The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
147
|
structure length |
147
|
Chain Sequence |
MRLSDYFPESSISVIHSAKDWQEAIDFSMVSLLDKNYISENYIQAIKDSTINNGPYYILAPGVAMPHARPECGALKTGMSLTLLEQGVYFPGNDEPIKLLIGLSAADADSHIGAIQALSELLCEEEILEQLLTASSEKQLADIISRG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of the cryptic mannitol-specific phosphotransferase enzyme IIA CmtB from Escherichia coli
pubmed doi rcsb |
| molecule keywords |
Mannitol-specific cryptic phosphotransferase enzyme IIA comp
|
| molecule tags |
Transferase
|
| source organism |
Escherichia coli
|
| total genus |
45
|
| structure length |
147
|
| sequence length |
147
|
| ec nomenclature |
ec
2.7.1.-: |
| pdb deposition date | 2007-01-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00359 | PTS_EIIA_2 | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the Genus database with same CATH superfamily 2A0J A; 1HYN P; 4ODX X; 2OQT A; 3T43 A; 2OQ3 A; 3URR A; 3BJV A; 3OXP A; 2FEW A; 1XIZ A; 1A6J A; 3LF6 A; 4KY9 A; 4M8Q C; 4M62 S; 1A3A A; 1J6T A; 4GQX A; #chains in the Genus database with same CATH topology 2A0J A; 1HYN P; 4ODX X; 2OQT A; 3T43 A; 2OQ3 A; 3URR A; 3BJV A; 3OXP A; 2FEW A; 1XIZ A; 1A6J A; 3LF6 A; 4KY9 A; 4M8Q C; 4M62 S; 1A3A A; 1J6T A; 4GQX A; #chains in the Genus database with same CATH homology 2A0J A; 1HYN P; 4ODX X; 2OQT A; 3T43 A; 2OQ3 A; 3URR A; 3BJV A; 3OXP A; 2FEW A; 1XIZ A; 1A6J A; 3LF6 A; 4KY9 A; 4M8Q C; 4M62 S; 1A3A A; 1J6T A; 4GQX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...