4GR5A

Crystal structure of slgn1deltaasub in complex with ampcpp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
463
structure length
451
Chain Sequence
SNPFEEYDGGHVVLTDALGRHSLWPAGIAVPAGWSVRHGTDSREGCLAHIEHHWTDLRPTRAPAGACVHELFEAQAARAPDAVALLHEADELTYGALNERANRLAHRLVGLGVAPGTLVGVHLERGFDMVVALLAVLKAGGGYTMLDPQFPVERLALSLEDTGAPLLVTSRPLSGRLTGTTTLYVEDAGNLATGVGPEDVACVMFTSGSTGRPKGVMSPHRALTGTYLGQDYAGFGPDEVFLQCSPVSWDAFGLELFGALLFGARCVLQSGQNPDPLEIGELVARHGVTMLQLSASLFNFLVDEVPEAFEGVRYAITGGEPASVPHVAKARRDHPALRLGNGYGPAESMGFTTHHAVVAGDLSGTALPIGVPLAGKRAYVLDDDLKPAANGALGELYVAGAGLAHGYVSRPALTAERFVADPFAGPGGERMYRTGDLARRRADGVLEYVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-ribosomal peptide synthetase
publication title Structural Basis of the Interaction of MbtH-like Proteins, Putative Regulators of Nonribosomal Peptide Biosynthesis, with Adenylating Enzymes.
pubmed doi rcsb
source organism Streptomyces lydicus
molecule tags Ligase
total genus 145
structure length 451
sequence length 463
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF03621 MbtH MbtH-like protein
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gr5A02
3.90.820.10 Alpha Beta Alpha-Beta Complex Rubredoxin-like Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 4gr5A01
2GPFA 3RG2A 5BUSA 4PZPA 4IZ6A 5BSRA 3WV4A 4DG9A 3VNQA 4GXRA 3NYQA 5BSWA 4R1MA 4WV3A 3ETCA 5BSMA 3T5BA 3E7WA 4R0MA 4FUQA 4FUTA 4RVNA 3FCEA 5BSTA 3WV5A 3R44A 4GS5A 2Y4NA 3ITEA 3L8CA 1V25A 3O84A 5JA1B 5D6NA 3IVRA 3NYRA 4ISBA 4R1LA 3T5CA 3B7WA 3DAYA 5BUQA 5BSVA 3IPLA 3U16A 3E53A 5GTDA 2Y27A 4G37A 3VNRA 3NI2A 3E7XA 3IESA 4LGCA 3RIXA 3O83A 5BSUA 4D4IA 4GXQA 1ULTA 4IR7A 2VZEA 3LGXA 4D4HA 3QYAA 5DWVA 1V26A 3O82A 3IEPA 3C5EA 2WD9A 3A9VA 4D57A 3G7SA 4RVOA 5BURA 2PSTX 4GR5A 4E5DA 3T5AA 5E7QA 2KHRA 4M46A 2MYYA 3WVNA 4D4GA 4OXIA 3U17A 3PBKA 4D56A 4GR4A 5KEIA 1GH9A 3TSYA 3DHVA 4DG8A 3IERA 2V7BA 3VNSA 3EQ6A 3FCCA 4W8OA 2Y4OA 3GPCA
chains in the Genus database with same CATH superfamily
5JCXA 1BQ4A 1MH1A 1PP4A 1YL6A 2BELA 3OQNA 3KJZA 4YAIA 3UB2A 1KOJA 2GCIA 2AFHE 2YYAA 3Q5GA 3MXOA 5EA2A 2C7GA 1E2BA 1ONOA 1CY1A 1UEXC 1NJ6A 2KLBA 2RDMA 5AD1A 4WMLA 3T1HB 1R15A 4FYXA 3CJTA 3LTEA 2HA7A 2WYWA 1A9SA 3F8TA 4MOWA 2HDOA 3ENWA 3ZJYA 4ZT6A 6REQB 2X8BA 2WWWA 1PJBA 1PR3A 1ZVKA 4BN0A 3GJXC 4KPUB 4PIVA 5AFSA 4CIXA 2VRBA 1RKXA 5GONA 4JOCA 4DLZA 3VR1A 1K5PA 1Z15A 1JHZA 1KK0A 1QE0A 1VBFA 2YC2C 4DXAA 5JAUA 4XQEA 3ZVKA 1VRVA 3V1LA 3M70A 3AJEA 4GLLA 4ZCTA 1X1DA 2W90A 4L4SA 5IVKA 1X7DA 2IEYA 3LDFA 5CURA 3I04A 4R3NA 4DGQA 1H5QA 4F04A 4QGGA 4DILA 2GXSA 1I7PA 2JI6A 2Q28A 1PJLA 2Q2QA 3OEYA 1QGZA 3JD4A 3X3HA 3HCOA 1IN5A 4ZCMA 2QOEA 4IJ5A 1KR2A 1EP1B 2H1HA 2BR3A 4ERNA 3D3NA 3SZGA 3LWDA 3EF3A 1OAOA 4CU5A 3CISA 1RIFA 1TZMA 4EB8A 3PRKE 1U2TA 3CPEA 4N18A 2C20A 2HSEA 2OLJA 4H7EA 3TTUA 1TM2A 2PD4A 5KJ1A 4OB7A 4Q1DA 3RGGA 1FL9A 2Z0MA 2IS1A 3VNVA 1RJ9A 3N2EA 5A6VA 4QXQA 5JWHA 1F9EA 3GGSA 3S81A 1P18A 2QQ0A 4MIKA 1F17A 3MQFA 4YK7A 2NV6A 3UK0A 1UFKA 1TJPB 1WUYA 1ZR2A 1ACLA 2BD0A 4J49A 4LBWA 5CCEA 3C8HA 3QVGB 2JZOA 2P5TB 1POXA 1ZITA 3CRVA 1C0PA 3H17A 6AT1A 4LOIA 4RJ2A 4MHTA 1Q21A 3C0KA 3I2KA 2OL4A 4YCLA 3PGXA 1RI5A 3THWB 1MB4A 1ADYA 2BY4A 1VYTA 3V6LA 3DGFC 1G21E 1QCZA 2PGDA 3LVQE 1SXQA 2D5IA 5ALVA 1UBHS 1YUNA 3A70A 1ZGAA 5IVHA 4ND8B 3KQQA 4IH1A 3MRSA 1CS4C 1SIWA 3RGWS 1L5FA 5IAOA 2QP3A 3LU1A 3CUTA 4G07A 4E33A 1TQ4A 4X41A 5JDIC 3B1VA 1OFHA 4WXYB 3K9LA 3MYYA 4QXMA 2BJHA 2VG8A 5SY6A 1DOAA 2V03A 5JDCC 2BR5A 2ZWAA 3MJTA 4MKXA 1Z4JA 3RSHA 5B3JA 1JJFA 4G84A 1YA8A 3E5HA 4TVSA 4X65B 3VR2D 1Y8RA 4UUNA 1UQRA 1WCWA 1ZNXA 2TMYA 1LI4A 3AF3A 3HZZA 3IBFA 1JXQA 1SQGA 2BEWB 1O08A 1AXEA 2A0YA 3D0KA 5GZ6A 5IM5A 2KB0A 4FU0A 4JBLA 4PAMA 2BPOA 2HF8A 2YWFA 3KPUA 4KNVA 5GGXA 4N9WA 5HFJA 3SYTA 5A1JA 3EW7A 4P5DA 3FPKA 5AQ1A 4K6FA 3I9LA 4RCYA 1U5CA 2PANA 3PA8A 3G13A 3WWOA 2D1RA 2GF0A 3INTA 1UEJA 2A0UA 3IULA 3Q88A 1QH1B 2VNKA 3GAAA 2GYUA 5TQ0B 1YF3A 2H4ZA 4AZSA 4Q3EA 3MN1A 3OT5A 5COAA 1QO7A 3REOA 3X1WA 2HPZA 4JC8A 3ZCUA 1GNVA 2C95A 4FP9A 4TKLA 5H7XA 2GBCA 3HH8A 1TX4B 4YCBA 4E5SA 5KJ6A 2P2SA 3PR1A 4DIBA 1N9GB 3PD0A 3KU4A 2XWBF 2H2HA 1NE2A 1F06A 3ETCA 3GHYA 4PTZA 1U0JA 2POQX 3ZOKA 4DN6A 2JLXA 1CRQA 1WKCA 1PZFA 4JKIA 5SZJA 4AJEA 2A3RA 2QMUA 3S2ZA 1MC1A 4ZTZB 2FPGA 5LM3A 1NGSA 1CQIA 2GRUA 2JJMA 4OA5A 4AO6A 2UZIR 3C3WA 4DMMA 5JBQA 2HMVA 4N41A 3OC6A 5AW8A 1BS9A 3LKDA 5KX5A 1KIFA 5EXXA 1HY3A 5FJIA 2FDRA 2GR9A 3R44A 3TYXA 1JR3A 4Y6QA 3RUAA 3VPGA 4FKMA 5HZKA 5FOTA 3FVVA 4E2WA 3IAUA 4GECA 5L7WA 3BWYA 3LDUA 1FVOA 1DUVG 1UMDB 5KAPA 4LRTB 4QTYA 5BN3A 2YW9A 5T57A 1RRVA 1V1JA 2HPVA 3ESYA 3RS4A 2SECE 2H18A 3QTTA 3LW7A 3RU3A 2AJ8A 4A03A 3QVJA 3WBKA 3CNHA 2R6R1 4F2HA 3SEZA 5JFOA 4UVGA 2OFFA 4M9QA 3B13B 4ZDKA 2BOVA 2BFOA 1VG9B 4FZVA 4ITUA 4M1WA 4E6PA 2HSJA 2JK0A 3EG9B 2H06A 1KVQA 5FPSA 1T13A 2WIAA 1QHSA 2IW1A 4GDMA 4WOPA 2W00A 1VJ1A 4WZBA 5CA1F 1SRRA 1V5GA 2Z2YA 3IQEA 1AKRA 1YRQA 2J07A 2YH2A 1KSJA 4XIFA 1ZRSA 3THXA 3IXMA 1MHPA 4MVJP 3GT4A 4EAAA 2AN9A 3FYSA 3K9GA 1HDOA 1PKEA 4FPXA 3RANA 2HDHA 1CEQA 2QUAA 3KD3A 3TNDA 4DG5A 4L2IB 1XPRA 4WOKA 4EARA 5IAGA 3BXOA 2D4HA 4RWEA 4BO7A 4ENSA 2WJ3A 1MB0A 4R2KA 2GBPA 2ADFA 2DUJA 3DMYA 121PA 1D1TA 3EXG1 4R1SA 4A8PA 4AXBA 3PQEA 1KP3A 1AKEA 1RHJA 4PG7A 3SMVA 3T3HA 2DBRA 1ZU4A 2R25B 4G9BA 3WMWA 2C9BA 5AI8A 3D3QA 1J8DA 5A3QA 3V8RA 3HKCB 4ZU6X 4EGAA 5GONF 4LDQA 2J41A 1FXUA 5F76A 5FR1A 3GMDA 1A8UA 3GT0A 1E58A 2O5VA 3PEEA 4MV0A 1Y89A 1FVHA 3IKLA 1NSFA 2IYRA 3KT3A 1FYEA 1CUCA 1E9SA 1WXWA 4WNAA 1JS1X 4NMWA 5FAXA 1JBEA 2XB4A 2CL6X 3LZDA 5LQKA 5K99A 4KHPB 4H9GA 1RRFA 3EZFA 4ZCQA 2RH9B 4XJVA 3CWCA 1MRZA 3QLEA 1GUZA 4WN3A 1J07A 1AB5A 2RGRA 3UT5B 4ZHSA 4OMFG 1CWUA 1K2WA 1R3DA 1H6AA 2JD2A 1JA9A 2JGFA 3L1IA 1L4UA 4MVJM 2GRJA 3N7TA 4BMNA 3OU2A 4TQGA 3PHGA 2LTAA 4UHHA 4CM9D 4E30A 1G9TA 4UD2A 1RQRA 1DIRA 1KBQA 4R68A 5FQOA 4F1KA 3QFRA 3I73A 5DYGA 2GK6A 2RAVA 3U3MA 5JARA 4NONA 3RH0A 1Z5UA 3A2LA 3SQDA 2IU6A 2XVYA 5EZQA 4DM3A 5K7SA 4FDVA 4PYKA 5BNTA 3KYDA 2D00A 5DCLA 4ZEMA 3CVYA 1MVOA 3AX6A 2A9FA 4ODIA 4DGSA 2EFJA 5LZ2A 4XGKA 2QUKA 1KE1A 5BSWA 2P41A 5LUBA 2XCSB 3BL6A 1ZO8A 2X5XA 4JJKA 3LJKA 3HY3A 4MKZA 2UYGA 4M53A 1VPLA 3ZHXA 1TLTA 3RRBA 2PA0A 5BMVB 5AVJA 4I36A 3ACDA 3O75A 1LPBB 1Q1EA 3QP9A 1H0RA 2AJCA 1GDHA 4BBPA 5KMGB 3AUFA 5IMSA 2WW8A 1AA6A 5EWJB 1JHOA 4EHJA 5LLDA 4A73A 5I3CA 1UPBA 4O0LA 4PYJA 1QDLB 2AYYA 3K72B 4C4PA 2WJYA 1KSGA 1FCJA 1GGNA 4PPGA 3OZWA 5CCBA 3SXUB 1NV9A 3FSRA 3HEAA 3NP7A 4MZDA 4RELA 4EAQA 4RHEA 5SYMA 3EFBA 1BXGA 2QQEA 1JA0A 2YYSA 4HQ6A 3EPKA 5FAKA 4GAEA 3ZXXA 3H86A 3QVOA 2YUIA 3AHHA 5JSUA 3V1UA 5C7IO 1EVJA 4D9MA 3DUFA 4MVJE 1OWLA 4TQAA 3FWHA 4R1LA 4DSAA 2OE2A 3AW8A 2JI4A 3KAPA 4KI7A 4A8JC 1EGHA 4CFSA 1OX6A 1MEOA 3VM6A 4A2WA 1NFRA 3W5HA 5JW6A 1QDUA 1Q17A 4B6RA 4D3ZA 2DWOA 3AF1A 3ND7A 3DL2A 4EVIA 5TJ9A 3TL6A 1EXDA 1L1RA 4WESB 3T9CA 2JIPA 4POAA 1MAUA 5T3YA 4CKEA 3E3NA 5EOVA 4HB2A 4MS3B 3V1NA 1OXBB 2DR0A 2G3YA 1YVUA 1JIXA 2HLHA 4MR8A 3WQHA 4C6RA 4MWBA 2MR5A 5HYVA 2L19A 5KJCA 2CDRA 2WT8A 3V1MA 1UP7A 2N1MA 3W5VA 3ES9A 1G55A 8AT1A 4UVHA 1VHJA 1IH8A 1YWGO 1GTL1 3QE3A 1G3MA 5TDHA 4DUPA 2HDWA 2IKSA 1CUJA 3EXEA 5SZIA 1WZIA 1QHHB 2HRCA 1GP2A 4D0NA 3GMSA 5LP1A 5FA6A 3OUUA 2B5WA 3L8YA 5G3YA 1O8BA 4PPFA 5AVXA 4CIDA 4HX2A 1FTWA 3GOHA 1L5QA 2AC7A 5DX1A 2BMWA 2E1RA 2KW5A 2NO6A 4B2LA 4LV8B 4KO3S 3F96A 4MP8A 3WJ2A 3M7IA 1O0SA 3FNEA 3L1HA 4HPXB 3ZBPA 4ENTA 3NT4A 3ICWA 2YS7A 1EX9A 4LXXA 3U0BA 5KX5F 4LY0A 3TBKA 1AG9A 2H48A 3NVMB 3Q6NA 3HU2A 4MVWA 2UU9B 1GUDA 2LIVA 1QIKA 2QR3A 3LPCA 4E94A 1I4DD 1XCBA 2WV7A 1FLAA 4S3MA 2XUFA 5LWQA 4W5RA 3FPHA 2PBZA 4FYWA 3VYRB 4UATA 2P78A 1F1BA 2J3DA 4FC7A 4D56A 3E0XA 4X1IA 3FDJA 3OP1A 4ZVQA 1FNNA 1TJYA 1IBRA 3BXGA 5CHEA 4JKOA 2BFNA 3ZZNA 4NOKA 1DFIA 3ILSA 3ZGLA 4OP2A 2D0DA 1U7HA 2WILA 2VJLA 5EKTA 5LA6A 3VYWA 3F8SA 3N59A 3ADCA 1SY7A 2FR1A 3HV0A 5JAPA 3SXPA 1LBQA 4E0BA 3KQOA 2PU7A 4RA9A 1ZW1A 3W7AA 3H9CA 1D2RA 3B8HA 4RDIA 2F1RA 3SQMA 4CQLA 2WD7B 4QOJA 4WZ6A 5EPUA 1PEYA 5LDDC 2I1LA 1I5RA 2HRZA 3QPVA 2VWPA 4DNFA 4R8LA 2V6BA 4KQWA 3PICA 3BRWA 1MJHA 1ETHA 3UTDA 8ABPA 3CQ9A 1Z36A 2CE7A 3LKZA 5F3DA 2G80A 1MGPA 3HFRA 4D26A 2CUKA 3K15A 5EN4A 3BXPA 4E2FA 2OORC 4PO9A 1I6LA 3JZIA 4RSRA 2FK8A 3D31A 3SF0A 5AVKA 3RC3A 1HLFA 5EHGA 3PHBE 3QLUC 2VUIB 2NXCA 4FM9A 2WMNB 2SKCA 3KBOA 2GJAA 3EH1A 3GNQA 3RB8A 4E5YA 4ALLA 3O8LA 2PGNA 1KZ7B 1J70A 4JVMA 4BLOA 3LUGA 3MWFA 4PG5A 3U56A 5E6UA 1DU4A 2NTNA 1RAHA 2BM8A 4ESOA 1DG9A 4M76B 5SV2A 2O1EA 1K89A 2XDYA 4F3NA 4PC7A 2PT6A 1JZTA 3PNVA 2XSZA 1PW5A 2EYUA 3FWKA 4C0HA 4W5QA 3TSZA 3QKRB 2KLHA 3KCNA 4M8IA 3NIFB 3PFKA 4PQYA 5KQSA 2W9XA 3U5TA 5F51A 4KNYA 2NYRA 2QZ4A 5H3CA 3E53A 1UP4A 4JV5B 3RVRA 1Z88A 4OL0A 5E2IA 3BT7A 1DEOA 3U7RA 5F2NA 2J3JA 4C5CA 1WL8A 2ECKA 2HU7A 4JR0A 3DEFA 1LGYA 1UFVA 3QSGA 1N36B 4KFTA 4ZT2A 4I1RA 4NFHA 1UINA 5AHXA 1CE8B 3AP1A 5JALA 1AGYA 1JE1A 1GR0A 3RRYA 1I80A 3KSDO 4PNHA 4DJJA 4M9ZA 3RKSA 2QW0X 1VXOA 3G8CA 3IUJA 4UMVA 3V7FA 2C2BA 3K1AB 2QUZA 4QO8A 1MBZA 4ZOLA 1NZFA 4EQ6B 2V96A 3C1AA 3C4QA 5IN4A 1DJOA 5J1SB 3B6JA 1ZMBA 4EQZA 3QSYA 2QD4A 2CK3D 3JZFA 4CM9A 1T2DA 3GYBA 3OFJA 4U7DA 3T5PA 1JDVA 3UXYA 3L7JA 5KS2A 3NHAA 3H87A 1L4HA 2VK2A 1DKQA 4IW3B 2VF7A 1YJ8A 1YOBA 4K9QA 5HMMA 3WLAA 4YRQA 3F2VA 3SC4A 3WIEA 4B3TB 1XA4A 5L4LA 4I81A 5ECWA 3TI9A 4BNDA 2H16A 2Q1XA 4QSHA 3LXMA 1H1TA 1YRBA 3PSHA 3BQNB 1V7QA 4I19A 1RXVA 3DNMA 4OFXA 1NNEA 3AVYA 721PA 4NCJA 1J2JA 3DFMA 4RGQA 5G0UA 1TJ3A 2YV4A 5ADUS 1TJNA 1FTGA 4CMBA 3ESCA 5IK2D 2I4RA 5TIIA 1U9YA 2HQRA 1Z6PA 2ID9A 3VZPA 4CQMB 3NBXX 1H6DA 1TM1E 1EUZA 2Q0HA 3P2MA 3TPZA 1XIVA 3TRHA 2RKWA 3Q87B 3UHAA 1WB6A 2CNDA 2JK1A 3I58A 3LX5A 3ITKA 1ZWLA 3QYFA 2R66A 3FVWA 3D6NB 3PGMA 1H2EA 1O6BA 1UANA 4OYYA 1Y5LA 3QXJA 2OAEA 3DLAA 4A23A 2PMBA 3CNLA 4FS3A 4Q18A 1LU9A 2WKQA 1VL2A 4MR7A 4BX9A 5K6RA 2X4GA 3RG2A 1U6JA 3LUKA 2OCXA 3IE0A 4QUKA 1NAIA 2NVUB 3KTOA 1RE0A 3R2JA 3EHDA 3ZJUA 4F7DA 3SOZA 1KQOA 1P0CA 4IGFA 4QYIA 2X42A 3W6OA 2FZWA 2Z3ZA 4GEKA 4Y9TA 1JHAA 3HA3A 4TLDA 5FT9A 4RPLA 5ALIA 1NJ5A 1MW8X 3NH6A 1U3TA 3V2GA 4OHUA 2PKQO 1OJLA 3JWJA 4GRIA 3BMCA 1TMGE 4M7PA 3UANA 4YMGA 5BW5A 3A6EA 4L6AA 1VI2A 3D6TB 4KACA 1QV9A 5HQ3A 3ASVA 5KJFA 1U0RA 4KGXA 5BSTA 1PBTA 3A58B 3ZV5A 1WZEA 1P9LA 3AOEA 3PJEA 4I55A 4YMVA 3EY4A 3ADOA 2ZB7A 4LTNA 4JL8A 1C8BA 1A4UA 4N7RA 1OILA 3UVEA 3ZUGA 1P80A 5HIJA 5G0SA 3HL4A 1ETUA 2QKYA 3GJYA 5BPHA 1JHMA 1MEEA 3WWDA 5GIOE 1M2OA 2B8JA 2GEVA 2P1ZA 3PXEA 1CQPA 3DT8A 1A2OA 4YRAA 1PFGA 2C4KA 1R0LA 3O4FA 4V1CA 2C54A 4NVRA 3LUFA 5BUZA 3CZAA 5JNWA 3BL8A 4MUFA 1U2GC 2HUNA 3C3PA 2G9ZA 2FJUA 2FUG6 1TFRA 3OE1A 1TA4A 2FP4A 2GN0A 4WY2A 4H7FA 3T5TA 1P33A 2GNPA 1U9CA 1ECGA 2Y27A 2GRAA 2YJTD 3L2OB 5H1YA 5LA6F 2FU5C 4FXOA 4JELA 3S8MA 1E7WA 3GYGA 5A3VA 3BH0A 1SG0A 1YC5A 3IJ5A 4HXFB 4X97A 1Q6YA 3PPWA 1NPYA 3BCSA 5BSUA 3LX4A 4BFTA 5MF6A 1XZHA 2D8AA 1K7YA 2Y0EA 3HE3A 5L3SB 2ID7A 3VTAA 1MU0A 1VSUA 3AR2A 3LF1A 1KEUA 4YMUA 1GRCA 3B6ZA 4TWZA 2DY1A 1ORVA 5DTMA 1IN7A 2ISSD 4C2AA 1RRCA 2WE7A 2QX8A 1P7PA 2IF2A 2X15A 1VMEA 3L04A 4K9PA 4QIHA 3WLSA 4MI6A 4CTOA 5ITWA 4MV1A 1GA4A 3HCFA 3PQ5A 3T8YA 4KE9A 3G7SA 3NHSA 5E9WA 5F77A 2QLLA 4BJ6A 1P1IA 2ACVA 1I0IA 2C0QA 4NAUA 4RHXA 1O7JA 4URUR 4I4LA 5AVTA 1J23A 2IS6A 3I4LA 4I4CA 4U3JB 3R8XA 4LJ9A 3O4GA 4BRUA 1UJ6A 3G0CA 4CMCA 2GCNA 3A1UA 3DZBA 4HAIA 1SVOA 1TYBE 5GJCA 3TR5A 3EA4A 3Q7RA 2ORVA 3ZD8A 1ONBA 3UMSA 2FYTA 1XDUA 3HU3A 4CLOB 1TO6A 1EVQA 2AGVA 3E1SA 3IEKA 3AKYA 4HVCA 3BFVA 4C21A 5EQTA 5CAEA 4EI8A 2JA2A 2PUCA 2VT2A 1Q0QA 3FGOA 5B7GA 4XDZA 2SBTA 1JG1A 5KHAA 2L0XA 2PRKA 3EGEA 1HT3A 3D2CA 4X3CA 1XEWY 2VYCA 3LQFA 2GPJA 3F1KA 1CDOA 4WY5A 1E1RA 1Q7GA 2GLUA 3G2NA 3UOAB 4JDPA 2HQOA 4K9KA 3OIDA 2OTCA 1QOQB 2EEPA 3DZCA 2FOXA 2FMTA 4M8NE 2CLDX 3TTSA 1VPVA 1ZZEA 1XRQA 3I62A 4HDQB 4URZR 5LD2C 3N75A 1OLOA 3GRKA 3HUUA 1PJ4A 5ALNA 4CR7A 5HKOA 5DLPA 4ZOLF 3MIZA 1D5WA 1RXYA 2QN2A 3I5AA 1K98A 5HP4A 1HX7A 2IU0A 4Y8VA 2JJ8A 2OBFA 2V5UA 3E1GA 3KAJA 4M0DA 4ZJPA 3F7MA 2VR1A 2AFVA 3WBBA 4JUIA 4NH0A 2AG5A 4X20A 3D64A 1M5RA 3GEDA 1S3GA 4R1PA 3R9KA 2PX4A 2FH5B 1FP4A 1P1JA 3PEYA 4ARAA 1HKHA 2P3LA 3NV7A 1IEVA 2ZT5A 4D46A 1W6UA 2R62A 2GS9A 2QN6A 1QS0B 1FS4A 2H2GA 3IBSA 3VX3A 1U80A 2PJDA 2JLBA 2JHAA 1MQSA 3GDOA 4JQYA 1E3DA 2VT7A 6GPBA 1CB7A 4U7HA 1E99A 2D5AA 1RHKA 4U4AA 1SKMA 1JH8A 4PVDA 2ZB3A 4UMFA 5EAIA 3NATA 1KJYA 1Y7HA 2DR3A 4FOSA 1A0OA 3EODA 2GFQA 4QBKA 4DNXA 1JEEA 2IE0A 5DXJA 5CW2A 3GNTA 1PX0A 2BISA 4CLHA 1VJDA 2NNLD 3PQ8A 4OHKA 4YDQA 2Q5JA 3O0DA 4RWZA 3WNDA 4I9GA 2O7SA 1GV1A 3NM6B 1WBJB 5U9CA 3GCWA 4IDNA 3H8JA 3HK2A 2FEOA 1RQPA 2ZB4A 2BI4A 3A9SA 1CZUA 1Z33A 1HWYA 2BAGA 2E3JA 1JEQA 3HRIA 3OUZA 1XVTA 3Q2KA 3QEMB 3X1XA 5KNBH 3MUNA 3W1VA 1EZ4A 2PGJA 3FBTA 4XVRA 3OF2A 4L5BA 2GASA 1EQAA 1WA5A 2IIBA 1XZAA 1OTYA 2JGIA 2ZAIA 3ABQB 2OHHA 2VDUE 3C4VA 2POCA 4KRYA 2UUAB 4YV0A 4KEAA 1US8B 2GZ1A 4IHJB 1QH8A 4XLLA 3O8QA 5FORA 2JCSA 3TVYA 2GZSA 4MQ6A 1Z4LA 1L7RA 5IMBA 1X77A 4URVR 4G0MA 4MCJA 3JZDA 3WWZA 2V3CC 3AIIA 2IS2A 1ZMTA 3NUZA 4BLSA 1GG5A 5AKJA 1WPXA 2OAGA 4E5DA 1HSOA 1DZ3A 2BGTA 4I55F 4ZO8A 5KTSA 5LYJB 2O20A 1L4EA 3NETA 3TKLA 1T43A 2WSSD 3WVNA 4D4GA 1SVKA 4JT2A 1CZHA 3OCXA 1FSFA 4B45A 3EGWA 1WV0A 4XVCA 3LCUA 4F8YA 5KTTA 1Z4NA 3CS3A 3OFSA 3OPYA 5GONB 3CW8X 3UHOA 1D1PA 4QE3A 4OQYA 5B1DA 4ZFNA 5CEEA 3PK0A 4LK3A 1JKIA 2Z8YM 4PRLA 1PFUA 3AJDA 4C3OB 1R88A 1U5AA 4MYTA 5K09A 3U3JA 4R98A 1FFHA 1AHHA 1Y4UA 3FMFA 1B4DA 3QX9A 1O9GA 4P7GA 3PVZA 1YXMA 1PWZA 2FPIA 1U1DA 4MIYA 3GRCA 1LRKA 2OBLA 1U0HC 2R8YA 2HGSA 4GD3Q 2CUZA 1TF2A 1B73A 2FPSA 3VSBA 4FILA 4I8IA 3DPIA 1QRUA 2G5CA 2GXQA 3GGOA 4WK2B 2AD5A 3PV0A 5D85A 4PAQA 1GKLA 3F8WA 1QGDA 3CN9A 2GHRA 4CEHA 4G56A 1ESNA 5BYBA 3T5GA 2PM8A 5PGMA 5EHQA 1E3LA 1NMQA 1V37A 5IFLA 2D06A 2YIJA 3K9NA 1U6KA 2A3NA 2EJWA 4IHKA 2ZI7A 4F56A 4R0MA 1RLIA 1RJ9B 3UB3A 1VGVA 4K9SA 4XA8A 4WBNA 1WQ3A 4RNDB 4UCWA 2WU1A 4WDRA 4JL6A 1BEEA 3CLSC 3HXKA 1WMEA 3L8EA 1MEJA 2YCBA 4Q05A 4RKQA 1RKVA 1XTBA 4EKEA 2WWRA 2DPYA 1ID1A 3HR7A 4YJHB 1OB5A 4E2YA 3BAFA 3IVRA 5IKOA 1SKQA 4BYMA 5HRAA 3A1DA 1R5OA 3S68A 4CF5A 3O8RA 5JZSA 2DR2A 4FLMA 3Q4GA 3D4BA 4HRAA 3VYUB 4RFSA 4YUYA 3U3RA 1DADA 2WYIA 4W1SA 4EUSA 3GBVA 3MW8A 2Q45A 4C3UA 1WZNA 3MWLA 5EZ5A 3SKXA 5BSVA 1BYIA 5EFOA 4AJ4A 1EFVA 2IRWA 1D8AA 1VTKA 1X1SA 3AINA 5HGXA 4GU5A 2H3HA 5BR8B 5ELXA 4KFCA 2I6SA 4N5HX 1CSEE 1LVHA 1K5HA 2ID4A 1VPTA 4JIGA 4PSDA 3TZ6A 1H2FA 3LY9A 4UEQA 1J20A 4V0RA 4B3CA 5C1OA 2N1BA 3WY9A 2F7SA 1E8DA 3A6FA 3ETLA 4MYUA 1OFGA 1WWKA 5LPNA 1EVZA 3QNMA 2VHEA 4H35A 4HRVA 3ZX4A 9LDTA 3NMUF 1QOPB 4I50B 3NEYA 2B8TA 2HDNB 2IVZA 3O0TA 4H3KB 4PYRA 5B7NA 3MEQA 3CR3C 1IAQA 4LZWA 1CCWA 3QFTA 4ZZ3A 3RYTC 3OG9A 2G0AA 5I8WA 2H8KA 2Z08A 4KLCA 3HJGA 5K2OA 3VR4A 1A88A 1SBIA 2FFAA 3LCRA 3R5HA 3RYCA 2ZUCA 4GO1A 4MLZA 1ULUA 5FA8A 1TF5A 2Y05A 2CF5A 4RDHA 5BR7A 3E2IA 2IXGA 1TVEA 1NVFA 4TKZA 3ZZMA 4F4DA 1IUNA 4OGGA 4Z9AA 4DRXB 5JAZA 4AY5A 4KR2A 2A9PA 2XE7A 4QBIA 4JJ8A 4AUNA 4FDAA 4PU0A 1PX2A 2QQ5A 4RJTA 4OU4A 1KK3A 3RFCA 1NY5A 4BV3A 2X3UA 1EJ0A 4RE5A 3T3OA 3FLBA 1U7TA 2PUEA 4NHEA 4AK9A 1YFZA 3AERB 3UMRA 3QKWA 2V6GA 1DTWA 3B6EA 6CHYA 3TINA 2MYYA 3VNBA 3ZDDA 1ONSA 3MMSA 4GMFA 2QGNA 3WIVA 4TRJA 1E1CA 2GFHA 2KBEA 4WXHA 1ACJA 2N9UA 3ZHCA 4EELA 1C1YA 3BB3A 4LVNA 4YA6A 1NOIA 1RLMA 2QDXA 1DINA 1K6JA 2FPGB 2L18A 3ABSB 1NZJA 4GQAA 4A91A 521PA 4BNLA 1WXHA 1E32A 1KFKB 3ZE8A 1GCIA 2XGGA 4R01A 4O25A 4O5OA 4M0PA 4NEGA 1DLIA 5FBQB 3U61B 3AHDA 4L72A 1U5BA 1WXDA 1PT9A 3NNNA 5FRDA 1DX6A 4B3JA 4F21A 2NT3A 1PUXA 3MWEA 3R3WA 4RKWA 3A11A 4RTRA 1T6NA 2BGMA 2ET6A 3EXAA 2CJYA 4TRMA 2R7AA 4ENRA 2PZKA 1TZBA 4KBGA 1LY1A 3C5VA 1PGOA 1JTVA 3WIUA 5HIKA 3I2HA 1IHDA 5HUJA 2HIAA 1A04A 2LGJA 3FPJA 1QVVA 3SE7A 4RACA 3TI7A 4QFBA 1ZJJA 1FLNA 4P2GA 3UGQA 1F3OA 4FE3A 2OBNA 3IPRA 4ZYLA 5AVZA 4C89A 1E59A 1E1QD 4JROA 1IHOA 4RZXA 3C74A 5TNXA 4EPVA 3FPCA 4KSBA 3UIEA 4FXPA 4OI0A 2H08A 4O59O 3TMKA 1OI3A 3OKAA 1KMIY 4G5SA 1P60A 3NHKA 1QU3A 1EFPA 2VBCA 4UHBA 2C9DA 4MRMA 1J2EA 1N8TA 1ZRMA 1ZEJA 3T7JA 5KYYB 1ZVMA 4KYTA 5GMOA 4Z2YA 4ZI2A 1PR2A 1ZPDA 4B46A 4TWAA 3WQSB 3THXB 3JPYA 5KNDD 1DKRA 4ZV4A 1K2VN 2NADA 3IBCA 2ENWA 3BE6A 4MJ7A 2X9VA 1NMZA 1QM5A 1TEVA 2VYNA 1RZVA 2YUTA 1JXAA 4WOBA 3ZHVA 4F9EA 1TPYA 4L4ZA 4LXHA 2YMLA 1K1EA 1DKUA 1Y6ZA 1ZBQA 3DOCA 4YGYA 2HT6A 1MD9A 1WHSA 2A9KA 2PN1A 3I5MA 3BF8A 2J9XB 2O2JA 4R7ZA 1QBGA 2QRGA 2UKDA 5ICEA 2VFAA 4GFDA 1YS1X 4EK9A 5NULA 5JSHA 4D9GA 3LIIA 3GN2A 1XL1A 1ZMOA 3R3HA 5HVNA 3TFOA 1ND6A 2EX0A 2HNAA 2WHPB 3SFZA 3G9TA 3W3ZB 4BFSA 1JFVA 3KQNA 1YDEA 3HXMA 1D0SA 4A0GA 4YXWD 1JIUA 3S8EA 4QU5A 2FW1A 2P5SA 3M5PA 1LQTA 2QT0A 1VIAA 4IFIA 1QNFA 3OKPA 4NFLA 4P1ZA 3R9XB 3OCVA 1F2VA 1F4LA 1IPHA 3IMFA 1KH2A 2GH1A 1XYGA 1PK7A 5T67A 1NQWA 4L8LA 2GT1A 2JFBA 1IB6A 2OG1A 1FNSA 4JAVC 4UNIA 4CV3A 1DAGA 5BXYA 2GZHA 4UAVA 4EG0A 2G5PA 3SZRA 1I8TA 1SVMA 1YB7A 1RAFA 3DKKA 1QXSA 4C04A 5BWLA 4HN9A 1IWBB 1T5SA 5DLYA 1BO6A 5JEEA 1EHCA 4D8TA 4Q7QA 5CX4A 4P53A 2J3LA 3VHLB 4JC0A 3V5NA 4XX1A 2WQ7A 3QKUA 2C0PA 5TMBA 3LUBA 3AKEA 3BL5A 2ODTX 3IHLA 4FW8A 3FWZA 2FEKA 1O4VA 3KYDB 3ANSA 5G0VA 4CF7A 3N87A 4NV0A 2AN3A 4WBNF 1QMGA 2JNWA 3IR5A 1OTXA 1NNLA 4J7CA 3KUKA 2XA2A 2BGLA 1R6XA 1M34E 1Y4SA 2GCPA 3QLTA 5CGQB 3EQ8A 4QLBA 4ZYUA 1M10A 2GXAA 4Y1EA 4K9LA 1EUDB 4KWCA 5DEOA 1CY2A 3ZCTA 4ZC1A 2X0EA 1B6SA 3IMCA 1QVAA 2RKBA 2B3TA 2TECE 3KNZA 3MSXA 3R7DA 1VE1A 4DCMA 2QI9F 1GDTA 2XQGA 2R9VA 2NSHA 1JVSA 2CLMB 1W1UA 3PRJA 2C84A 1WRBA 4ZCPA 2P2YA 5I8ZA 1PJ8A 2IHZA 2QAGA 2RK3A 4ND4A 3T15A 2MSCB 4JLKA 4NV3A 2GETA 4BWFB 4N65A 1VJRA 3EC2A 1E0JA 4FYVA 2UUCB 1YL7A 2RGXA 1KP9A 1ZK4A 1TU3A 1Y5NA 3EIWA 4P83A 3TOXA 5JD4A 3ANLA 4QQ8A 2OLEA 1E89A 4B3XA 4DDVA 2W2MA 2IPMA 1CZOA 3GLFE 1JAHA 1FTSA 2I99A 3MWGA 3ELWA 3N2ZB 2P9FA 2OUKA 4B09A 4OBXA 3K92A 1S8OA 4YJFA 4YONB 4XQ0A 5PNTA 2I67A 4J4TA 4YRPA 3WL8A 3D2AA 2CXHA 4JVSB 4KLAA 1P0MA 1WTCA 2G5TA 1E4YA 3WB1A 1GG9A 4MTCA 1N6RA 5LJLA 4ZOQI 1KI3A 1U8TA 3EOZA 5GAJA 3BB4A 2J87A 4FD3A 3UH0A 1XZKA 3VX4A 1B2LA 1GILA 1E64A 1U8ZA 3HR4A 4TYNA 4J3JA 3RQIA 2V58A 4N3AA 3PYMA 4PC3A 4Y67A 3ETGA 1Q50A 2PAFA 4UAGA 2PT7A 3EIFA 1D7AA 1DJLA 2OBMA 3FWNA 5LQJA 3VDMA 3ERCA 2PUBA 1F0YA 1C2TA 2JF0A 3NHMA 1LWOA 2L69A 3PG5A 3QGMA 4JKYA 3ZWAA 4B7CA 5L53A 4QT4A 5JSQA 4IWYA 1NF9A 4XR4A 4I5IA 2JPDA 5DNEA 1TUIA 5DI3A 1TI7A 1UQUA 5E7MA 4F06A 2EHJA 4OX9Y 2IZOA 2Y8EA 1GZ7A 3U4QB 4CETA 5LSAA 2DFPA 1PR0A 1N2GA 2MU1A 2XEXA 3MBIA 3NANA 4GX1A 4MI9A 4UZFA 5EE9A 3II6X 1KNXA 4O8ZA 3WNCA 3T7AA 3I0ZA 4RJLA 3U49A 1YZ3A 4CMGA 1KY2A 2AJTA 2J4FA 3GP5A 1W4CA 5D6OA 3AEXA 2EKLA 3GMIA 3QOXA 1M1YA 5CT5A 1QLWA 1Z6XA 2CJFA 2R1UA 4PYOA 5BWNA 4A3SA 2KPOA 4TXMA 1YVRA 5DHAA 4M86A 5F7OA 1JWAB 2CNOA 2DT8A 1BSVA 2FR8C 1G1AA 1NNSA 1U6IA 2QENA 2W6CX 4ZDWA 4QHTA 1RXSA 2BMAA 1OC2A 1A7JA 1V8OA 2WM9B 2MYNA 4X1IB 4A0HA 2XXJA 2XIQA 1J5EB 2BF4A 3WP0A 1K88A 1SCUA 3LFHA 2Q0XA 3EC1A 3LQYA 5DDIP 3CZCA 5DYNA 3VHXA 5CEJA 5F3RA 4TS1A 1MXFA 2F9FA 2NPOA 3GARA 4UNQA 5LA6B 4KXYA 5JCJD 3H5VA 1UAGA 3ZU4A 4XCQA 4MV4A 1YQQA 3ZWWA 2IH5A 3H3XA 4LSGA 2X22A 2QSYA 4RA9B 3E3LA 1U3WA 5J40A 1KO4A 5K3FA 3UN1A 1E1LA 4CQLB 2ZIUB 5I9MA 1V45E 3QKIA 3DTVA 1CUHA 4HVAA 1UJCA 4M46A 2XCQA 1NVUQ 3HGTA 2MTBA 4PFKA 4XJXA 1KU6A 1NP6A 4U2EA 5EI5A 3Q85A 3DL7A 1CF4A 4L0DA 2IYFA 1GH9A 2QM8A 2Y3IA 2Z1MA 1PT8A 1KIAA 1RXUA 2OGZA 2YYYA 3G68A 3RS8A 1VCMA 2H52A 1C3VA 4CKWA 1R6AA 2WHYA 5AK5A 5H0IA 5IYZA 3ER9A 3TCNA 4RENA 3LQKA 5EIAA 2ATXA 3ASUA 3ZTYA 3LBAA 3N0VA 5G1OA 3AV3A 4HEA6 2ZP1A 1G0OA 1OFUX 3L7CA 3Q9SA 3STXA 4B3SB 1XD2B 2BBTA 5KNDA 5JJLA 3Q3EA 5F1OA 1L4KA 5DGCA 4F85A 1KYWA 1J09A 1N2EA 1M2VA 1P62B 1WU7A 1YHYA 2CMDA 2JIOA 3PNMA 4HLNA 4EBBA 1YZNA 1WMFA 2C03A 4LAFA 3R7WA 4N6GA 1F48A 4YO8A 4L76A 4XYEA 3WKEA 1M33A 2XAUA 2R7MA 3OE7A 2OK8A 1S8NA 3BREA 3IUPA 3KOUA 1E5DA 4NF2A 1ADCA 2YQZA 4RPKA 3FNRA 1YBVA 3PDJA 4N3GA 3GGDA 1BGVA 4P80A 4EI7A 4NH4A 3EPHA 1NYTA 2VTBA 2XYRA 3NJ8A 3F74A 1FC0A 3OQ6A 4YI5A 3PC6A 3CXUA 5CYPA 4C2BA 2EW2A 4DADA 1D2MA 1GR1A 4B74A 4OGKA 1QWOA 2O2ZA 4CM8A 3G85A 1SUAA 4EBFA 2N42A 1J2UA 1DO0A 2CLEB 1GQSA 3H9EO 4RADA 4P98A 2TMGA 3R77A 1XQVA 4LYJA 3T54A 3DOFA 4P35A 1KDOA 4M0LA 4FSHA 2YWGA 3I6YA 1EX1A 2V98A 1DPGA 7AT1A 3ZXSA 2VDLB 3AUXA 4FMBB 4C7KA 4ZOLB 4BRSA 3PITA 2W6ZA 3OU6A 4X00A 4ZK2A 5K51A 5IZ4A 1IJBA 1OT3A 2Y1KA 4AQ7A 3B12A 3ONFA 5BP7A 1ZN8A 4GP9A 4A7PA 1N6KA 2WWVD 1EMDA 4XB1A 3V00A 4B8WA 2BGJA 4R5HA 1NW9B 4I6JA 3FM9A 5AH0A 1TEXA 3K6RA 4OHZA 1VLJA 3I0MA 3PXXA 5I47A 1L5HB 3VSEA 4W5HA 4AJHA 4BNDB 4LRXA 3IOMA 4F1WA 2CDNA 2I5PO 2XH8A 3VC7A 4NXNB 2AMYA 1DX4A 2IHKA 3GLGE 1RZUA 3URKA 1RFLA 1FP2A 2XUDA 4D4IA 2PV0A 2WF8A 5LP6B 5JATA 3AHCA 2QZPA 4W8GA 5LXTA 2F8TA 3TZLA 3KV1A 1Y7LA 1PFQA 1WV1A 3MGCA 4WZAE 2ZFUA 3UKDA 4AY4A 4B6FA 5KIAA 5KYUB 1JW9B 1NKVA 3QELA 4PHGA 4WASA 3W77A 4S05A 1U0FA 2WOOA 1KEVA 4L9RA 4R71A 1XP5A 1U7WA 3KVRA 1Z4KA 2CVHA 2NVBA 3QNWA 1ODLA 1O6GA 1Z4QA 2ZYWX 4QUHA 1GNPA 5EQJB 4MR7B 1GXSA 3L41A 3NTRA 4AKTA 3MTEA 3LVBA 3UJNA 3C2QA 3HDJA 3L8GA 1W85A 2MSNA 2IPNA 4QYIB 5F9HA 1N25A 5HRUA 1J25A 2YHAA 1THGA 1EQUA 4DMCA 4YLEA 2NUAA 4TMZA 1YRYE 2RB4A 1GZVA 1K7SN 1MFPA 1TYZA 1XMPA 4QZVA 3GJ3A 3DL0A 3DTTA 1QIDA 2JBAA 3E03A 3LL7A 2I6QA 1KDVA 5JNVA 4I8DA 5LYYA 3L5OA 5HQ3B 4FWTA 2ZJ0A 3LA8A 3P9PA 2PL3A 3EQ6A 2X6TA 1F2UB 5COBA 3U44B 2J7PA 3O2JA 1BNCA 3VNAA 1E3MA 4WCFA 1KVUA 1I01A 3QQ5A 4OBBA 4I55B 1W29A 3HMQA 3JQ9C 1KJNA 2EERA 4IFBA 1QR2A 4JR2A 4LECA 2VQSA 5G4KA 1YMVA 1KMNA 2KMLA 2M1XA 4X9XA 5JRZA 3O1JC 3PKZA 4L6IA 4IAOA 3BGOS 3EMDA 5H81A 2PL1A 3Q6IA 4F7WA 1M2OB 2CMKA 3A26A 5THXA 1YJ5A 1QZXA 4EECA 1SMKA 4LTDA 2M6KA 5A04A 1HFWA 2VL7A 1UXOA 1KJQA 3OKCA 3P32A 5KNBD 2B1GA 2CMHA 2DVMA 2EVWX 2ZUSA 4P31A 3SPXA 2HWYA 2WZBA 3ZIAD 2X40A 4RK0A 1AMNA 4K3UA 1EK5A 3M5WA 1FNBA 3MSCA 1P5JA 2EEZA 4QDJA 2AEFA 4KAXA 7REQB 2PSFA 3MMPA 3WRYC 4V1CI 1I7LA 2FA9A 2Q8PA 3KQTA 3LDAA 2PUJA 1U0SY 1E5XA 2YOFA 4FCTA 4IIEA 5CTJA 1RXCA 2QE7D 4YAUA 2XCRB 2B25A 2G9NA 3ROQA 2Y0BA 1DBQA 2EYQA 4JX9A 3ZYZA 2O0JA 1KARA 3H0KA 3PIIA 2IXBA 4UZEA 1BJRE 2YHUA 4Q9AA 1DBVO 1T8PA 4P4NA 3LCCA 4KUGA 4EIWA 1B8UA 2NOAA 3LLSA 4KWTA 1LC0A 3HKEB 4AY6A 1XF9A 2GNOA 2R6CA 3E5RA 3DEJA 4R5MA 4XUGB 3SSMA 1P5FA 4DREA 1TKRA 1OAKA 3CO5A 2VRCA 3B85A 2XLCA 3DOUA 3I9V1 1W36C 2IEIA 3B9PA 1XLVA 4XCVA 1X92A 4KFRA 5T6MA 1B93A 3PL1A 3THOA 2ZIGA 3V8VA 3RW9A 3CR7A 3JALA 3FMPB 1ODIA 3EIEA 4XGNA 4X60A 5H9VA 2LKCA 2XVZA 3GHHA 4CMJA 2ZCJA 3OFKA 4HDCA 1OU4A 2WVJA 3KHKA 2AQ8A 3ZHTA 1WMBA 4MB6A 3UAVA 2RKOA 4TXJA 2EZUA 4MHOA 2CN1A 3WWCA 1SGWA 2PD3A 1N5IA 2WF6A 3NALA 4TWJA 5K3DA 3NW9A 4HQ0A 1P3Y1 4NARA 3B1JA 3ROFA 2GWHA 1HEUA 1DQPA 2J45A 3U26A 4GZ3A 1BRMA 2JLCA 2QRMA 2W6JD 2RHGB 4ZI3A 3L0YA 2AOUA 1G5IA 3G0GA 1AS2A 1ZHFA 4Q0MA 3EDRA 1PGNA 1RC0A 1SUFA 1KBOA 5F52A 3UENA 4CDRA 3D1LA 5CAEB 1XTQA 4G0WA 3DKVA 2WT4A 1NF2A 5A5VA 1TM7E 2BE9A 4MWZA 3HUTA 3L4KA 4JC4A 1XVAA 2D4AA 1RM0A 1YTLA 1YJXA 1IY2A 1TD1A 2HXYA 2IYAA 4O0MA 4NPHA 1X80A 3CMMA 1CUFA 3L6BA 4MRPA 4D57A 1QNLA 1WXXA 3W8RA 4F2WA 4OQDA 3O3MB 2ZU0C 5ALEA 1ELOA 3IT3A 3KFLA 4PC1A 1FFEA 1Q1GA 3P52A 4CLRB 1HZZA 1XF1A 2FPKA 2V65A 3FOZA 2QROA 3KKEA 4MULA 2G9RA 4GH5A 3TUIC 3VPCA 5KCZA 1A9XA 2PMCA 3KPVA 2REQA 1QG4A 3BFPA 1FJXA 1H0KA 2PCLA 4BIMA 1TJ5A 1WNTA 3KZNA 4I4IA 5LBIA 2OCDA 1O03A 3T1VA 2F6RA 2V3WA 3QRWA 3ULKA 3C5CA 4R41A 3HNOA 2QF7A 4II3A 3I32A 2FG5A 2AVDA 4M55A 4X20B 2HPAA 3R0VA 5FHQA 1K4KA 1P2SA 3W8FA 2GF2A 2BVNA 2HKIA 2WHRA 2Y71A 3TOZA 1OXKB 3U7HB 2VRWA 3D1VA 4G5OA 1EWRA 4ZXFA 2VJQA 2YNMC 1GFSA 4NJOA 2D7DA 3DCNA 3N0RA 5H5JA 4DA8A 4K9NA 3RCBA 1RJDA 4YMSA 2O7RA 4B7XA 4DY6A 2FZGA 2WZQA 1BFUA 3CEHA 4ZRMA 5K6TA 1ZBDA 2OV3A 5LXTF 2H4FA 3KB8A 4OHCA 4S1TA 4DCVA 4YPOA 3NM5A 1NW6A 2JJ2D 1XDDA 1RCTE 3AETA 2HWUA 4G4SP 3R76A 4PRZA 1ECBA 1YTUA 2VAXA 3Q9NA 1WQ4A 5FF9A 2Q0SA 1I3CA 1OPXA 2FPWA 3AJAA 2W43A 4HLQB 3N8DA 4N9QA 1HZJA 2FEPA 3AUTA 1F4VA 1HT1E 4HNQA 3I1FA 1PJRA 3TMAA 4CMEA 5JH7F 2ZJBA 1R0YA 4YBRA 4BU1A 2WWIA 5CXSA 3EEFA 4L16A 4Z4GA 1T9BA 3K0CC 5JLAA 3VZSA 3SZMA 3PVSA 5DF1A 3DXYA 3H4IA 2G40A 2OUIA 3P8ZA 2VQFB 1BYUA 3H0CA 4PBTA 2WYOA 1H2BA 1E7RA 4AURA 2C7QA 2OILA 2B1RA 2P4SA 4RZ3A 1EHIA 2A5JA 5DBOA 1HEYA 2V7XA 3AYXB 3RUFA 4AS3A 1EFTA 1KO7A 3NBAA 1HUQA 1KEKA 1NUPA 3O8QB 2B61A 1SC4A 1DKLA 3AEYA 1ZGHA 3A1SA 1TUEA 3D9QX 3LQRA 1I3MA 1M0TA 4YRLA 2B5OA 5P21A 3NI2A 3TLMA 3F4LA 3GWGA 4ZEWA 4HH4A 5AW4A 3E7FA 1RM4A 2BJVA 2O6HA 5C52B 4AJLA 2OAP1 4X3OA 5GZ1A 2IH2A 3PC8A 1QB8A 1RBYA 1KNQA 3DO8A 3TXAA 1YHNA 3IVGA 4AMVA 2HWWA 4E21A 1SCKA 3TRJA 3GN1A 2JB9A 4ZQFA 2WNHA 4JSTA 1R5NA 4R4JA 5BN4B 2GN1A 4HLUC 3WYAA 1EEXB 5HK9A 2IK8A 1XZEA 1GADO 1IUPA 4RFLA 3L84A 2DQZA 4RUKA 1BAPA 2JGAA 5IC6A 1SD2A 3GPLA 1LLFA 1C9JA 4ZVMA 2MSWA 1BKYA 3OOJA 5CH8A 3UPTA 2FPIB 3CEJA 3OPYI 3P0FA 4LRSB 3GLIA 3EVEA 2OCIA 2W6ID 2ZI6A 5MN6A 2NU7A 3WO0A 3OCUA 1S1MA 3BXZA 4OAQA 1I36A 5JXJA 5K3SA 3HXQA 5EE0A 1GQQA 3RNOA 1AUPA 2B69A 2OXEA 1NU8A 3DWGA 3Q40A 4FSXA 2Q6LA 4JASB 5C7OO 4JCOA 1NQUA 2MYUA 2VDKB 2PSDA 3ZIAA 4H4EA 4CEHB 1AMUA 4X3PA 3P26A 3MELA 3MINA 4ZTBA 2BRUC 3E48A 3DEKA 2QPTA 2P1DA 3BD6A 1PLKA 2Y4OA 1SG9A 1I2DA 1QTQA 5DM1A 3LGAA 1DWOA 1S2MA 2ILVA 4H17A 4HLDA 4NZOA 4EDFA 3A6HA 1R6UA 2I78A 2HJVA 1Q3HA 3MB5A 3F7OA 3Q3VA 3RQSA 3SWWA 2PZEA 1QVZA 3HLYA 3PLNA 1E2DA 2XQFA 3QVMA 2Q9UA 1LEHA 3K1ZA 1LZLA 1N5LA 1E98A 1GQYA 1L3BA 2Z3VA 2N46A 4QOEA 4LJ5A 5DBFA 4BATA 5FR2A 1N3LA 2WU3A 2AN5A 3VKWA 4QOFA 4RNCA 2O2IA 4R8VA 1X94A 3MJCA 1AK1A 2H4HA 4W4TA 1HYGA 4B3MB 4NK5A 1J1ZA 1XA3A 1E3IA 2ANBA 4RTPA 4U2GA 4IUBS 2VNSA 3CE6A 4Y6GB 4JI3B 4FGZA 3DJFA 4MDEA 3TLZA 3MAGA 3WGJA 4NIMA 5HM8A 3PR3A 3LDGA 2V9PA 3SC3A 4GYWA 1E92A 2OENG 1WSDA 1LSJA 2ZIXB 2EXXA 1DXQA 2CXNA 1QO9A 4Y18A 4TSRA 3GD7A 5TPWA 3JD0A 5KNCH 2B83A 1UOPA 1N1MA 2C83A 2CHVA 5ARCA 4MS1B 5EXEA 5HS4A 1GTG1 4WLUA 3BSSA 1U9ZA 4D5GA 3H9JA 3RYCB 1NI4B 2XQJA 5IEBA 1QSGA 2GAIA 4RTJA 1ZWKA 5B2EA 3KHUA 4QUEA 2ETVA 2C94A 3E9DA 4EKIA 2E5WA 1QCYA 2AHRA 4GNRA 3G6KA 2JBWA 4GM4A 5CK5A 4DJDC 4L4UA 3AF0A 2ZT7A 4HWPA 5ALFA 1CUIA 4AZWA 1I9GA 4C5BA 2SICE 4G37A 4RVUA 4CHTA 5KSPA 2I22A 1JAIA 1IXYA 1L5OA 2VHYA 3FUCA 2AIRA 2H1OA 4QFMA 3AKCA 2AEEA 2ZJ5A 4Q4JA 4DTCA 1NQAO 4GICA 1MZPA 1IOWA 1XC7A 2P69A 3I8SA 1QGOA 4D9EA 1HDGO 1E1CB 1SIBE 4P5PA 2YIMA 1HT2E 1QDEA 3SZ3A 3H05A 1X6VA 2F3PA 3CC8A 2FZEA 5KU1A 3ANTA 1V71A 3MPOA 1EK2A 1XNHA 2ERYA 1QHFA 3DCJA 1PJ3A 2ICAA 3PUZA 4G5XA 4BUJA 5JR3A 2QT1A 4PN7A 1R0BA 3KCQA 1DOZA 2D2EA 2X58A 3A14A 3A7EA 3PUKA 4LYAA 2AQKA 4DCOA 1ID8A 1UKEA 1U5BB 3MJRA 4MUNA 3MWEB 3CVOA 4RXMA 4AS2A 2ZAMA 4JH0A 3KL2A 2DEUA 4WZZA 3OOHA 1L7MA 4IYRA 5D3KA 4C0BA 3BZUA 1BE1A 1WUHS 3V8MA 5G40A 3PYLA 4IH9A 4IIHA 1T0JB 2FI1A 3NDJA 4H2DA 5ELLA 2DTXA 4H7JA 4Z9BA 1WD5A 3PXCX 2GDJA 2FFRA 2OHOA 3QE4A 3Q11A 2GM9A 2NZVG 5FTWA 3ZGXA 2A5LA 1QKKA 2FQXA 1G5HA 1KR5A 1PYOA 1VMKA 2VSFA 3KOWA 4OYRA 1KYQA 4LCJA 4TS4A 5AUOB 4Y6LA 1IXSB 3CO0S 9GPBA 3QUBA 2NO0A 5DCWA 1KEWA 3GVHA 1O3YA 4JI6B 3TW8A 3MTDA 1TVKA 3PNOA 2CZQA 4NDAA 3UMBA 1MNAA 1IHXA 5ALUA 2FFJA 4IIGA 1Z4PX 2EIXA 4CR8A 1UXHA 2EZ8A 2LCIA 2RHOA 3NGLA 4FHCA 4QDXA 2NZWA 3EWNA 5FUYA 3W34A 1T9AA 5K3EA 3DZJA 2C2WA 3IQDB 5EP3A 3F97A 2PZBA 1WHSB 2R4UA 5JXIA 2FTKE 1U7XA 1O4WA 4H6XA 2Y1DA 5DYYA 4KXMA 1L5KA 5AM4A 4KMRA 4XSVA 3CGWA 4W9NA 1KEEA 5JJKA 2DUUA 2OCBA 1GKIA 5FV7A 3RTCA 2VDRB 2CLLB 1OAOC 4K26A 3SHWA 1CP2A 6ABPA 1IZ0A 1JL3A 2ZJ6A 4H1UA 4H6VA 4QT0A 3T94A 2JI8A 3MT9A 4HGYA 2VHQA 5HTOA 4UW9A 1KRXA 4FMCB 3HMKA 4UBNA 3ZHYA 3N3AC 1KI7A 3RT9A 1EFUA 3BB1A 1E0DA 3HDGA 3OJFA 1JR6A 4G8BA 1Q84A 1SBNE 5IFKA 2IPOA 2P90A 3DGEC 3CCBA 3DW3X 3W5DA 2IYUA 3S3TA 1NOKA 5LBUA 2AX4A 2QV0A 3I01A 1J0EA 2C9MA 4HDRB 2ZK7A 4YRCA 1Y1KE 4MQEB 1A9YA 1YCGA 1MO5A 5C3MA 1G3UA 1XZQA 4HNRA 2JIDA 4JLBA 4M3NA 2IP1A 3P9RA 2VF5X 1KKLA 2O0LA 1XTSA 3B5EA 4LHEA 3V4SA 1YRWA 3MGAA 2Q5OA 1SC1A 1FXSA 3RRJA 3A2KA 2AE1A 2G5GX 1NXTA 3S7TA 3L43A 3TDKA 4WY8A 1LW7A 2W6IA 5DO9A 1I7QB 3EFOA 1MX9A 2ZTHA 3T3PB 2V5AA 4HDNA 4D4KA 3K1JA 2Z6QA 3SD7A 3HB1A 1TKBA 4PPQA 5I5GA 2WAAA 3SJ7A 2OY0A 1K7EB 3D5EA 1I2MA 1O5IA 2CEAA 2WIDA 5FWXA 4IINA 2KI5A 3ESDA 4LXUA 4S2UA 3EYAA 5B3JC 2UXCB 1G8HA 1SUDA 3U7QA 3IOYA 3UMMA 3RFVA 2INGX 2CWWA 2IT1A 4RMHA 2LKDA 1AF7A 1VSTA 2AW5A 4PO8A 2CVZA 3LOPA 1ENZA 2QAGB 3KB2A 2NTYC 1IWOA 1AQJA 3E7PA 3HCDA 3ZG6A 3C5EA 5TQ2A 3OEWA 4F4JA 4P0QB 3UJ3X 4R51A 5IASA 3ZI7A 4Q7KA 3V4FA 1JJVA 2OCPA 2DHEA 3CONA 3D3EA 2QT9A 1VKOA 4RQTA 3JYQA 5CXXA 2UUBB 4MVYA 1N8KA 4R9UC 2WJHA 1LWNA 4UAJA 4HPWA 2CC2A 2NW6A 2X9NA 2HA5A 3GLKA 4C76A 3NJ4A 3RJ9A 1JQEA 1G0NA 3JQRA 1UXGA 3UMGA 1OYOA 3PFCA 2KYRA 4E14A 3LT4A 3QXSA 2OQIA 1BCRA 3E8XA 3PWTA 2FSHA 1L7VC 2VPWA 3VKVA 2I80A 4PNEA 4BVBA 2E37A 4PG6A 2OB2A 4RC9A 5EJMA 4CMIA 4IIBA 3I6IA 5T8KC 1XQ6A 1BFDA 2VF2A 3BK2A 3PGVA 4LJ4A 4OHRA 4M1YA 1KRHA 1ZRNA 3DF7A 3LLCA 3OY7A 1OFVA 5IZCA 4CG0A 3VYSB 1PNTA 1R18A 2GUWA 3ODGA 2B30A 3EQ2A 3RV3A 1A7KA 1C3XA 4LSMA 3MD9A 2FN3A 4OMUA 4DYHA 4DV3B 4F86A 3KSRA 3OJEA 2SCUA 5JO0A 4M1EA 5FYDA 3UFXA 3A1WA 1UMKA 3HABA 1FDOA 2BM0A 1FSSA 1R8YA 2V6FA 4L8VA 1OWPA 4MEAA 2RC5A 4XLTA 4EYQA 1X1EA 4QA9A 4LXIA 1GFZA 2R7KA 2R2GA 5BNIA 4HGQA 1XX6A 1KVTA 1JKXA 1X7WA 2FVXA 2XMBA 4FWIB 2JJ1D 4XARA 3AFGA 4D80A 2F00A 3QF4A 3RSZA 3BJZA 1VG1A 1BXRA 2AFRA 2C1XA 1YOVA 4LQCA 5MGNA 3ZHSA 2QMYA 1HA3A 1U1FA 4HBGA 1V5WA 5A0FA 2XB6A 4ZU3A 3FIUA 3HR8A 3RASA 3NWPA 3UNXA 4EITA 2WHXA 3B8EA 3ID6C 1QCCA 1T0PA 3PA6A 4BN4A 3SXJA 3DAFA 3EW9A 4PSVA 1GNLA 2ZB8A 3GDHA 2DSNA 3ZQKA 3T4XA 1PW7A 3ZZUA 3VHXB 1N8NA 1LI5A 3UCEA 2GN8A 1TE2A 2W4QA 5HK8A 4E2ZA 2NAPA 2WUGA 4Q5IA 1Y8QA 1EX7A 2VHCA 2ZRBA 1ENOA 1WVGA 1UKVY 4JYCA 4Q9LA 2X2OA 2BP7A 3TH5A 1J06A 4Q1FA 1TT5A 3RC7A 1PR5A 2WFLA 3HCEA 5IKXA 5K3FB 1Z4MA 3NXSA 4FFSA 1UBGA 3ACCA 4Q4LA 3KLNA 2GBGA 5CVTA 1I10A 3DTVB 1HF3A 2HJ9A 3IAM1 3BCHA 3A36A 4RD3A 4ZT7A 5G2OA 1E7SA 3KEQA 1NKTA 1KI6B 1OI2A 5L95A 1H3NA 1PZXA 4DQXA 2QN7A 5JZ9A 1APBA 1BN7A 3DC7A 3IAS1 5BN1A 2G17A 2VVTA 3L8MA 1WULS 5JXGA 4XM2A 3W4KA 3TOVA 3RT7A 3FCSB 4OEHA 3WGIA 1YDFA 1D2NA 4CKWB 3CTMA 4D4HA 5ICCA 3LZCA 3CGGA 5JSFA 4GSLA 1K5DA 4DSOA 4XCXA 3JQAB 2CJPA 4QBTA 3HV2A 4M37A 3A27A 2P9ZA 3IVCA 4C2UA 2VDNB 1E8NA 2R1VA 3DHEA 1JDBB 4LGMA 5EJAA 2IOFK 1GG8A 2VBGA 4J2HA 3A1CA 2P9QA 1GPKA 2ZI9A 4C4XA 2PX2A 2QQGA 3DDOA 3CLRC 2AYZA 2HXSA 3L7IA 3R7WB 3PLAE 1SUBA 3DL4A 3ZJ5A 4L8FA 2XKKA 3A31A 1G5RA 3PRYA 2ZRFA 1SB8A 2X4IA 3LE8A 3SZLA 4BO5A 5I7SA 3UJ8A 1TUGA 4CI0B 3GJ4A 1NG1A 1OIWA 3IKVA 1G7CA 3UOGA 2W2VA 1EUQA 4A6EA 1KSFX 3COYA 1KMMA 2VTBB 1OBHA 1YIAA 1KJIA 3NH9A 4JVNA 2CXSA 3BJEA 4DLNA 1KDRA 5E3IA 1XQWA 3PEFA 3RIEA 1G4HA 2GZRA 4D9JA 4O4HA 3ZY6A 3D6JA 5JAHA 3TZKA 3W4JA 5AVQA 2XUAA 3GEGA 5FUVA 4CIAA 1DEXA 3RS5A 3HM2A 1QE3A 2CFTA 4P34A 4EZEA 5I8PA 2CVOA 4UBIA 5F64A 3R75A 1P7WA 1X1AA 2NG1A 3NP9A 3Q3IA 3SQOA 2Y77A 4MV8A 4B32A 7MDHA 5IABA 2P30A 2WJVA 3LP5A 1D5CA 1U81A 5LNK6 3JQGA 4NJEA 1QE5A 3K4QA 2HR1A 2GM5A 1O97C 3FPAA 1OU0A 3KZOA 4YUWA 1BDIA 1NSTA 3NHPA 4KE8A 2FZCA 1O95A 1I6WA 1PDOA 1U3FA 2LR0A 3L0SA 2WHQA 4C6TB 3N7AA 3DXFA 4HSEA 1JDJA 1QQAA 1HKUA 4MUIA 5K05A 1N6OA 1GPMA 1CBUA 5EWMA 5DN6A 2Q6KA 1Z7YA 2G36A 3DEHA 4RD6A 2OKCA 4BP9A 5I01A 4QGFA 1YL5A 5C1DA 2I6FA 3BKXA 1PHRA 1FTNA 1LLDA 3UWMA 2CHGA 3GH1A 3ITEA 3QE0A 3RFXA 1J5PA 5JAQA 4J75A 1C8KA 1OLSB 2HH9A 4YMTA 3SEQA 3PFFA 4B85A 5LXTB 1H94A 2AJLI 2OWDA 2P65A 4S2EA 1JFLA 4I9HA 5GJBA 2RIRA 5K3CA 4QOGA 2GUGA 3QELB 1QV6A 1EFKA 2CNNA 1S7GA 1K66A 2XECA 3JQQA 4LI3X 1BMQA 1BX3A 2DFDA 1HLDA 5DKFA 4CIBA 5E0OA 2BFDA 3NCHA 3L05A 3V8NA 4ZDIA 5DGDA 2AFHA 1T8YA 5FDFA 1G42A 3R6WA 2R6AA 3GQVA 4JXJA 5SY9A 3SX0A 2QRVA 3RNLA 1TIKA 1QRSA 5DE3A 5I6DA 2RBKA 5CLQA 3R7BA 2HA0A 2OSBA 5HBGA 3UUFA 2HQ1A 2K7FA 4RX1A 2QVGA 2XT9A 2P2LA 4N5DA 4RTQA 1FZQA 3OLZA 4MW0A 4IHAA 2Q2NA 1YE8A 2Q62A 3IILA 5FI5A 2EFGA 1L5LA 4MI1A 3FAZA 1RR6A 2JBAB 4H6WA 4EG5A 4MKIA 4UD6A 2VXBA 4PN3A 1IATA 1Y33E 3PHHA 5CFLA 3HJRA 3RVMA 1MLDA 1ODCA 3O82A 2FPMA 2H29A 5KYKA 1LS1A 2F3RA 3A9CA 3J7TA 2P7HA 1FDWA 1SUPA 2PZLA 3PPVA 4Q3AA 4DQVA 3D4NA 4O5AA 1V0JA 1H8HA 2YN0A 3GMTA 1KK2A 4IDGA 2CBZA 5G4KB 3NDBB 2AN1A 3THYA 4M4SA 1G6OA 2AYXA 1EAYA 1PS9A 4MITA 5K0LA 3ZK8A 5C8XA 3TG2A 3ZDZB 3H04A 1DO8A 2VDOB 1NA5A 2GFIA 1XK7A 4KUHA 3GR6A 3NBMA 4EI9A 5C8DA 5JSKA 1G291 2CL5A 4RORA 3DNFA 2HFKA 2HJWA 3LCMA 4LPKA 3DEZA 5AOCA 3JX9A 1WB9A 4ZJUA 2OCGA 3GUUA 4E70A 3QYJA 4Z4EA 3EVFA 5AKHA 1XFDA 3ZV4A 4CXMA 2JJ1A 4COOA 2ONCA 1FDUA 3DLTA 3H75A 1PS8A 1CNFA 3U80A 4NBTA 2OD9A 1EINA 1HDYA 5JBIA 3G8DA 5DP2A 1PQPA 3IQXA 3LXRA 1I33A 2J8ZA 1WAMA 3GCGA 3LQQA 1MORA 3AFIA 5EINA 1R6DA 1DDIA 2IYVA 4IMPA 3CRNA 4R7GA 4L5AA 1HO3A 4JLSA 1OIVA 1OE0A 1I0LA 1QYWA 1M1NA 1Y8CA 5EXSA 1ZM7A 4Q21A 4QL3A 2ONKA 2QYTA 1IDOA 2X4DA 4KGDA 2JCYA 2RARA 4Q01A 1OVMA 5L3VA 3NIWA 5K0ZA 2AMVA 5AI6A 2Q4BA 4XIGS 5FL7D 4KBFA 2O4CA 4JI5B 1WG8A 2YHSA 3TSOA 3D7MA 2WSYB 1UKCA 3AVOA 5E4FA 5LMNB 1Y9EA 5K6AA 1Y5RA 3AM4A 4DXDA 2R8BA 1DWQA 3TECE 2I76A 4CW7A 3MCZA 4OOEA 4NZ9A 1G21A 2NT4A 1CDZA 5J4HA 1VMAA 4J0QA 4XDHA 3WGYA 3JALB 1ULHA 3C7TA 2ZETA 2CDBA 4PX9A 1TCVA 2AWOA 1FVXA 3BWXA 1QHIA 4J0GA 1W25A 1R8XA 1E1NA 1H0HA 5KSWB 1DKOA 4QG7A 3KDAA 4UJ3A 4IRXA 5DISB 1NASA 2J3EA 4F5DA 4MUKA 2YXNA 3P0HA 2PH3A 2AHOA 3TAXA 3DV2A 5A1TA 4HATA 4J07A 1XT6A 1Y3AA 3W5AA 3QPCA 3O2SB 4BNWA 4E5PA 2CBXA 4XD7A 1R10A 1R9JA 5EYPB 1L8QA 5DV9A 4KRGA 1FYDA 3RBVA 2C2KA 5JA1B 3JYHA 2C3OA 1A9RA 4QUJA 3NM4A 4OJKA 3N76A 4OQZA 5KBYA 3BS4A 3IBGA 4ZTUB 2H8GA 2FDCA 3B7WA 2J9FA 4M83A 5DT9A 4IEFB 1GNSA 1UKYA 4JENA 4UTPA 1GGMA 1JFSA 1KPHA 3D4OA 1DTSA 3CT6A 1X80B 1R2QA 2H31A 2NZ8A 1UC5B 1V96A 2G82A 4FONA 5D3MA 3IPXA 1JHPA 4EKGA 4EPWA 4O4HF 2J08A 3AUAA 1P8JA 4A10A 2Q1WA 3OZIA 3P2IA 4BP8A 1YS4A 2Q5QA 3C7DB 3N2NA 4NU8X 4RO0A 1ORTA 3QXXA 1GT6A 4AMGA 1FS6A 4BB6A 1EAMA 4J8PA 3USCS 2UZAA 3MS2A 4CG3A 1SCAA 3OJ0A 3P2JA 2P2DA 3EZGA 2V7EA 4DW8A 5BVHA 4PYMA 4F3CA 2IXFA 5F78A 2R00A 2B2CA 5F33A 4BO9A 2PWAA 3GJ7A 5THKA 3ESRA 1ORDA 2X2FA 4V0OA 3U4AA 3MOIA 4ML3A 3WDKA 3UA4A 2KHZA 2Q3EA 1FDTA 3LDHA 1MO3A 1N2IA 4HAUA 4QYTA 3UHJA 1U94A 3ZNPA 3O73A 4G67A 5CRIA 3PEUA 1W2WB 1AM4D 2QK4A 4H18A 4YX9A 4LYEA 1SOWA 4LMBA 4ME6A 2OYRA 2Y68A 2J3QA 3E7DA 1SK8A 2PZMA 4N0MA 5FQNA 4A4DA 5FTLA 3TM4A 1AS0A 1XD9A 2RG7A 4ZN6A 3TBHA 1JR4A 3CA8A 4NR0A 4X84A 4EHNA 1YCFA 1NT2A 2PU5A 4ZQCB 1A1VA 2V7VA 4JU9A 3K0EA 4B8ZA 3HHPA 2R48A 3OF3A 4OXIA 1IY8A 2O5CA 3GZTB 1DS6A 5KNCD 4RTSA 2AZTA 1S2LA 3B70A 3B3QA 3C41J 3GLUA 4IJVA 3VMMA 3AETB 3LPAA 2D59A 1BHSA 1XUOA 4XEHA 5ADVA 4UCFA 5BRNA 4EUKA 2ZULA 4PFSA 3ZYCA 3M4YA 5AW7A 4JDUA 5TF0A 3GPBA 4FMDF 1T2VA 3LC7O 1PVDA 4I5EA 2QXUA 4D8XA 3DE2X 1KKMA 1VJCA 1BHO1 2HZ7A 2QLTA 4MWSA 4AX4A 3AOEC 4DJAA 4YRBA 4MZXA 1VMIA 3K70B 1XZLA 3DCYA 5DSTA 2FKAA 1P5RA 1G2PA 3UV7A 4RIFA 3E9NA 1FQKA 4WLFA 3N39C 1J97A 4M88A 1QYDA 3GNSA 4DHWA 2WUDA 5KSYA 4EFKA 1I4EB 3E9YA 4UQPA 2PWYA 4Y9SA 4CWAA 2ONJA 2XMCA 4NATA 4PC2A 1DIGA 2EQ5A 2X2PA 2VF8A 4ZEOA 4WIAA 3T5BA 1BRTA 1GQ2A 3Q7IA 3FWYA 4RZIA 1NXQA 4YDHB 1DC3A 4L51A 2DLDA 1EYZA 1IEXA 1Q1BA 2JZCA 2EL9A 2L2QA 4TWRA 2FMXA 4P9NA 2YY7A 3IAHA 2PGOA 4R8MA 4TKUB 5KWVA 2NZUG 3CX7A 4FHGA 3QNUA 4YAEA 4CGYA 4KKVA 3M9LA 4B6PA 4Z6KA 2ABWA 1XU7A 1Y3IA 2D2VA 3HVHA 3O8OB 2CLIB 4UTOA 5JYDA 4D3YA 1G38A 3S1AA 2GPSA 3R6LA 4A6PA 3JS5A 16PKA 1N8SA 2PBRA 3TEJA 1JV2B 3MTAA 1GLGA 3Q0IA 4RIGA 4OUKX 5TMPA 3BSFA 2Z30A 3G0OA 3I6MA 3AI2A 4X8LA 4KMOA 4YP0A 3T34A 2EJCA 1PFWA 5FBRB 4AYTA 1GCUA 4C2TA 1JILA 5EJ8A 1V43A 5BYAA 4OL9A 4XE5A 3KXIA 1T0UA 3NC1C 4LDPA 4PZDA 5D8DA 2FRVA 2HA4A 1IY1A 4J0CA 1YNSA 3IQIX 4IGAA 4IH4A 1ADGA 3KM0A 4RSMA 4R1QA 4RY0A 3LY5A 4KR3A 3OZBA 1JHQA 3NIGB 4XWAA 5CB4F 4F8EA 5KZMB 2CD9A 2ZQ5A 3HYRA 3N6VA 4DR4B 3FYHA 3IJEB 2NU7B 4G5QA 3I2YX 3B2EA 1WUJS 1Y9ZA 4UREA 2B21A 1PJAA 2XVMA 5GV8A 1OUMA 3WJ1A 2Z6AA 1L6RA 1SWVA 1TF7A 2QL6A 2R6HA 3OM1A 4OJMX 3EVNA 1KDYA 3WDSA 2ONZA 4G5HA 1H8ED 2FSUA 1RYZA 5K01A 5K8IA 5LU8A 2QTFA 3O3OB 3L0OA 4KI0A 3MINB 2A88A 4MCHA 1XTTA 1KORA 4Q03A 4I1IA 4IXTA 5BSHA 3U3XA 3HDYA 2DQYA 1Z38A 2BT4A 4P4UA 1FA9A 3DLBA 1VSBA 2EP7A 2EF0A 4IJMA 3TAUA 1BFKA 1MC8A 3BFXA 1GO2A 3BMOB 2B7BA 1GT91 1H93A 1Z2AA 3FW1A 3A9VA 3ILVA 5HKLA 5BOSA 1TQDA 2NU6A 1JMKC 3ZXIA 2GJ9A 3MK31 2CSXA 2F48A 4AG5A 1KAEA 4U0KA 3RREA 1M73E 4MVJA 4C0JA 1OYVA 1ARZA 4MVCA 4ZAXA 1W5AA 4YIKA 4LWPA 2Q99A 2VHWA 2AMFA 4LXTA 4DPMA 1W2HA 5K3BA 4EJFA 4DAEA 4FWBA 3TO5A 4ARBA 3K0FB 3KEGA 3C5WP 2IIVA 2V7BA 2Y67A 4IICA 3W6ZA 1ZW6A 2BFPA 3AEQA 4I3GA 1Z75A 4NESA 3QE9Y 3UPUA 3ICCA 2HIGA 3IRVA 3O2QB 1Y37A 3WS7A 1CQWA 4II7A 3V1TC 2D54A 4RGYA 1ZKMA 1ZNZA 3KXKA 4BGUA 4ZIRA 3G6WA 4WH0A 2YRXA 3E15A 3K73O 1Y5MA 3BD7A 4IEEA 1T5TA 4OMDA 2M6RA 3L7OA 1XJQA 5AOBA 4CTMA 4FZRA 4BO6A 3NOVA 2ZYRA 5ITVA 1T8UA 3QX3A 1A9ZA 1P73A 3HWX1 5G41A 2RC6A 5KYGA 2JEZA 4U8HA 1N0HA 2ORYA 3QLJA 4EPXA 1VPWA 1XNQB 1DZIA 1OLUA 2YVQA 2PZAA 4DY4A 4R2MA 2GXUA 3GUVA 1ZL0A 4IDQA 1BS1A 1TL7C 2HUPA 2XKBA 2PTHA 3Q41A 4NKRA 1P9RA 2Q29A 4NEQA 4KITB 3KOXA 5HM6A 5CB8A 2QX4A 3OECA 3OOWA 4ITVA 2F3SA 2B2NA 1WZ2A 1IG0A 3KKPA 3OF5A 1AUOA 1M54A 4JD5A 1VB3A 2EAUA 1I3KA 3ZWNA 4V39A 1G18A 1CUVA 2GOYA 1GUAA 1YZLA 1V3TA 1LK0A 1R74A 3T12A 4D82A 2ES4A 1K7FB 3WI7A 1HR0B 5MFZA 3L01A 2WUEA 3LRPA 4URHA 3G3EA 4C4TA 3Q8WA 3X1ZA 4X6YA 1U2GA 3M9WA 4A0QA 3EQ7A 3HYNA 4RKRA 4CM3A 4URYR 4F5WA 3H5RA 3EGXA 4WNYA 5F4BA 3E9CA 1EM8A 5K03A 5JJIA 4RKYA 5AT1A 3DQPA 1UFRA 3M2PA 2M2IA 4WCVA 4YROA 3NCTA 1YKGA 5HJ2A 1FMCA 3BPSA 4P7JA 4B5LA 4JA0A 3HA7A 4HH1A 4TVBA 3F7NA 5JECA 5K8VA 2AQHA 4L9WA 2AWNA 1W59A 4CIVA 4DANA 1U8FO 4F12A 3HM9A 3C6ZA 3CLSD 4DDKA 3O83A 1MRNA 4OVKA 4M2LA 4M0EA 1U2QA 1YVEI 2BFMA 1U0EA 1F38A 4J4BA 6PFKA 5JH7B 3OZ7A 4IR7A 3T41A 2B98A 3Q98A 5JROA 3PGKA 5L8VA 5ALSA 5ILQA 1C4OA 4EGJA 1UZMA 4AROA 2ZUVA 3DPSA 4GI2A 4KKXB 1WXEA 3WGHA 1UBNA 1U9IA 1TVKB 3KPWA 2AI2A 4LOLA 2GKGA 3W5CA 2Z1DA 3DHNA 2O8FA 4J91A 2CJWA 4ZREA 2ECPA 3JYNA 2BFAA 4Q24A 3TSCA 4AB1A 1DJNA 3BEDA 3DZKA 3HN2A 4J0FA 4CQJA 2YY6A 4PLTA 1NMXA 1ZD2P 3K0SA 4H3VA 1NBME 2Z58A 5E7QA 2C9OA 1VHTA 3H5LA 3TW6A 1RI4A 3W8DA 1ESDA 1FFSA 1VIVA 2IQIA 1KEEB 4YUVA 4D3DA 3DDSA 2EP8A 5MFPA 3SM9A 2HK8A 3JVUA 2K2QB 3OETA 2V9ZA 1DC5A 2RHHA 1MB9A 3GDFA 2FV8A 2PXCA 3DHVA 3IJRA 3TRFA 3UAXA 1DGQA 3K53A 5FOSA 1TAHA 1UH5A 1C1XA 4FJ0A 4R69A 1EGQA 4B87A 3RUHA 2P35A 1EVYA 4KQFA 4O1HA 2VT3A 1M0WA 2O1SA 5F73A 3I9JA 1AUVA 2QP4A 2RCNA 2WBLC 3ZWVA 4YUAA 4Y0VA 4OLJA 3HPRA 3ROGA 1VLLA 3KQUA 1EX6A 4QAJA 5AJUA 1JFFA 5E8RA 1CY4A 4GI1A 3DA8A 1HE4A 1ZISA 2R68A 3OPXA 3W1WA 1E4OA 5CIWA 1GUYA 4BEWA 1U63A 5FKJA 3FB4A 2CMFA 3NHWA 1HE3A 3S5JA 2BFFA 4CGZA 3ZCSA 2XVAA 2BFCA 1X7XA 2QI9C 4XYMA 2HCJB 5AUQA 3ZVLA 2C5GA 2GO1A 1XMJA 4B3DA 5EKSA 5BUCA 1VCIA 2IFTA 1Q7BA 2JH3A 1CR4A 2Y66A 5CDTA 1W75A 1R0XA 4G0PA 4PZLA 1REQB 3U9SA 4F4FA 3SYMA 2PMKA 3FGPA 4BQEA 5BW4A 3B7PA 2FG6C 4KYUA 4R1OA 3CX4A 5IC4A 1ZJZA 2BN4A 1SXHA 1PZEA 1TECE 4GPAA 4P4SA 3SBEA 3TK1A 2JVJA 3W9UA 4HDNB 4BFYA 1HEIA 2COEA 1N57A 4HRXA 4QQFA 1HPLA 2DULA 4C05A 4OUDB 4B73A 4ENVA 3GUZA 5I48A 2F59A 2Q5FA 4X95A 5C5IA 2C9ZA 2FCRA 2WWHA 4ITRC 4YJDA 5GWXA 4AWXA 1H8EA 2MOKA 2NUBA 5FWXB 4B84A 2JIBA 4TXHA 3OFND 3V3TA 1E0AA 2RHTA 3M4JA 4JBHA 3I53A 3VVBA 2GD6A 4MVJF 1T15A 3SNKA 5B1IA 5CU7A 3T9AA 3M33A 1D9XA 1SKYE 3KTAA 5U4XA 2VA9A 1JSZA 1XCPA 5I9NA 3VKGA 3HGMA 4B7ZA 2P5YA 4BN5A 4URWR 5TQ2B 3KUDA 1R6TA 4OGLA 3BGDA 5M34A 1ZM3A 3AR8A 1FUEA 4P5EA 4X1KA 5EJEA 2GMWA 3HUEA 3A6GA 2XX3A 3DZDA 4WXEA 1IJFA 3C97A 3HFGA 1NF8A 3CNOA 3CV3A 2C29D 2GJ4A 3JARB 3SC2A 3U1VA 3AFNA 1D4AA 2IZ6A 3UXMA 1YZFA 3CU5A 3HCNA 5IT5A 3P4YA 1BKSB 1TM5E 1JHRA 2FFHA 1I7NA 1D7OA 1UMCA 1XMOB 4KVFA 1F0KA 4IWNA 1ZK1A 1Z3IX 4BC1A 1U8AA 4ZVVA 4LYHA 5HRCA 1RT9A 1BCRB 3KE9A 1A8HA 2PVCA 2RJNA 4MPPA 4XKJA 3U4GA 2Y76A 3SEFA 3RVJA 2I1WA 2XF8A 3ROKA 1NBIA 3NUQA 3P27A 4CMIB 4BQFA 2JAHA 5EMNA 3UT6A 5IH3A 5GY7A 2P6RA 2X5NA 5F5NA 4B2IA 1YZUA 2IUTA 3KP1A 3LRXA 1SD5A 4JJ4A 2HV8A 3QHQA 4OH7A 5FFNA 2C4NA 4JZYA 4ZI7A 3ZHBA 1PZNA 1DIAA 1Q7TA 2AMLA 1PTJA 3OT1B 1VA4A 2XJ4A 3CUUA 2WYVA 3R5FA 2QV7A 4CU2A 1ZXLA 1WU8A 3QIVA 1W1WA 4OIMA 1OZHA 3R3JA 5A62A 2EFHB 4OATA 4BB5A 1SKBA 1DRKA 2AZXA 2HBYA 5ICGA 3NHZA 2VT6A 4ZZ2A 3T6KA 3S1SA 2XUPA 4V0NA 1FFAA 3HZHA 1H5UA 2FAXA 2ZXUA 4RK7A 4YFVA 5DCYA 3D43A 6NULA 5CXUA 4JSRA 3DG9A 3GRAA 4UHJA 5D1NA 2IWHA 1JZSA 3QF4B 2GN2A 3ETHA 4D9IA 4XWKA 1BXRB 7ADHA 5AKXA 1X7HA 3D2BA 4MPTA 1C7ZA 1P91A 1FYWA 4X6XA 4F5EA 1ZHOA 1LA2A 1SHJA 1P7CA 1G3QA 4KW7A 3ROXA 3QU2A 3IDOA 1J33A 4YRJA 4AIIA 4B4DA 3R23A 1L5GB 1YE3A 2IS4A 5BQPA 5DNYB 3GK3A 2XHZA 1PD1A 5MN5A 3WQRA 4Z2AA 4HNAA 4GXRA 1NWCA 5ILGA 4IGKA 3VZCA 1P9WA 1Z7BA 2EW8A 3ZVNA 3QLVC 1I0ZA 3VXKA 3O3NB 4Q3KA 1II0A 5LOVA 4KREA 5THQA 2WK1A 5AOVA 3QMPA 2WKWA 4HC4A 1E9AA 1IEWA 1RE1A 1XVUA 3EXG2 1GN9A 2A1UA 2P9BA 2QUJA 3A3KA 4H7IA 5IJ0A 2BP7B 3K8QA 1OBOA 4S04A 2Y1CA 1TT5B 4IXNA 2WFLB 1YS9A 3PC3A 4UEKA 2ZAOA 1QRAA 2XA1A 1F5NA 2PQMA 1N6HA 3FDZA 5DLQC 2P0AA 4NAVA 1PU2A 2D5LA 3NAGA 2I54A 3ZVRA 4ALJA 4DQKA 4F1JA 2WJPA 4UBMA 3WLQA 3W2EA 3U3ZA 1QRDA 3IUQA 1YK1A 1WDWB 4WLVA 5C34B 1DC4A 5E4YA 1SXJB 5IXSA 2GA9A 2OZPA 2QAJA 1HYEA 1S6YA 1TTPB 2VYVD 4GVXA 2H51A 3KWMA 4GPTA 4BLRA 5B55A 1QPBA 1Q5PA 3PI7A 3PTAA 4AN1A 3WZMA 2QP9X 3MWYW 4U7PB 1A82A 3LKBA 4RABA 1Z74A 4DNPA 5LMCA 3FTFA 1TRKA 1CFJA 1V4BA 4I1UA 1ZIYA 2QTVA 2R8EA 2WA2A 4CFZA 1OXVA 4DXHA 3RI3A 3K8YA 2HYDA 2R6ZA 1HQKA 3H6HA 5JISA 4JI0B 1KAOA 2C8LA 3NBYC 3OESA 2H9IA 3WGGA 5AW6A 3G2JA 1IQUA 1LTQA 3PXGA 3DHWC 3NZEA 1H65A 4BVLA 3V42A 4PX2A 4RV5A 1T1JA 4FBMA 4LY6A 4NENA 4C0XA 4UU0A 4Y2XA 1VHQA 2G8NA 5B7PA 4LF8B 4O33A 2A2ZA 4GLJA 3PQ2A 1IN1A 1UADA 3UFBA 1NTOA 1ORWA 5H9WA 1AKQA 4IIDA 4LV6A 4BQOA 1WDMA 4CRWB 4C0KA 3K32A 3CZQA 3PFNA 3HRHA 5DOVA 5L51A 1HV8A 4TLCA 3M5DA 2C58A 4QEKA 4O4HB 1N75A 1QFJA 4N5IX 5B1SA 1S2NA 3QMMA 4NFSA 2J9YB 4R2HA 1XDGA 3JSXA 2QAGC 4HN4B 2OEPA 4FOLA 3UWDA 3H5TA 3MRVA 4TMYA 4E4RA 3LYUA 1XTUA 2PJRA 2OYSA