2W8HA

Crystal structure of spin labeled wza24-345.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
322
structure length
322
Chain Sequence
IPGQGLNSLRKNVVELPDSDYDLDKLVNVYPMTPGLIDQLRPEPVIARSNPQLDNLLKSYEYRIGVGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNSDGTIFYPYIGKVQVAGKTVSQVRQDITSRLTTYIESPQVDVSIAAFRSQKVYVTGEVANSGKQAITNIPLTVMDAINAAGGLAADADWRNVVLTHNGKDTKISLYALMQKGDLTQNHLLYHGDILFIPSNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGISQEMSDATGIFVVRQLKGDRTGKIADIYQLNAQDASAMVLGTEFQLCPYDIVYVTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PUTATIVE OUTER MEMBRANE LIPOPROTEIN WZA
publication title Peldor Distance Fingerprinting of the Octameric Outer-Membrane Protein Wza from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 322
sequence length 322
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02563 Poly_export Polysaccharide biosynthesis/export protein
A PF10531 SLBB SLBB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 2w8hA01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 2w8hA02
3.30.1950.10 Alpha Beta 2-Layer Sandwich wza like fold wza like domain 2w8hA03
2W8HA 3P42A 2W8IA 2J58A
chains in the Genus database with same CATH superfamily
2W8HA 3P42A 2W8IA 2J58A
chains in the Genus database with same CATH topology
2W8HA 3P42A 2W8IA 2J58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8H A;  3P42 A;  2W8I A;  2J58 A; 
#chains in the Genus database with same CATH topology
 2W8H A;  3P42 A;  2W8I A;  2J58 A; 
#chains in the Genus database with same CATH homology
 2W8H A;  3P42 A;  2W8I A;  2J58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...