2IJQA

Crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
145
structure length
145
Chain Sequence
GNPSGWRTDGQWEHETLRRAVVHGVRLYNSGEFHESHDCFEDEWYNYGRGNTESKFLHGMVQVAAGAYKHFDFEDDDGMRSLFRTSLQYFRGVPNDYYGVDLLDVRTTVTNALSDPSALHGWQIRLDGEYPTCRPEDIEFAESLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical Protein from Haloarcula marismortui
rcsb
molecule keywords Hypothetical protein
molecule tags Structural genomics, unknown function
source organism Haloarcula marismortui
total genus 57
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3450.10 Mainly Alpha Orthogonal Bundle Hyaluronidase domain-like TTHA0068-like 2ijqA00
2IJQA
chains in the Genus database with same CATH superfamily
3IKOC 2GNXA 2IJQA 5M73C 3JROC 4P3FA 4P3EC 4P3GA
chains in the Genus database with same CATH topology
2IJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJQ A; 
#chains in the Genus database with same CATH topology
 3IKO C;  2GNX A;  2IJQ A;  5M73 C;  3JRO C;  4P3F A;  4P3E C;  4P3G A; 
#chains in the Genus database with same CATH homology
 2IJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...