The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
72
|
structure length |
72
|
Chain Sequence |
MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRPLSLRQHMDKAAG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of PA2412 protein determined using ABACUS protocol
rcsb |
| molecule keywords |
conserved hypothetical protein PA2412
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Pseudomonas aeruginosa
|
| total genus |
11
|
| structure length |
72
|
| sequence length |
72
|
| ec nomenclature | |
| pdb deposition date | 2006-04-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03621 | MbtH | MbtH-like protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Rubredoxin-like | Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id |
#chains in the Genus database with same CATH superfamily 2PST X; 5JA1 B; 2GPF A; 2MYY A; 2KHR A; 1GH9 A; 4GR5 A; 4GR4 A; #chains in the Genus database with same CATH topology 2PST X; 5JA1 B; 2JNE A; 2GPF A; 2JRP A; 2MYY A; 2KHR A; 1GH9 A; 4GR5 A; 4GR4 A; #chains in the Genus database with same CATH homology 2PST X; 5JA1 B; 2GPF A; 2MYY A; 2KHR A; 1GH9 A; 4GR5 A; 4GR4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...