1HYNP

Crystal structure of the cytoplasmic domain of human erythrocyte band-3 protein
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
293
structure length
293
Chain Sequence
KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords BAND 3 ANION TRANSPORT PROTEIN
publication title Crystallographic structure and functional interpretation of the cytoplasmic domain of erythrocyte membrane band 3.
pubmed rcsb
source organism Homo sapiens
total genus 86
structure length 293
sequence length 293
chains with identical sequence Q, R, S
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2001-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF07565 Band_3_cyto Band 3 cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.930.10 Alpha Beta 3-Layer(aba) Sandwich Mannitol-specific EII; Chain A Mannitol-specific EII; Chain A 1hynP00
4ODXX 3T43A 4M62S 3BJVA 1XIZA 2OQ3A 4GQXA 1HYNP 1J6TA 4KY9A 2OQTA 3URRA 2A0JA 3OXPA 1A3AA 4M8QC 3LF6A 2FEWA 1A6JA
chains in the Genus database with same CATH superfamily
4ODXX 3T43A 4M62S 3BJVA 1XIZA 2OQ3A 4GQXA 1HYNP 1J6TA 4KY9A 2OQTA 3URRA 2A0JA 3OXPA 1A3AA 4M8QC 3LF6A 2FEWA 1A6JA
chains in the Genus database with same CATH topology
4ODXX 3T43A 4M62S 3BJVA 1XIZA 2OQ3A 4GQXA 1HYNP 1J6TA 4KY9A 2OQTA 3URRA 2A0JA 3OXPA 1A3AA 4M8QC 3LF6A 2FEWA 1A6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODX X;  3T43 A;  4M62 S;  3BJV A;  1XIZ A;  2OQ3 A;  4GQX A;  1HYN P;  1J6T A;  4KY9 A;  2OQT A;  3URR A;  2A0J A;  3OXP A;  1A3A A;  4M8Q C;  3LF6 A;  2FEW A;  1A6J A; 
#chains in the Genus database with same CATH topology
 4ODX X;  3T43 A;  4M62 S;  3BJV A;  1XIZ A;  2OQ3 A;  4GQX A;  1HYN P;  1J6T A;  4KY9 A;  2OQT A;  3URR A;  2A0J A;  3OXP A;  1A3A A;  4M8Q C;  3LF6 A;  2FEW A;  1A6J A; 
#chains in the Genus database with same CATH homology
 4ODX X;  3T43 A;  4M62 S;  3BJV A;  1XIZ A;  2OQ3 A;  4GQX A;  1HYN P;  1J6T A;  4KY9 A;  2OQT A;  3URR A;  2A0J A;  3OXP A;  1A3A A;  4M8Q C;  3LF6 A;  2FEW A;  1A6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...