The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
173
|
structure length |
173
|
Chain Sequence |
VQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Isomerase
|
molecule keywords |
Allene oxide cyclase 2
|
publication title |
The Crystal Structure of Arabidopsis thaliana Allene Oxide Cyclase: Insights into the Oxylipin Cyclization Reaction
pubmed doi rcsb |
source organism |
Arabidopsis thaliana
|
total genus |
46
|
structure length |
173
|
sequence length |
173
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
5.3.99.6: Allene-oxide cyclase. |
pdb deposition date | 2006-03-29 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | AOC barrel-like | Allene oxide cyclase-like |
#chains in the Genus database with same CATH superfamily 2DIO A; 4H69 A; 2GIN A; 1Z8K A; 4H6C A; 1ZVC A; 4CQ7 A; 2BRJ A; 2Q4I A; 4H6B A; 4H6A A; 4CQ6 A; #chains in the Genus database with same CATH topology 2DIO A; 2OOJ A; 2Q03 A; 4H69 A; 2GIN A; 1Z8K A; 4H6C A; 1ZVC A; 4CQ7 A; 3V0R A; 2BRJ A; 2Q4I A; 4H6B A; 4H6A A; 4AUD A; 4CQ6 A; #chains in the Genus database with same CATH homology 2DIO A; 4H69 A; 2GIN A; 1Z8K A; 4H6C A; 1ZVC A; 4CQ7 A; 2BRJ A; 2Q4I A; 4H6B A; 4H6A A; 4CQ6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...