EA 2MINB 3UVEA 1W4LA 2W11A 1JG2A 2AUTA 3IILA 5D7NA 2OXIA 2IWHA 2VXYA 1FVOA 3EN0A 4FSDA 4HNSA 4PVCA 4F3YA 3LQQA 1ZUWA 1Y6GA 5JXHA 1IZ0A 5M3BA 1D5CA 3JWJA 4WEOA 4E51A 2CMGA 3HVHA 1U8YA 1SNYA 3QE3A 2O2JA 2XODA 1OYOA 2ZIXB 5ILQA 2WSLA 4E13A 4AKHA 2ZYSA 2H1CA 1U90A 4B40A 3V4RA 2PXXA 2CKDA 2EKPA 2FR1A 3GVXA 4UHHA 2BYTA 1OI4A 4CKWA 1PJTA 3BD7A 1ZGCA 3QEMB 5JZOA 1Z4NA 1COWA 4U7PB 2DF8A 4IGIA 2N47A 4MTLA 4ZOLB 2CXTA 1FZQA 4HN4B 1KI6A 1QV7A 4EGJA 2RFLA 1JEEA 4KK4A 1U9CA 3QX7A 3A25A 1ODJA 4E94A 4CEHB 4WGFA 5AQ1A 3GL9A 4IY1A 4JLJA 1H9BA 2R00A 3E9RA 4P36A 4ZO7A 1KQ3A 4KN8A 2OBLA 5IDQA 3BDVA 1KJ8A 2I6QA 2IZ7A 2JGJA 2Q9BA 3NASA 4MI6A 5EFZA 1VPWA 2V65A 1E9SA 3BGIA 1NXTA 2BMWA 1Z6QA 2C07A 2WT4A 2QSYA 2D74A 4AYXA 2YWGA 1YCHA 3VRHA 5DN6D 2XGSA 5T7BA 1QGZA 1IHUA 2I1WA 1XXHA 2JBWA 1E9EA 4IJVA 3NAQA 5C7LO 5HHTA 2D7JA 1E98A 4D9CA 2A3RA 3OOEA 2W6JD 1WQ4A 3UMJA 1KJZA 5AVJA 2WHYA 4ARAA 2EL7A 2HJRA 1CJVC 2GZ2A 2OGWA 3IQWA 4PG5A 3STHA 4DV4B 1PGQA 2X6RA 1O95C 4XGRA 5ALHA 5IDVA 4BCDA 1MJHA 5IASA 5JUWA 4WLNA 1XL0A 4LTDA 5EP2A 4EGSA 2XB9A 1ESNA 3FDJA 3UO8B 2H7CA 3FBWA 5E0OA 8ATCA 1MC5A 2BBWA 2G63A 4M4SA 2PS9A 1W59A 3UUFA 1T2DA 2RONA 4KYIB 2A9VA 4WACA 3SXPA 3UZUA 1E6LA 1Q1GA 4TTSA 4H6PA 3OFSA 3K1TA 3SHFA 1LQUA 1JAZA 3QSGA 4J0JA 5KDDA 3OT5A 1Y1SA 4DC0A 3UKJA 3GYGA 1HZZA 5TQ0B 3WDSA 4RTOA 3RTDA 3TRFA 1PL6A 2Z9DA 4JUBA 3D4PA 4B87A 4GL4A 3AL2A 3SM3A 1JFLA 1ZKDA 2ZDHA 3GAZA 1FS4A 1LI7A 2B6NA 1ZN2A 1GNVA 2PX3A 5HIIA 1Z0UA 3SEFA 3CNQS 2FN8A 1UT8A 3RREA 1KVSA 1SUWA 4EEZA 3M6IA 1IB0A 1N3LA 4EW1A 1HK7A 3AF5A 4O4IA 3AETB 2GN1A 3G8DA 2ASEA 3IIMA 2GO7A 4P84A 3KPVA 4R6WA 4YCCA 1EFVA 1WUKS 4ZO8A 3PNQA 1IM2A 4OYYA 3TQIA 5B3KA 3QEBZ 1TIPA 2JIMA 2HRCA 2OOSA 3LPDA 4KQFA 1XMSA 4M99A 5KU7A 4H4EA 4ZCLA 3JQBC 4EARA 5JDIC 1N6IA 2PRZA 2YY5A 4E6PA 4ERXA 1L5KA 2PXHA 4L7QA 2ZB2A 1RJGA 4PLFA 3TYXA 4BRZA 4AZ3B 2VTKA 4AIRA 2YRXA 3EVZA 3LLSA 3ZH2A 3K73O 1L8AA 3V34A 4BNLA 1N2ZA 1ZVVA 5CFLA 3BHIA 2AZDA 4R8SA 2WUDA 3T41A 4V0ME 4DLYA 3ZLJA 4JB8A 3Q8LA 3HUFA 1L3IA 5CDTA 4JBIA 1G2PA 2HA7A 1D0VA 1GYRA 4RYDA 1RYBA 4U5XA 1YZLA 3VKFA 2XITA 3ANYB 3RARA 2WY2D 3U7RA 2CD9A 4EYEA 1DFHA 1XEWX 3ELUA 3WGZA 1Z5OA 4QHTA 1P2TA 1U7TA 2YZGA 1UOPA 1SWVA 4JHLA 2XMQA 3LXRA 3SNHA 3MUNA 1DIHA 2HUNA 5CYOA 4C87A 2ZATA 3BAZA 2H1HA 2R6FA 3AI2A 5CXXA 5FEMA 4QEDA 3DDHA 4DABA 3EBLA 3ZE6A 3A1TA 3HV0A 3D3KA 2CHUA 2GTPA 2Q2NA 2FN3A 4PPGA 1EFRD 4QGFA 1EXNA 3QWAA 4IUCS 3UATA 5PGMA 1M2EA 4K9DA 1E66A 5DOVA 3ZZ1A 1C7EA 1GGEA 4XD7D 2GSWA 2H0RA 1ECBA 1JEQA 1KKUA 4EHBA 3MMPA 1GL6A 1S1MA 1SAYA 2OV3A 2IK8A 3FKQA 3K9HA 3ZGVA 3EVCA 3OCZA 1MQAA 2CMHA 2WIKA 5IM5A 4C0JA 1NLYA 4FJ0A 3UAOA 3QXXA 3WYNA 1FTWA 2PRKA 2ZZKA 1F0PA 2VPXA 1C50A 4MW1A 4FLEA 2J31A 3CS3A 2ZSIA 3LLUA 5H4GA 1MCZA 2ZR0A 3OKPA 4MMYB 4L78A 5JSFA 3G5AA 3PWZA 4JOCA 1N77A 2IYRA 4J0FA 1T1RA 1YS4A 2R8OA 4M0UA 3K0CC 2G9ZA 1OLXA 1QP8A 1G17A 1YU6A 2EHDA 2I1VB 4Q4HB 3HS3A 3M49A 3LWBA 5JMOA 3CN7A 1UODA 2ZB8A 3GLIA 2PS1A 3G17A 1DT3A 3TNYA 3K70C 3GLFB 1J5XA 3L8GA 4QHYA 1UIMA 3VHLB 5KWSA 5TE9A 5CITA 2ZE5A 3UCEA 2F55A 4QXPA 4XFDA 5DB4A 3D5QA 3MINB 5DI9A 1DEOA 2OCKA 2JLCA 5EP3A 5E3IA 4ZT4A 2Y1KA 3QLUC 4CMEC 3PFBA 4BTVA 3TOXA 1GQFA 3A2MA 2MT9A 1H0KA 3I2FA 4EQ6B 1IAQA 2PD3A 1TIKA 3PDUA 2IOHA 4U7WA 5CJJA 2QU8A 3PI7A 4CM8A 5B30A 2NADA 1FSZA 4OYRA 1MDBA 2BD0A 3U4QB 3A1DA 5C4GB 2X8AA 1T0HB 1VMAA 3F8SA 3IA7A 3STTA 3LV8A 2JGAA 2QRVB 3VZRA 1Q11A 4O33A 2I54A 4XJTA 3WZLA 2DQKA 1BX0A 4PXSA 3ZQ4A 4LYHA 2EJVA 4IGAA 4YEDA 1EX7A 3WKDA 3EIOA 5JO9A 3Q3VA 1DEXA 4OI2A 4OG2A 2NXJA 4EHFA 1S8NA 1Y7HA 1SBZA 3WQQA 5BUCA 4OHYA 4NZPA 3OIVA 3MS2A 1B23P 1F2TB 3RKRA 1RXVA 1JJBA 4BQEA 1DC5A 3N2GB 2F1RA 2A5JA 2FA9A 2ZWMA 4Z8XA 1CFJA 3QVVA 3SIPA 1TEVA 3HB1A 1P4RA 2AYYA 1H0HA 3NVDA 5JY6A 2H9YA 4EK9A 1GDHA 4IH4A 2N3ZA 1JE0A 4UMFA 5HZHA 4F7DA 3IKMB 1JDUA 2XECA 2YHSA 4TKVA 5CXSA 5KOHA 4U7FA 2XMCA 2QVCA 4MRVA 1JP7A 4RPIA 1LPNA 4D8TA 1Q84A 3L01A 3VJMA 521PA 2YYAA 4W5TA 3RODA 3TW4A 4AYTA 4BFCA 1N9ZA 2LWIA 3ONWA 3P2IA 2WUWE 4WE3A 5KX5A 1E3EA 2IHZA 2JFNA 1YS7A 4JQYA 1ZNZA 2QMYA 3N0XA 5TMDA 2KHRA 3KYCB 2I3GA 4RD3A 1KY3A 5BYBA 4CLRB 1LF5A 1H2BA 4J91A 5GV8A 1FBTA 1C0IA 4RK6A 4BU0A 2QDKA 5HVNA 1UDRA 1F8UA 4MP6A 3X2FA 1YIAA 2BSXA 3HBFA 1SCJA 3OKCA 4I1OA 4Y9RA 5EFOA 2E6KA 2B9VA 1DBQA 1QTIA 3MNFA 2DCMA 2VO1A 3F47A 4IVRA 2PGXA 4R9UC 4BLSA 3M5PA 3ZHQA 4KPYA 2Y9MB 4I4IA 2H4ZA 4LCBA 3SMVA 3R44A 1VL1A 3BGVA 1QNLA 2HHCA 4OXYA 2HLDD 5AI5A 2CLEB 1QQ5A 5K0GA 3KJIA 1H6BA 1ZWKA 1ZMXA 3Q0EA 1K06A 4EUSA 2PBRA 3UMVA 3RHTA 4B2YA 3LA6A 1SOMA 4IFIA 4P3KA 3TIXB 1RABA 2YMQA 4NBNA 4BFWA 3SC2B 3N5CA 3U44A 1JLMA 1YS9A 1VE7A 2Y1FA 1GPH1 4UVIA 1KAHA 4EPYA 1NYQA 3GLGB 1W4BA 3A2LA 1DT5A 3QUCA 2P6OA 2QGZA 2XWBF 3ZY2A 1JPJA 5TJHA 2NU7A 2BBTA 4HP8A 3O73A 4ODIA 5D6NA 1NM5C 3QBDA 3SFVA 5JCOC 4GM0A 3PC3A 1BQ4A 4M8NE 4PHTA 1T9KA 2Z0MA 2OE2A 3AV0B 3D3WB 3HWWA 4PX5A 4D92A 1GTZA 1H65A 1TM2A 4QGGA 3DC7A 2W22A 4RLHA 2FGJA 2JBAA 2V7GA 2GT1A 1CPYA 2ZAOA 3ACBA 2QUZA 3MWDA 3O2JA 4QXRA 1G7RA 3H5VA 5EXPA 4EMSA 2X9GA 2P9EA 5JXGA 2EARA 4YCSA 1H22A 2AXEA 4LY6A 3GY0A 3CZMA 3RADC 1RI2A 2O07A 4TWAA 1PR4A 5AI9A 5LA6F 4P7BA 5HWSA 2NV0A 5JZVA 4TGLA 1YIDA 3KAPA 4HGRA 1Z83A 1Z4JA 2P75A 1GRQA 2WR8A 3FFBA 5JJ5A 1PK9A 1A27A 4HKTA 4TL8A 4O4HF 2GM4A 3FRHA 3D7LA 1XI2A 3NH9A 3DZGA 5C35A 1CVIA 1LSUA 1XLTA 5M2QA 1P45A 5CX1A 2G1AA 2LE0A 1O54A 1ZNYA 4MYDA 4B3BA 3B3AA 1FTYA 4ZZ2A 4B46A 3FGOA 2E37A 4P5EA 4QPZA 4WKOA 3BTSA 4XCXA 1KH2A 3PDWA 1I4DD 5H68A 1D09A 4MKRA 4DRZA 2QMZA 3FX2A 3RVMA 2Q6KA 1FYWA 2C95A 1JIKA 2H9IA 2VQ6A 3ONNA 3K30A 1DXYA 3K16A 1R6UA 3PGKA 4FDMA 1Z7WA 4R3UC 1WZCA 4XTCS 5EIFA 2J7KA 3B12A 3OOJA 2GPFA 1XCBA 5AXDA 1DVRA 4HAVA 2WJJA 1YQQA 2OP0A 5EQJB 1QYWA 3IEVA 4YBZA 1OAAA 1RWOA 2ZRJA 1NY5A 2OGUA 2WDZA 1XZ8A 2YTZA 2ACWA 3I3OA 4NXMB 1JZTA 3LPAA 3TR5A 2OHXA 3KOOA 1EFDN 4J0IA 2IV2X 5EYPB 1E2BA 2P8SA 1ZIDA 5KVCA 2YWJA 1ZIYA 2LR0A 2NACA 5BVGA 3GJZA 1WF6A 5CB8A 2VEOA 1L7QA 4UXHA 3PDCA 5F76A 2Q3BA 2ZT5A 3TBFA 1E1QA 3B9PA 3DQQA 3PNOA 4KN5A 4HT3B 4YR7A 3R6WA 4ZREA 1Q0TA 3DD1A 2MIIA 1P1BA 3R7AA 4R9RA 3IX7A 4A8JA 1DKQA 5DNDA 4WA7A 4MVJH 2WYWA 1DB3A 4I3FA 3GG2A 3O3NB 5H7XA 1J2UA 1WZIA 3DPUA 5CD9A 1XWFA 5JVDF 3EASA 3ZHTA 4HNVA 1KZGB 3LC0A 2NN3C 2V6MA 1NGSA 5HZGA 2D5LA 3ER6A 2GCOA 3JVVA 3V42A 4B79A 4IDBA 3A7EA 2VLBA 1QOPB 2WM3A 3CWCA 2EDCA 1J70A 3PKJA 2PX5A 1R0CA 4IXWA 1XK7A 4LRYA 1PGJA 1M9NA 2E55A 2NXNA 2OXEA 2VL7A 3LUAA 4JMPA 4MVYA 4OB6A 3PUZA 4URYR 4DIMA 2G71A 3P1JA 4UZEA 3UH1A 3FSJX 3UHFA 2G36A 2ID9A 3IQIX 2G9VA 2AQKA 2JAXA 5JW6A 1G8KA 1T5IA 1VIMA 2QU7A 4P0TA 1SBNE 3EGDB 1MORA 3EBOA 3VVLA 3RC7A 2EG9A 4Q3AA 2O8NA 1NA5A 1SBQA 2P0EA 3LLCA 3PKZA 2G6BA 3OE4A 5D00A 3SAJA 2WOOA 1J5PA 1RDFA 4LI0A 1YCDA 3ZHRA 1SQGA 2I8CA 3HKDA 3MCTA 3RHZA 1AMUA 3K0HA 4KQCA 1IHDA 2AKYA 1UEXC 3FYCA 2QJOA 3H1EA 1KFJB 4G5XA 5FBVB 4AU1A 4LKRA 2GN9A 3DMDA 1Z4IA 4JLNA 5G02A 1AKUA 5KYYA 2BGUA 5JD4A 3ZWWA 5JZ9A 2P9CA 1QRUA 4TXHA 3L40A 4X00A 2XDAA 3AI3A 4OK3A 4YJHA 4D5GA 2C7RA 4A0QA 2GFHA 3FYUA 5IZ4A 3ZHVA 5I5EA 5JO0A 5J5VA 1YTUA 1OBFO 2VP6A 5DCUA 2QPTA 3WP0A 1YH3A 3CGWA 4Q3LA 3A9TA 3PXDA 3QXGA 3VZDA 1YRWA 4WNIA 1YMVA 5DWQA 5JR3A 3EDRA 3G89A 5BN1A 1X77A 1TE2A 1U1IA 1NI4B 1Z07A 4FN5A 3OLZA 4JEUA 3NMUF 1N8SA 1X1AA 2IHJA 2AI3A 1KYVA 3O74A 3EIXA 1LBQA 1UKZA 2OGTA 3M0EA 4I9HA 4P92A 5BWMA 5I45A 4URWR 1NXQA 2GLUA 5KYUA 3C7AA 2VAXA 5T41A 3V33A 3O4JA 2Z2YA 3W8RA 4L0QA 1ECFA 1G6OA 4O6VA 3Q4GA 5CK4A 1CZKA 2X5OA 5H9VA 3ZE9A 4YUAA 4X85A 5E8JA 3D8TA 3JD4A 3NDRA 2JKZA 4IRXA 4H9GA 5TEVA 1ELOA 4LYDA 4EX6A 3LSYA 1FUKA 1WHTB 1V3TA 4F5WA 5K8UA 5DVZA 3DKKA 3UG7A 1I2ZA 1H5UA 4IHQA 2XXAA 1RI3A 1H2ZA 2JHFA 4FK8A 2JFHA 2WVHA 2CWDA 3S1LA 4ABYA 1LDGA 1QGOA 2ODPA 1JBEA 3KD3A 3IMCA 4MKHA 4LAFA 1MF7A 4KREA 3ZUPA 1UJ5A 2QMEA 5DXFA 4RTQA 5IT0A 4OSPA 2AN4A 2G5PA 2QX9A 2GJ8A 3UJDA 4KG7A 3N2KB 5E2AA 3C6ZA 2H2WA 2RKOA 2Z5VA 3DAHA 4ONEA 4XARA 1YVDA 4LEIA 3TL3A 3VKGA 3TM4A 3U3RA 1UC9A 1FFEA 1I7PA 1XCMA 1GAEO 1WUYA 3AW9A