2J58A

The structure of wza
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
355
structure length
355
Chain Sequence
TIIPGQGLNSLRKNVVELPDSDYDLDKLVNVYPMTPGLIDQLRPEPVIARSNPQLDNLLKSYEYRIGVGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNSDGTIFYPYIGKVQVAGKTVSQVRQDITSRLTTYIESPQVDVSIAAFRSQKVYVTGEVANSGKQAITNIPLTVMDAINAAGGLAADADWRNVVLTHNGKDTKISLYALMQKGDLTQNHLLYHGDILFIPSNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGISQEMSDATGIFVVRQLKGDRTGKIADIYQLNAQDASAMVLGTEFQLQPYDIVYVTTAPLVRWNRVISQLVPTISGVHDMTETVRYIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE LIPOPROTEIN WZA
publication title Wza the Translocon for E. Coli Capsular Polysaccharides Defines a New Class of Membrane Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 88
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02563 Poly_export Polysaccharide biosynthesis/export protein
A PF10531 SLBB SLBB domain
A PF18412 Wza_C Outer-membrane lipoprotein Wza C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2j58A04
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 2j58A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 2j58A02
3.30.1950.10 Alpha Beta 2-Layer Sandwich wza like fold wza like domain 2j58A03
3P42A 2W8HA 1AFOA 2J58A 2W8IA
chains in the Genus database with same CATH superfamily
3A5TA 1OXZA 4H44C 4IL6H 3HE4B 2AXTH 3CCJP 5AW0B 3P7KA 2ZFCA 4D6TG 1ZR2A 4HB1A 2NPSD 4DZOA 4ZKPA 4EYYQ 1LJ2A 2XV5A 5APXA 5AW5B 5BU5A 3SFEC 2ZJSE 2KNCA 4IL6E 2P10A 2AXTE 5AW7B 1MUUA 3U1CA 1KILC 3H1IG 1LWUB 3CC2P 3L71G 3RBXA 2R3SA 2SPZA 2E75C 1J1DB 3CC4P 3RK3B 3W68A 3Q2YA 2L91A 2KLVA 1NU1J 1Z56A 4JBZA 3L70G 1NH4A 1W5CE 1LT9C 4EOTA 3B4SA 5AVZB 2Q5UA 2QA4P 1Q90D 2YKQA 4JYBA 2O01J 4WB4A 1AV1A 5CCGD 2B89A 3LW5H 3H1LJ 4I1LA 4LC1A 3M91A 2KP8A 1VQMP 3IFMA 4GKGA 3CD6P 1BDCA 4XA4A 1PPJE 3OW2O 1JTHB 4WY4B 2IZ1A 1IFPA 2E76B 3PP5A 1L0LK 5C39A 3HUSB 3HTKA 1ZXGA 1MFZA 1PP9E 2Y0EA 3BATA 4HYTB 1KV4A 3P8MC 4GOFA 1N7SC 3TGUE 2MKVA 3M0DA 4U7JA 2O1JA 4PD4H 4I6MC 2I1KA 1RE3C 4A7PA 2UWJE 1W2BO 3PHLA 5L8RJ 3M9QA 2G8YA 1LTJB 2PP6A 1BE3G 2Z5IA 4R4MA 1L2PA 1EZVI 1EZVG 2WQYC 3BRTB 4PD4E 4C7NB 1GMJA 5AVYB 3A3YB 3HD7C 3H1HG 2QIWA 1AQ5A 3U1AA 1YTZT 1A02F 3H32B 3V2RA 2OYIB 3TYYA 1RF1A 4GDOA 2FFDA 2J5UA 1LP1A 1FJPA 1EC5A 3F89A 1PP9J 1K05A 4H13C 3H1JE 4I7ZB 1YIJP 2POHA 5KJ7D 3TGUJ 2D2CB 1S5LH 3P8CE 3V5BA 1A02J 3KDPB 1SQVD 2E74D 1BGYD 1SQPD 1JY2O 4ASVA 1DH3A 3RK2B 2CK3H 2HLOA 3CXHH 2Q6QA 3HE5A 2WSFH 3A2AA 1FZEA 1FE6A 1JEKA 1L4AA 2FYUD 1AA0A 1SFCC 1HBWA 3BCCE 1M1JA 1OZHA 2OTJP 1ZRTD 1SQQK 1NGMB 4L74A 2KNCB 2QJYB 2J58A 1FC2C 1KC8Q 3SWKA 4AYCA 3L75E 3SWYA 1PGPA 3FXEA 1H0TA 4D6TE 4PV1D 3USSA 1M90Q 2BEZF 1KMIZ 1URQC 1SVFA 3Q5RA 1NU1G 1PZQA 1GL2C 2P1JA 1M8OB 3H1JJ 1GD2E 3VN0A 3L4FA 1J2JB 5CJ0A 3MGNA 2L5GB 4EI2A 1CI6B 1NTMK 1PGJA 2W27A 1ZR4A 1WMKA 2KUBA 1S2EA 2WPSA 4KJMA 3ZDMA 1VQ7P 3GF3A 3RK3D 2W8ZA 3HTKB 1GU5A 1K9MQ 5KLVK 1OW7A 1LTSC 3BCCJ 1YYCA 5AW9B 1MKMA 2JKVA 5AVTB 3BASA 5AVRB 1IFNA 5BU8B 2ZXEB 2ZT9C 5KKZB 3L75J 1HUCA 1RE4C 1JNMA 1LT9A 2NZ2A 1NTME 4D6TJ 5KLIB 2B9BA 1FOSE 2GUVA 5CHXA 3W67A 5CJ4A 3L72D 2BCCD 3AEDC 1HWTC 3OJAB 2E76D 3GHGC 3ABVC 1U7JA 3CX5D 2RKLA 2K1AA 1S4XA 3CWBG 1FZCB 4U3FE 3UIAA 1HGZA 2HODB 2NPSC 3CCMP 2XZRA 3Q3DA 1KILE 3GW6A 1RF1B 1FOSF 3R4YA 1S3JA 2FFDB 2WSEH 2YMYA 1LP1B 4EDFA 2KI7B 1E79H 1JCDA 3H1HE 3CCQP 1RE3A 5B5EH 1U57A 1GK6A 3A0BH 2YKOA 2Y0DA 1NTMJ 2W6AA 1FZBA 2VRSA 3FGAD 5AVVB 5DJUB 3L73G 5CCGC 2ITAA 4L75A 4WY4A 1L0NK 1EDJA 3HE5B 5B5EE 1LTBC 3B71A 2AXCA 3A0BE 1IZNB 1L4AB 3M9HA 2R5BA 3HD7A 5KLVJ 1EXJA 5CCHC 1M1JB 4WVZA 1Q86Q 1NTZD 4PD4I 4IFMA 4U3FJ 1VQ6P 1KYOH 2AEFA 2IFNA 3CCEP 2P7JA 1H0TB 2D2CD 3S9OA 2IDBA 2M3EA 1SQBK 1NAYA 3P32A 1DD4A 3GLMA 1NTKD 3EQ2A 1HF9A 1KYOE 4YPCA 2IX7C 3H1HJ 2Z4EA 5AVSB 1SQXD 1PPJD 4H44B 5AW6B 2ZYAA 2WSEJ 1JY3N 4N78E 1PP9D 1JUNA 3CMAP 1SQBE 3MP7B 1PFIA 1KILB 2O1KA 1TU3F 2P67A 1FBMA 2GUSA 1D7MA 2E75B 2QJKC 1GDTA 2Y9ZA 3B5NC 4O9BA 1BCCE 2JWDA 3CXHI 1LT9B 3T97A 3TNUA 1URQA 4MN4C 3L74G 3L75G 1GL2A 5BVZA 1S72P 2N9YB 4L76A 1KZUB 4KT0J 2ZXXA 1VF5C 3EWKA 1VL2A 2WPRA 3AE7C 4YXWH 1RQVA 1NTZK 2M5AA 1S5LE 2KOGA 2V4HA 3WUTA 3CCSP 1HJ0A 2I8DA 3G9RA 3AE2C 1SQQG 3NTNA 2YO3A 1YJ9P 3AEFC 5AVXB 1RF0C 1NTKK 4EIJA 3CCRP 1SQBJ 2ZYDA 1N7SB 3C9IA 3H6PA 4PJ0H 1AVOA 1VQ8P 3M9BA 2WWWA 2JR8A 1SQXK 1N8RQ 3CWBE 1RE4A 3TK1A 1AFOA 2KS1B 3AE3C 4Y99B 1X8YA 1KB9H 2K9YA 1CI6A 2ZYGA 3PJSK 1BCCJ 1ZLLA 4PJ0E 2MJZA 2N1TC 2PFXA 5AVWB 4GODA 2ZVOB 3K5BA 1VQOP 1NTMG 3GHGA 1Q82Q 1OVUA 4Y28J 1N73C 1NJIQ 2FKWB 4H0LD 1KB9E 3VYIA 3HD7B 3MHVA 3KYQA 3RL0C 1T2KC 2PRRA 3M06A 1G1JA 1P84H 3TSIA 1UIXA 2KSJA 5KLVG 2BEQD 4K3AA 3L73E 2IPPA 3CCLP 1NKZB 1FDOA 2Y9YA 4U3FG 3L36A 1JY3P 1S9KE 1DX7A 3H1ID 1P84E 4H13B 2E42A 1KORA 1CSBA 1L0LE 3L71D 1ZV8A 2A06G 1U7MA 2IYPA 3CWBJ 3L70D 1L4AD 3MIWA 1FZCA 2WITA 1NWQA 2HODA 2YIUC 1M57D 4BXLA 2AEJA 1VQ5P 3VMAA 1YJWP 2I1JA 4XFJA 2HR3A 1OVVA 1FJKA 1SFCB 3LW5J 1OW6A 5CCHA 1FZGA 2OGUA 1EQ7A 1PIXA 2Q3IA 3E1IA 3KZIH 1NO4A 1QVFO 1IFMA 1G2CB 2GA1A 1EDLA 1MFTA 1VQKP 5KTBA 2RMZA 1BSNA 2W8HA 3L73J 4NPFX 1OVRA 4IFDK 1YJNP 3KZIE 4ZMDA 4H44D 1HJBA 3T97B 3PTZA 3TNUB 1URQB 4HKZH 2RN0A 1GL2B 5DJTB 1L0LJ 2FXMA 3H1KG 3L35A 1L0NG 2QG4A 1HGVA 2M5AB 4Z1MH 1KYOI 1BE3D 3CXHE 3PLNA 4JQ0D 4JPZB 3L74E 2E43A 1EZVD 1SLQA 3I56P 2E75D 1XTGB 4DJGA 3H1HD 1NAFA 3KXDA 1M56D 3B5NA 2C0WA 1AVYA 1SQBG 2ZT9B 4DT0A 4DOJA 3CX5I 5KAFH 5AW3B 1SQQE 2KLUA 1W2EA 1EDKA 3L37A 4R4LA 2E5TA 4IL6X 3V2QA 1BCCG 5AVQB 2Q3EA 2OYOA 2RH0A 3M0AA 3A7OA 3D6ZA 3GHGB 3HRNA 2N9BA 2K3RA 1JMBA 5KAFE 2Q1KA 1KFMA 1OWAA 1KILA 1R5LA 2K9JA 1OX3A 5KAIH 1KN7A 5M1BA 5CMZA 2NPSB 2HG5D 2FY8A 4BWNA 2M0BA 3MZWB 1SQVK 2IBZD 3FXDA 1SQPK 1RF0A 2M8RA 4NPEA 3WUUA 2WSFJ 3L74J 1JM0A 5KAIE 2FYUK 4OGQC 2QM7A 2QJPC 1JMMA 3VTPC 4YTPC 2OYHC 4WY4D 5KLVE 5CBNA 2HPCA 4LLHA 1JCCA 1SQQJ 2N1TA 3HD7D 2B88A 1BGYE 5B66H 2WSCH 2C9NY 1NU1D 1N73A 1K73Q 1FU1A 3I5CA 3G6EP 3IN6A 2WZ7A 2JO1A 2YKPA 4HJGH 4OVNF 2A06E 1N7SA 1PGQA 3H1LD 3AE4C 1LTIC 3FWNA 1ZN5A 1FDMA 3G4SP 1ZRTE 1E5WA 2KS1A 3S1KA 1KB9I 3M0DC 3JC22 1Y9BA 1DD3A 2OTKE 3V4QA 2KIKA 1DEBA 2H88C 3AEEC 2JP3A 1KQSO 2H89C 3D71A 2CPSA 1YBKA 2JWAA 4DCKA 5EFWB 2QSIA 3G71P 2XNXA 1P84I 3QWOC 3NMDA 2NRGA 1L0LG 5H2FH 3IF4A 4ZKUA 1KFNA 1ZOYC 5APQA 2M3BA 3O6QA 2Q9IA 2LXCB 1SQVJ 1BGYJ 2FXPA 3AEGC 4H0LC 2YO2A 1LNQA 1JY3O 3V6IA 3RK3E 2FBWC 3H1KE 3AE6C 1L0NE 1UIIA 3CWBD 1QGKB 2KYVA 3RK2D 1URQD 5K5GB 4W7ZA 1SP4A 2QJKB 3SWFA 2WSCJ 2KB7P 3B5NB 4IFFA 1NU1K 1JO5A 3O8ZA 1QX8A 2H7HA 3VP9A 3CX5H 5AW8B 1GU4A 3CMEP 1VF5B 2XU6A 1LGHB 1SFCA 1KD1Q 3L72E 1JB0J 2BCCE 3OA7A 1VDFA 4BRYA 1NVOA 1X22A 3TGUD 3V2NA 1G2CA 3CX5E 1M7LA 3P42A 2K9JB 3KHUA 3E7KA 3TDKA 2ZT9D 2WTYA 1J1EC 1QEXA 2J59M 2A45I 4ASWA 2LKMA 3RL0g 5APUA 1WT6A 3H1KJ 1NYHA 3KQGA 5KJ7C 1L0NJ 4PD4D 1FZFA 1X79B 1BSHA 2FYNC 1FAVA 2E74C 4I2LC 1CW5A 2HPCB 3CL3D 2N1TB 1AQTA 1SS1A 3CI9A 2XKMA 1JOCA 1QL2A 1N73B 1XTCC 1G1IA 1R8EA 2PGDA 3L72J 2BCCJ 1K8AQ 3H1JD 1KTMA 3RL0B 3RBZA 1M1KQ 5APTA 2BASA 3P8CD 1NTZE 4PV1C 2KZIA 2H8PD 4N6JA 5AVUB 1KQLA 4W7YA 1T3JA 2ZAEB 3Q1MA 2OYHA 1IK7A 1BDDA 2JJLA 1NTKE 3BCCD 2QVAA 3E1RA 2W8IA 3CXHD 3LIEA 2FXOA 3R2PA 3NFQA 4TT3H 1S1CX 2YIUB 2NPSA 3L74D 3L75D 5CCHD 1SQXE 1LWUC 1PGOA 1R5SA 4WBAA 3ITKA 1VQ9P 2W6BA 4D6TD 1ZW0A 3O6QB 1FDIA 1J1DC 2WSSH 3EFFK 3RK3C 4AQRD 2K88A 1PV3A 1LTAC 2B87A 5CBOA 1WRGA 4LGDE 3Q5PA 2AEMA 1DIPA 4M3LA 3V4WA 1SQVG 3WMM0 1BGYG 1SQPG 4UB6H 1FS0E 3SFDC 3B8EB 1NHLA 4RKUJ 2IZ0A 2WT7A 4UB8H 3CCUP 4ZNCA 1SQQD 2FYUG 4Y99C 1NTZJ 1LTGC 4UB6E 5CCGA 3U59A 1T8ZA 1KQFB 3F5HA 1YI2P 2XDJA 4UB8E 4WY4C 1QVGO 3VMXA 2E76C 2K37A 3HUSC 2PAJA 3FWLA 1NTKJ 1GW3A 2HYNA 3OAKA 2Z5HA 4BRYB 5TISH 2IFMA 3Q5SA 2C0XA 1SQXJ 1NTMD 1N2DC 3B5ND 4CPGA 3MD0A 4QMAA 1GZLA 1MZ9A 5TISE 3NXSA 1LTJC 2YXRB 1VQ4P 2A45H 5KLVD 1VF5D 3PRJA 3QH9A 4TLFA 1H89A 4U3FD 1IC2A 1X0TA 4RJTA 2OQQA 3PH0A 1GW4A 1RH5B 2LR2A 2ZVNB 1DEEG 1KILD 4N3YB 2IBZI 2IBZG 2A06D 1T6AA 2P2UA 2YNYA 2OYIC 3AEBC 4YXDC 1VQNP 2JDIH 1T3UA 2QRXA 5GTIH 3EFGA 4I7ZC 1VQLP 2R3CA 3L72G 2BCCG 1Y47A 1IO4A 1OIPA 1JY2N 1HVVA 1QL1A 1LT1A 1OFCX 2D2CC 1H88A 3A0HH 5E79H 4HH2A 3MUDC 2QEXP 1HTLC 5GTIE 1NOHA 2LXBA 1N7LA 5KJ7A 3RK2C 4OGQB 2R32A 1S5LX 2XNDH 2QJPB 2N1TD 3H1IE 2OYHB 3GF7A 4JYCA 3BVHA 1Q81Q 3L71E 5AW2B 3A0HE 5E79E 2DW3A 2W83C 3H1LG 3AE9C 2KXPB 3L70E 3RL0D 1T2KD 2G3AA 3AE1C 1N7SD 2QJYC 1RY3A 2QM8A 3RGUA 3H1KD 4GOEA 3IR9A 3VOPA 1L0ND 1OW8A 4GT1A 1QLED 2B87B 4XE5B 3WU2H 2C9LY 3TF5A 1KYOD 4OWFA 2R5DA 3GMAA 2WT7B 4AUWA 1Q7YQ 1FZAA 5TJHA 4KHXA 5APYA 4OH8B 5GTHH 3HE4A 4RO0A 3WU2E 2IYOA 3S4RA 1EDIA 4N78D 1NTZG 3H25A 1SQVE 1SQPE 3AE5C 1H8AA 3C8VA 1YHQP 1SQBD 2QE7H 3IAOA 3MTUE 3H1IJ 3WUVA 5GTHE 2E5YA 4K35A 3L71J 4JF7A 3CLQA 2FYUE 2WMMA 1LWUA 2Y0CA 3SSUA 3CC7P 3D6YA 1LTTC 1NTKG 2O01N 1YITP 5B66E 2H43A 3L70J 4H13D 1BE3E 1BCCD 2R44A 4RESB 1Y8AA 2WPQA 4H0LB 5KKZC 1PL5A 3CPWO 1VPCA 1EZVE 2YXQB 4GIFA 1SQXG 1PPJG 2GM4A 1Q2NA 5KLIC 3FX0A 3C1LA 2YMKA 4L73A 3CCVP 2WVRA 5APSA 1X9VA 1YTZI 2KK7A 1PP9G 3N7NA 1RQUA 3GG2A 3TGUG 1GK4A 1SFCD 3KPEA 1IJDB 1FZCC 5APWA 1JY2P 1MV8A 4WWIA 2P58A 1JTHA 4B86A 2W90A 2OTLP 2O3JA 2V7QH 3HUSA 1SQPJ 1VQPP 2CPBA 2OARA 1EXIA 1AJYA 3AEAC 3G3ZA 3D70A 2HFED 1ZMEC 1RF1C 1IFDA 2FYZA 3V2PA 1GTWA 2FFDC 4C46A 5H2FE 1USDA 2FYUJ 3BRVB 2W6JH 3AECC 4NPDA 1YQ4C 2WPVB 1GL2D 5AW4B 4IOIH 1BE3J 1KQGB 3I55P 2IBZE 1J1EB 1HH0A 1LTJA 3N4XA 2KSEA 2KZJA 4C7NA 1KB9D 1OMIA 1CZQA 2FYNB 1L4AC 2E74B 2Q7CA 3H1JG 2O01H 1YQ3C 3VP8A 1M1JC 3L73D 3H32A 3JCUH 2OYIA 1RHZB 3LIDA 1IFIA 1NU1E 1USEA 1IFJA 2JEEA 3VMYA 3II6A 1N86A 3JSVC 1S9KD 4W80A 5APVA 4C7RA 1P84D 1NKNA 2A45G 1L0LD 3VMZA 3AE8C 1ZP0C 3H1LE 1IK9A 4OGQD 3JCUE 4PV1B 3BCCG 3MUDA 1K04A 2V7QJ 5AW1B
chains in the Genus database with same CATH topology
3A5TA 1OXZA 1W2EA 2W6AA 1FZBA 3HE4B 2VRSA 5CCGA 5AVVB 5AW0B 3U59A 3P7KA 2ZFCA 1T8ZA 3L37A 5CCGC 4WY4A 2XDJA 1L0NK 1ZR2A 2NPSD 4WY4C 3V2QA 4DZOA 5AVQB 3VMXA 3HE5B 4ZKPA 1LTBC 3M0AA 3A7OA 3GHGB 3HRNA 3HUSC 2N9BA 2PAJA 2XV5A 1L4AB 3M9HA 2R5BA 3HD7A 5APXA 5AW5B 5BU5A 1GW3A 2HYNA 3OAKA 1KFMA 1OWAA 1KILA 2Z5HA 5CCHC 5AW7B 1MUUA 1M1JB 1KILC 3U1CA 1LWUB 5CMZA 2IFMA 2NPSB 2HG5D 2C0XA 4IFMA 1J1DB 1SQVK 2IFNA 3RK3B 1SQPK 1N2DC 1RF0A 2M8RA 3B5ND 2P7JA 2KLVA 3MD0A 1Z56A 1NH4A 4EOTA 1LT9C 5AVZB 2Q5UA 1GZLA 1MZ9A 1SQBK 3NXSA 1LTJC 3P32A 2FYUK 2YKQA 4JYBA 4WB4A 2A45H 3EQ2A 2QM7A 5CCGD 1JMMA 3LW5H 3VTPC 2IX7C 2OYHC 4I1LA 4LC1A 4WY4D 2Z4EA 1H89A 3M91A 5AVSB 1IC2A 2HPCA 4LLHA 5AW6B 2KP8A 3IFMA 1JCCA 4GKGA 2N1TA 3HD7D 1GW4A 2WSCH 4XA4A 2C9NY 1KILD 4N3YB 1JTHB 1JY3N 4N78E 4WY4B 1N73A 1FU1A 3I5CA 2P2UA 3PP5A 2WZ7A 1L0LK 1JUNA 2YNYA 2OYIC 3HUSB 3HTKA 2YKPA 1MFZA 1N7SA 3BATA 1T3UA 4HYTB 1PFIA 3EFGA 3P8MC 1KILB 1N7SC 2O1KA 1LTIC 2P67A 1FBMA 1ZN5A 1FDMA 2GUSA 2R3CA 1E5WA 3M0DA 1GDTA 1IO4A 2O1JA 3M0DC 3B5NC 1JY2N 4O9BA 1HVVA 1QL1A 4I6MC 2I1KA 1H88A 1RE3C 4HH2A 3V4QA 1LT9B 1HTLC 3T97A 3TNUA 1URQA 1NOHA 1DEBA 3M9QA 1N7LA 5KJ7A 3RK2C 1LTJB 1GL2A 2PP6A 5BVZA 2Z5IA 2R32A 1KZUB 2CPSA 2N1TD 2WPRA 2OYHB 3BRTB 4JYCA 3BVHA 5AW2B 5AW1B 1NTZK 4C7NB 2XNXA 5AVYB 2KOGA 3A3YB 3NMDA 3HD7C 4ZKUA 3RL0D 1T2KD 1KFNA 5APQA 2M3BA 1N7SD 2Q9IA 1AQ5A 3U1AA 1YTZT 1A02F 3NTNA 1RY3A 2QM8A 3H32B 3V2RA 2OYIB 3TYYA 2YO3A 3IR9A 2YO2A 1RF1A 3VOPA 5AVXB 4GT1A 1JY3O 1RF0C 1NTKK 4XE5B 2FFDA 4EIJA 2C9LY 1FJPA 1N7SB 3C9IA 3H6PA 2KYVA 2POHA 3M9BA 3RK2D 2WWWA 1URQD 2R5DA 4W7ZA 1SP4A 5KJ7D 1SQXK 1RE4A 2WT7B 3SWFA 4AUWA 3TK1A 1FZAA 2KB7P 4KHXA 3B5NB 5APYA 1AFOA 4OH8B 4Y99B 3P8CE 3V5BA 1A02J 1X8YA 1NU1K 3KDPB 1JO5A 3HE4A 1CI6A 1JY2O 3O8ZA 1ZLLA 2H7HA 1DH3A 3RK2B 3VP9A 2HLOA 4N78D 5AW8B 2MJZA 1GU4A 2N1TC 1H8AA 2XU6A 3HE5A 5AVWB 2WSFH 3A2AA 1FZEA 3GHGA 1LGHB 3MTUE 1L4AA 1SFCA 1N73C 2FKWB 1SFCC 3OA7A 1HBWA 1VDFA 4JF7A 3VYIA 3CLQA 1M1JA 3HD7B 1LWUA 3RL0C 3KYQA 1T2KC 3V2NA 1SQQK 1G2CA 3M06A 1G1JA 1M7LA 3P42A 3TSIA 1LTTC 2J58A 2KSJA 2H43A 4AYCA 3SWYA 4RESB 2IPPA 1NKZB 2WPQA 2WTYA 1VPCA 4GIFA 1J1EC 2J59M 3L36A 2A45I 2GM4A 1JY3P 2LKMA 1S9KE 1DX7A 5APUA 1WT6A 2E42A 1URQC 1SVFA 3KQGA 1CSBA 5KJ7C 5APSA 1GL2C 1X9VA 1YTZI 2P1JA 1FZFA 1ZV8A 1X79B 1GD2E 3VN0A 3L4FA 3N7NA 1J2JB 5CJ0A 1FAVA 3MGNA 2L5GB 1GK4A 1L4AD 1SFCD 4I2LC 3MIWA 1FZCA 1CI6B 2WITA 1NWQA 1CW5A 3KPEA 1IJDB 1NTMK 2HPCB 2HODA 2W27A 3CL3D 1FZCC 5APWA 1JY2P 1MV8A 1JTHA 1ZR4A 2N1TB 4B86A 2WPSA 3CI9A 2XKMA 3HUSA 2I1JA 1JOCA 1QL2A 2CPBA 2OARA 3RK3D 1N73B 1XTCC 1FJKA 1SFCB 3G3ZA 1G1IA 5CCHA 2HFED 1FZGA 3HTKB 1GU5A 1RF1C 5KLVK 1EQ7A 1IFDA 2Q3IA 2FYZA 3V2PA 3RL0B 3E1IA 1GTWA 2FFDC 4C46A 1LTSC 1NO4A 1IFMA 1YYCA 3BRVB 5AW9B 1G2CB 5APTA 5AVTB 3BASA 5AVRB 2BASA 3P8CD 1IFNA 1GL2D 5BU8B 5AW4B 2ZXEB 5KTBA 1HUCA 1RE4C 1JNMA 1LT9A 2W8HA 1J1EB 4IFDK 2H8PD 1HH0A 1LTJA 3N4XA 4N6JA 5AVUB 1FOSE 2GUVA 1KQLA 4W7YA 5CHXA 1T3JA 1HJBA 3TNUB 1URQB 5CJ4A 1GL2B 2OYHA 4C7NA 2JJLA 2FXMA 1HWTC 3OJAB 3GHGC 3L35A 1CZQA 1L4AC 1HGVA 2Q7CA 2W8IA 3LIEA 3R2PA 2O01H 3NFQA 3VP8A 2NPSA 5CCHD 1M1JC 1FZCB 3UIAA 1HGZA 1LWUC 2HODB 2NPSC 4WBAA 2W6BA 3H32A 2OYIA 2XZRA 3LIDA 1IFIA 2E43A 1J1DC 1SLQA 3RK3C 4AQRD 1IFJA 1XTGB 2JEEA 1LTAC 3VMYA 1WRGA 1N86A 3II6A 4LGDE 1S9KD 4W80A 4M3LA 5APVA 4C7RA 3V4WA 1RF1B 1FOSF 3WMM0 1NKNA 2A45G 3B8EB 1NHLA 2FFDB 2WSEH 3VMZA 2YMYA 1NAFA 2WT7A 1IK9A 3B5NA 1JCDA 2C0WA 1RE3A 3MUDA 4DOJA 4Y99C 1GK6A 2YKOA 1LTGC 5AW3B 4IFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P42 A;  2W8H A;  1AFO A;  2J58 A;  2W8I A; 
#chains in the Genus database with same CATH topology
 3A5T A;  1OXZ A;  4H44 C;  4IL6 H;  3HE4 B;  2AXT H;  3CCJ P;  5AW0 B;  3P7K A;  2ZFC A;  4D6T G;  1ZR2 A;  4HB1 A;  2NPS D;  4DZO A;  4ZKP A;  4EYY Q;  1LJ2 A;  2XV5 A;  5APX A;  5AW5 B;  5BU5 A;  3SFE C;  2ZJS E;  2KNC A;  4IL6 E;  2P10 A;  2AXT E;  5AW7 B;  1MUU A;  3U1C A;  1KIL C;  3H1I G;  1LWU B;  3CC2 P;  3L71 G;  3RBX A;  2R3S A;  2SPZ A;  2E75 C;  1J1D B;  3CC4 P;  3RK3 B;  3W68 A;  3Q2Y A;  2L91 A;  2KLV A;  1NU1 J;  1Z56 A;  4JBZ A;  3L70 G;  1NH4 A;  1W5C E;  1LT9 C;  4EOT A;  3B4S A;  5AVZ B;  2Q5U A;  2QA4 P;  1Q90 D;  2YKQ A;  4JYB A;  2O01 J;  4WB4 A;  1AV1 A;  5CCG D;  2B89 A;  3LW5 H;  3H1L J;  4I1L A;  4LC1 A;  3M91 A;  2KP8 A;  1VQM P;  3IFM A;  4GKG A;  3CD6 P;  1BDC A;  4XA4 A;  1PPJ E;  3OW2 O;  1JTH B;  4WY4 B;  2IZ1 A;  1IFP A;  2E76 B;  3PP5 A;  1L0L K;  5C39 A;  3HUS B;  3HTK A;  1ZXG A;  1MFZ A;  1PP9 E;  2Y0E A;  3BAT A;  4HYT B;  1KV4 A;  3P8M C;  4GOF A;  1N7S C;  3TGU E;  2MKV A;  3M0D A;  4U7J A;  2O1J A;  4PD4 H;  4I6M C;  2I1K A;  1RE3 C;  4A7P A;  2UWJ E;  1W2B O;  3PHL A;  5L8R J;  3M9Q A;  2G8Y A;  1LTJ B;  2PP6 A;  1BE3 G;  2Z5I A;  4R4M A;  1L2P A;  1EZV I;  1EZV G;  2WQY C;  3BRT B;  4PD4 E;  4C7N B;  1GMJ A;  5AVY B;  3A3Y B;  3HD7 C;  3H1H G;  2QIW A;  1AQ5 A;  3U1A A;  1YTZ T;  1A02 F;  3H32 B;  3V2R A;  2OYI B;  3TYY A;  1RF1 A;  4GDO A;  2FFD A;  2J5U A;  1LP1 A;  1FJP A;  1EC5 A;  3F89 A;  1PP9 J;  1K05 A;  4H13 C;  3H1J E;  4I7Z B;  1YIJ P;  2POH A;  5KJ7 D;  3TGU J;  2D2C B;  1S5L H;  3P8C E;  3V5B A;  1A02 J;  3KDP B;  1SQV D;  2E74 D;  1BGY D;  1SQP D;  1JY2 O;  4ASV A;  1DH3 A;  3RK2 B;  2CK3 H;  2HLO A;  3CXH H;  2Q6Q A;  3HE5 A;  2WSF H;  3A2A A;  1FZE A;  1FE6 A;  1JEK A;  1L4A A;  2FYU D;  1AA0 A;  1SFC C;  1HBW A;  3BCC E;  1M1J A;  1OZH A;  2OTJ P;  1ZRT D;  1SQQ K;  1NGM B;  4L74 A;  2KNC B;  2QJY B;  2J58 A;  1FC2 C;  1KC8 Q;  3SWK A;  4AYC A;  3L75 E;  3SWY A;  1PGP A;  3FXE A;  1H0T A;  4D6T E;  4PV1 D;  3USS A;  1M90 Q;  2BEZ F;  1KMI Z;  1URQ C;  1SVF A;  3Q5R A;  1NU1 G;  1PZQ A;  1GL2 C;  2P1J A;  1M8O B;  3H1J J;  1GD2 E;  3VN0 A;  3L4F A;  1J2J B;  5CJ0 A;  3MGN A;  2L5G B;  4EI2 A;  1CI6 B;  1NTM K;  1PGJ A;  2W27 A;  1ZR4 A;  1WMK A;  2KUB A;  1S2E A;  2WPS A;  4KJM A;  3ZDM A;  1VQ7 P;  3GF3 A;  3RK3 D;  2W8Z A;  3HTK B;  1GU5 A;  1K9M Q;  5KLV K;  1OW7 A;  1LTS C;  3BCC J;  1YYC A;  5AW9 B;  1MKM A;  2JKV A;  5AVT B;  3BAS A;  5AVR B;  1IFN A;  5BU8 B;  2ZXE B;  2ZT9 C;  5KKZ B;  3L75 J;  1HUC A;  1RE4 C;  1JNM A;  1LT9 A;  2NZ2 A;  1NTM E;  4D6T J;  5KLI B;  2B9B A;  1FOS E;  2GUV A;  5CHX A;  3W67 A;  5CJ4 A;  3L72 D;  2BCC D;  3AED C;  1HWT C;  3OJA B;  2E76 D;  3GHG C;  3ABV C;  1U7J A;  3CX5 D;  2RKL A;  2K1A A;  1S4X A;  3CWB G;  1FZC B;  4U3F E;  3UIA A;  1HGZ A;  2HOD B;  2NPS C;  3CCM P;  2XZR A;  3Q3D A;  1KIL E;  3GW6 A;  1RF1 B;  1FOS F;  3R4Y A;  1S3J A;  2FFD B;  2WSE H;  2YMY A;  1LP1 B;  4EDF A;  2KI7 B;  1E79 H;  1JCD A;  3H1H E;  3CCQ P;  1RE3 A;  5B5E H;  1U57 A;  1GK6 A;  3A0B H;  2YKO A;  2Y0D A;  1NTM J;  2W6A A;  1FZB A;  2VRS A;  3FGA D;  5AVV B;  5DJU B;  3L73 G;  5CCG C;  2ITA A;  4L75 A;  4WY4 A;  1L0N K;  1EDJ A;  3HE5 B;  5B5E E;  1LTB C;  3B71 A;  2AXC A;  3A0B E;  1IZN B;  1L4A B;  3M9H A;  2R5B A;  3HD7 A;  5KLV J;  1EXJ A;  5CCH C;  1M1J B;  4WVZ A;  1Q86 Q;  1NTZ D;  4PD4 I;  4IFM A;  4U3F J;  1VQ6 P;  1KYO H;  2AEF A;  2IFN A;  3CCE P;  2P7J A;  1H0T B;  2D2C D;  3S9O A;  2IDB A;  2M3E A;  1SQB K;  1NAY A;  3P32 A;  1DD4 A;  3GLM A;  1NTK D;  3EQ2 A;  1HF9 A;  1KYO E;  4YPC A;  2IX7 C;  3H1H J;  2Z4E A;  5AVS B;  1SQX D;  1PPJ D;  4H44 B;  5AW6 B;  2ZYA A;  2WSE J;  1JY3 N;  4N78 E;  1PP9 D;  1JUN A;  3CMA P;  1SQB E;  3MP7 B;  1PFI A;  1KIL B;  2O1K A;  1TU3 F;  2P67 A;  1FBM A;  2GUS A;  1D7M A;  2E75 B;  2QJK C;  1GDT A;  2Y9Z A;  3B5N C;  4O9B A;  1BCC E;  2JWD A;  3CXH I;  1LT9 B;  3T97 A;  3TNU A;  1URQ A;  4MN4 C;  3L74 G;  3L75 G;  1GL2 A;  5BVZ A;  1S72 P;  2N9Y B;  4L76 A;  1KZU B;  4KT0 J;  2ZXX A;  1VF5 C;  3EWK A;  1VL2 A;  2WPR A;  3AE7 C;  4YXW H;  1RQV A;  1NTZ K;  2M5A A;  1S5L E;  2KOG A;  2V4H A;  3WUT A;  3CCS P;  1HJ0 A;  2I8D A;  3G9R A;  3AE2 C;  1SQQ G;  3NTN A;  2YO3 A;  1YJ9 P;  3AEF C;  5AVX B;  1RF0 C;  1NTK K;  4EIJ A;  3CCR P;  1SQB J;  2ZYD A;  1N7S B;  3C9I A;  3H6P A;  4PJ0 H;  1AVO A;  1VQ8 P;  3M9B A;  2WWW A;  2JR8 A;  1SQX K;  1N8R Q;  3CWB E;  1RE4 A;  3TK1 A;  1AFO A;  2KS1 B;  3AE3 C;  4Y99 B;  1X8Y A;  1KB9 H;  2K9Y A;  1CI6 A;  2ZYG A;  3PJS K;  1BCC J;  1ZLL A;  4PJ0 E;  2MJZ A;  2N1T C;  2PFX A;  5AVW B;  4GOD A;  2ZVO B;  3K5B A;  1VQO P;  1NTM G;  3GHG A;  1Q82 Q;  1OVU A;  4Y28 J;  1N73 C;  1NJI Q;  2FKW B;  4H0L D;  1KB9 E;  3VYI A;  3HD7 B;  3MHV A;  3KYQ A;  3RL0 C;  1T2K C;  2PRR A;  3M06 A;  1G1J A;  1P84 H;  3TSI A;  1UIX A;  2KSJ A;  5KLV G;  2BEQ D;  4K3A A;  3L73 E;  2IPP A;  3CCL P;  1NKZ B;  1FDO A;  2Y9Y A;  4U3F G;  3L36 A;  1JY3 P;  1S9K E;  1DX7 A;  3H1I D;  1P84 E;  4H13 B;  2E42 A;  1KOR A;  1CSB A;  1L0L E;  3L71 D;  1ZV8 A;  2A06 G;  1U7M A;  2IYP A;  3CWB J;  3L70 D;  1L4A D;  3MIW A;  1FZC A;  2WIT A;  1NWQ A;  2HOD A;  2YIU C;  1M57 D;  4BXL A;  2AEJ A;  1VQ5 P;  3VMA A;  1YJW P;  2I1J A;  4XFJ A;  2HR3 A;  1OVV A;  1FJK A;  1SFC B;  3LW5 J;  1OW6 A;  5CCH A;  1FZG A;  2OGU A;  1EQ7 A;  1PIX A;  2Q3I A;  3E1I A;  3KZI H;  1NO4 A;  1QVF O;  1IFM A;  1G2C B;  2GA1 A;  1EDL A;  1MFT A;  1VQK P;  5KTB A;  2RMZ A;  1BSN A;  2W8H A;  3L73 J;  4NPF X;  1OVR A;  4IFD K;  1YJN P;  3KZI E;  4ZMD A;  4H44 D;  1HJB A;  3T97 B;  3PTZ A;  3TNU B;  1URQ B;  4HKZ H;  2RN0 A;  1GL2 B;  5DJT B;  1L0L J;  2FXM A;  3H1K G;  3L35 A;  1L0N G;  2QG4 A;  1HGV A;  2M5A B;  4Z1M H;  1KYO I;  1BE3 D;  3CXH E;  3PLN A;  4JQ0 D;  4JPZ B;  3L74 E;  2E43 A;  1EZV D;  1SLQ A;  3I56 P;  2E75 D;  1XTG B;  4DJG A;  3H1H D;  1NAF A;  3KXD A;  1M56 D;  3B5N A;  2C0W A;  1AVY A;  1SQB G;  2ZT9 B;  4DT0 A;  4DOJ A;  3CX5 I;  5KAF H;  5AW3 B;  1SQQ E;  2KLU A;  1W2E A;  1EDK A;  3L37 A;  4R4L A;  2E5T A;  4IL6 X;  3V2Q A;  1BCC G;  5AVQ B;  2Q3E A;  2OYO A;  2RH0 A;  3M0A A;  3A7O A;  3D6Z A;  3GHG B;  3HRN A;  2N9B A;  2K3R A;  1JMB A;  5KAF E;  2Q1K A;  1KFM A;  1OWA A;  1KIL A;  1R5L A;  2K9J A;  1OX3 A;  5KAI H;  1KN7 A;  5M1B A;  5CMZ A;  2NPS B;  2HG5 D;  2FY8 A;  4BWN A;  2M0B A;  3MZW B;  1SQV K;  2IBZ D;  3FXD A;  1SQP K;  1RF0 A;  2M8R A;  4NPE A;  3WUU A;  2WSF J;  3L74 J;  1JM0 A;  5KAI E;  2FYU K;  4OGQ C;  2QM7 A;  2QJP C;  1JMM A;  3VTP C;  4YTP C;  2OYH C;  4WY4 D;  5KLV E;  5CBN A;  2HPC A;  4LLH A;  1JCC A;  1SQQ J;  2N1T A;  3HD7 D;  2B88 A;  1BGY E;  5B66 H;  2WSC H;  2C9N Y;  1NU1 D;  1N73 A;  1K73 Q;  1FU1 A;  3I5C A;  3G6E P;  3IN6 A;  2WZ7 A;  2JO1 A;  2YKP A;  4HJG H;  4OVN F;  2A06 E;  1N7S A;  1PGQ A;  3H1L D;  3AE4 C;  1LTI C;  3FWN A;  1ZN5 A;  1FDM A;  3G4S P;  1ZRT E;  1E5W A;  2KS1 A;  3S1K A;  1KB9 I;  3M0D C;  3JC2 2;  1Y9B A;  1DD3 A;  2OTK E;  3V4Q A;  2KIK A;  1DEB A;  2H88 C;  3AEE C;  2JP3 A;  1KQS O;  2H89 C;  3D71 A;  2CPS A;  1YBK A;  2JWA A;  4DCK A;  5EFW B;  2QSI A;  3G71 P;  2XNX A;  1P84 I;  3QWO C;  3NMD A;  2NRG A;  1L0L G;  5H2F H;  3IF4 A;  4ZKU A;  1KFN A;  1ZOY C;  5APQ A;  2M3B A;  3O6Q A;  2Q9I A;  2LXC B;  1SQV J;  1BGY J;  2FXP A;  3AEG C;  4H0L C;  2YO2 A;  1LNQ A;  1JY3 O;  3V6I A;  3RK3 E;  2FBW C;  3H1K E;  3AE6 C;  1L0N E;  1UII A;  3CWB D;  1QGK B;  2KYV A;  3RK2 D;  1URQ D;  5K5G B;  4W7Z A;  1SP4 A;  2QJK B;  3SWF A;  2WSC J;  2KB7 P;  3B5N B;  4IFF A;  1NU1 K;  1JO5 A;  3O8Z A;  1QX8 A;  2H7H A;  3VP9 A;  3CX5 H;  5AW8 B;  1GU4 A;  3CME P;  1VF5 B;  2XU6 A;  1LGH B;  1SFC A;  1KD1 Q;  3L72 E;  1JB0 J;  2BCC E;  3OA7 A;  1VDF A;  4BRY A;  1NVO A;  1X22 A;  3TGU D;  3V2N A;  1G2C A;  3CX5 E;  1M7L A;  3P42 A;  2K9J B;  3KHU A;  3E7K A;  3TDK A;  2ZT9 D;  2WTY A;  1J1E C;  1QEX A;  2J59 M;  2A45 I;  4ASW A;  2LKM A;  3RL0 g;  5APU A;  1WT6 A;  3H1K J;  1NYH A;  3KQG A;  5KJ7 C;  1L0N J;  4PD4 D;  1FZF A;  1X79 B;  1BSH A;  2FYN C;  1FAV A;  2E74 C;  4I2L C;  1CW5 A;  2HPC B;  3CL3 D;  2N1T B;  1AQT A;  1SS1 A;  3CI9 A;  2XKM A;  1JOC A;  1QL2 A;  1N73 B;  1XTC C;  1G1I A;  1R8E A;  2PGD A;  3L72 J;  2BCC J;  1K8A Q;  3H1J D;  1KTM A;  3RL0 B;  3RBZ A;  1M1K Q;  5APT A;  2BAS A;  3P8C D;  1NTZ E;  4PV1 C;  2KZI A;  2H8P D;  4N6J A;  5AVU B;  1KQL A;  4W7Y A;  1T3J A;  2ZAE B;  3Q1M A;  2OYH A;  1IK7 A;  1BDD A;  2JJL A;  1NTK E;  3BCC D;  2QVA A;  3E1R A;  2W8I A;  3CXH D;  3LIE A;  2FXO A;  3R2P A;  3NFQ A;  4TT3 H;  1S1C X;  2YIU B;  2NPS A;  3L74 D;  3L75 D;  5CCH D;  1SQX E;  1LWU C;  1PGO A;  1R5S A;  4WBA A;  3ITK A;  1VQ9 P;  2W6B A;  4D6T D;  1ZW0 A;  3O6Q B;  1FDI A;  1J1D C;  2WSS H;  3EFF K;  3RK3 C;  4AQR D;  2K88 A;  1PV3 A;  1LTA C;  2B87 A;  5CBO A;  1WRG A;  4LGD E;  3Q5P A;  2AEM A;  1DIP A;  4M3L A;  3V4W A;  1SQV G;  3WMM 0;  1BGY G;  1SQP G;  4UB6 H;  1FS0 E;  3SFD C;  3B8E B;  1NHL A;  4RKU J;  2IZ0 A;  2WT7 A;  4UB8 H;  3CCU P;  4ZNC A;  1SQQ D;  2FYU G;  4Y99 C;  1NTZ J;  1LTG C;  4UB6 E;  5CCG A;  3U59 A;  1T8Z A;  1KQF B;  3F5H A;  1YI2 P;  2XDJ A;  4UB8 E;  4WY4 C;  1QVG O;  3VMX A;  2E76 C;  2K37 A;  3HUS C;  2PAJ A;  3FWL A;  1NTK J;  1GW3 A;  2HYN A;  3OAK A;  2Z5H A;  4BRY B;  5TIS H;  2IFM A;  3Q5S A;  2C0X A;  1SQX J;  1NTM D;  1N2D C;  3B5N D;  4CPG A;  3MD0 A;  4QMA A;  1GZL A;  1MZ9 A;  5TIS E;  3NXS A;  1LTJ C;  2YXR B;  1VQ4 P;  2A45 H;  5KLV D;  1VF5 D;  3PRJ A;  3QH9 A;  4TLF A;  1H89 A;  4U3F D;  1IC2 A;  1X0T A;  4RJT A;  2OQQ A;  3PH0 A;  1GW4 A;  1RH5 B;  2LR2 A;  2ZVN B;  1DEE G;  1KIL D;  4N3Y B;  2IBZ I;  2IBZ G;  2A06 D;  1T6A A;  2P2U A;  2YNY A;  2OYI C;  3AEB C;  4YXD C;  1VQN P;  2JDI H;  1T3U A;  2QRX A;  5GTI H;  3EFG A;  4I7Z C;  1VQL P;  2R3C A;  3L72 G;  2BCC G;  1Y47 A;  1IO4 A;  1OIP A;  1JY2 N;  1HVV A;  1QL1 A;  1LT1 A;  1OFC X;  2D2C C;  1H88 A;  3A0H H;  5E79 H;  4HH2 A;  3MUD C;  2QEX P;  1HTL C;  5GTI E;  1NOH A;  2LXB A;  1N7L A;  5KJ7 A;  3RK2 C;  4OGQ B;  2R32 A;  1S5L X;  2XND H;  2QJP B;  2N1T D;  3H1I E;  2OYH B;  3GF7 A;  4JYC A;  3BVH A;  1Q81 Q;  3L71 E;  5AW2 B;  3A0H E;  5E79 E;  2DW3 A;  2W83 C;  3H1L G;  3AE9 C;  2KXP B;  3L70 E;  3RL0 D;  1T2K D;  2G3A A;  3AE1 C;  1N7S D;  2QJY C;  1RY3 A;  2QM8 A;  3RGU A;  3H1K D;  4GOE A;  3IR9 A;  3VOP A;  1L0N D;  1OW8 A;  4GT1 A;  1QLE D;  2B87 B;  4XE5 B;  3WU2 H;  2C9L Y;  3TF5 A;  1KYO D;  4OWF A;  2R5D A;  3GMA A;  2WT7 B;  4AUW A;  1Q7Y Q;  1FZA A;  5TJH A;  4KHX A;  5APY A;  4OH8 B;  5GTH H;  3HE4 A;  4RO0 A;  3WU2 E;  2IYO A;  3S4R A;  1EDI A;  4N78 D;  1NTZ G;  3H25 A;  1SQV E;  1SQP E;  3AE5 C;  1H8A A;  3C8V A;  1YHQ P;  1SQB D;  2QE7 H;  3IAO A;  3MTU E;  3H1I J;  3WUV A;  5GTH E;  2E5Y A;  4K35 A;  3L71 J;  4JF7 A;  3CLQ A;  2FYU E;  2WMM A;  1LWU A;  2Y0C A;  3SSU A;  3CC7 P;  3D6Y A;  1LTT C;  1NTK G;  2O01 N;  1YIT P;  5B66 E;  2H43 A;  3L70 J;  4H13 D;  1BE3 E;  1BCC D;  2R44 A;  4RES B;  1Y8A A;  2WPQ A;  4H0L B;  5KKZ C;  1PL5 A;  3CPW O;  1VPC A;  1EZV E;  2YXQ B;  4GIF A;  1SQX G;  1PPJ G;  2GM4 A;  1Q2N A;  5KLI C;  3FX0 A;  3C1L A;  2YMK A;  4L73 A;  3CCV P;  2WVR A;  5APS A;  1X9V A;  1YTZ I;  2KK7 A;  1PP9 G;  3N7N A;  1RQU A;  3GG2 A;  3TGU G;  1GK4 A;  1SFC D;  3KPE A;  1IJD B;  1FZC C;  5APW A;  1JY2 P;  1MV8 A;  4WWI A;  2P58 A;  1JTH A;  4B86 A;  2W90 A;  2OTL P;  2O3J A;  2V7Q H;  3HUS A;  1SQP J;  1VQP P;  2CPB A;  2OAR A;  1EXI A;  1AJY A;  3AEA C;  3G3Z A;  3D70 A;  2HFE D;  1ZME C;  1RF1 C;  1IFD A;  2FYZ A;  3V2P A;  1GTW A;  2FFD C;  4C46 A;  5H2F E;  1USD A;  2FYU J;  3BRV B;  2W6J H;  3AEC C;  4NPD A;  1YQ4 C;  2WPV B;  1GL2 D;  5AW4 B;  4IOI H;  1BE3 J;  1KQG B;  3I55 P;  2IBZ E;  1J1E B;  1HH0 A;  1LTJ A;  3N4X A;  2KSE A;  2KZJ A;  4C7N A;  1KB9 D;  1OMI A;  1CZQ A;  2FYN B;  1L4A C;  2E74 B;  2Q7C A;  3H1J G;  2O01 H;  1YQ3 C;  3VP8 A;  1M1J C;  3L73 D;  3H32 A;  3JCU H;  2OYI A;  1RHZ B;  3LID A;  1IFI A;  1NU1 E;  1USE A;  1IFJ A;  2JEE A;  3VMY A;  3II6 A;  1N86 A;  3JSV C;  1S9K D;  4W80 A;  5APV A;  4C7R A;  1P84 D;  1NKN A;  2A45 G;  1L0L D;  3VMZ A;  3AE8 C;  1ZP0 C;  3H1L E;  1IK9 A;  4OGQ D;  3JCU E;  4PV1 B;  3BCC G;  3MUD A;  1K04 A;  2V7Q J;  5AW1 B; 
#chains in the Genus database with same CATH homology
 3A5T A;  1OXZ A;  1W2E A;  2W6A A;  1FZB A;  3HE4 B;  2VRS A;  5CCG A;  5AVV B;  5AW0 B;  3U59 A;  3P7K A;  2ZFC A;  1T8Z A;  3L37 A;  5CCG C;  4WY4 A;  2XDJ A;  1L0N K;  1ZR2 A;  2NPS D;  4WY4 C;  3V2Q A;  4DZO A;  5AVQ B;  3VMX A;  3HE5 B;  4ZKP A;  1LTB C;  3M0A A;  3A7O A;  3GHG B;  3HRN A;  3HUS C;  2N9B A;  2PAJ A;  2XV5 A;  1L4A B;  3M9H A;  2R5B A;  3HD7 A;  5APX A;  5AW5 B;  5BU5 A;  1GW3 A;  2HYN A;  3OAK A;  1KFM A;  1OWA A;  1KIL A;  2Z5H A;  5CCH C;  5AW7 B;  1MUU A;  1M1J B;  1KIL C;  3U1C A;  1LWU B;  5CMZ A;  2IFM A;  2NPS B;  2HG5 D;  2C0X A;  4IFM A;  1J1D B;  1SQV K;  2IFN A;  3RK3 B;  1SQP K;  1N2D C;  1RF0 A;  2M8R A;  3B5N D;  2P7J A;  2KLV A;  3MD0 A;  1Z56 A;  1NH4 A;  4EOT A;  1LT9 C;  5AVZ B;  2Q5U A;  1GZL A;  1MZ9 A;  1SQB K;  3NXS A;  1LTJ C;  3P32 A;  2FYU K;  2YKQ A;  4JYB A;  4WB4 A;  2A45 H;  3EQ2 A;  2QM7 A;  5CCG D;  1JMM A;  3LW5 H;  3VTP C;  2IX7 C;  2OYH C;  4I1L A;  4LC1 A;  4WY4 D;  2Z4E A;  1H89 A;  3M91 A;  5AVS B;  1IC2 A;  2HPC A;  4LLH A;  5AW6 B;  2KP8 A;  3IFM A;  1JCC A;  4GKG A;  2N1T A;  3HD7 D;  1GW4 A;  2WSC H;  4XA4 A;  2C9N Y;  1KIL D;  4N3Y B;  1JTH B;  1JY3 N;  4N78 E;  4WY4 B;  1N73 A;  1FU1 A;  3I5C A;  2P2U A;  3PP5 A;  2WZ7 A;  1L0L K;  1JUN A;  2YNY A;  2OYI C;  3HUS B;  3HTK A;  2YKP A;  1MFZ A;  1N7S A;  3BAT A;  1T3U A;  4HYT B;  1PFI A;  3EFG A;  3P8M C;  1KIL B;  1N7S C;  2O1K A;  1LTI C;  2P67 A;  1FBM A;  1ZN5 A;  1FDM A;  2GUS A;  2R3C A;  1E5W A;  3M0D A;  1GDT A;  1IO4 A;  2O1J A;  3M0D C;  3B5N C;  1JY2 N;  4O9B A;  1HVV A;  1QL1 A;  4I6M C;  2I1K A;  1H88 A;  1RE3 C;  4HH2 A;  3V4Q A;  1LT9 B;  1HTL C;  3T97 A;  3TNU A;  1URQ A;  1NOH A;  1DEB A;  3M9Q A;  1N7L A;  5KJ7 A;  3RK2 C;  1LTJ B;  1GL2 A;  2PP6 A;  5BVZ A;  2Z5I A;  2R32 A;  1KZU B;  2CPS A;  2N1T D;  2WPR A;  2OYH B;  3BRT B;  4JYC A;  3BVH A;  5AW2 B;  5AW1 B;  1NTZ K;  4C7N B;  2XNX A;  5AVY B;  2KOG A;  3A3Y B;  3NMD A;  3HD7 C;  4ZKU A;  3RL0 D;  1T2K D;  1KFN A;  5APQ A;  2M3B A;  1N7S D;  2Q9I A;  1AQ5 A;  3U1A A;  1YTZ T;  1A02 F;  3NTN A;  1RY3 A;  2QM8 A;  3H32 B;  3V2R A;  2OYI B;  3TYY A;  2YO3 A;  3IR9 A;  2YO2 A;  1RF1 A;  3VOP A;  5AVX B;  4GT1 A;  1JY3 O;  1RF0 C;  1NTK K;  4XE5 B;  2FFD A;  4EIJ A;  2C9L Y;  1FJP A;  1N7S B;  3C9I A;  3H6P A;  2KYV A;  2POH A;  3M9B A;  3RK2 D;  2WWW A;  1URQ D;  2R5D A;  4W7Z A;  1SP4 A;  5KJ7 D;  1SQX K;  1RE4 A;  2WT7 B;  3SWF A;  4AUW A;  3TK1 A;  1FZA A;  2KB7 P;  4KHX A;  3B5N B;  5APY A;  1AFO A;  4OH8 B;  4Y99 B;  3P8C E;  3V5B A;  1A02 J;  1X8Y A;  1NU1 K;  3KDP B;  1JO5 A;  3HE4 A;  1CI6 A;  1JY2 O;  3O8Z A;  1ZLL A;  2H7H A;  1DH3 A;  3RK2 B;  3VP9 A;  2HLO A;  4N78 D;  5AW8 B;  2MJZ A;  1GU4 A;  2N1T C;  1H8A A;  2XU6 A;  3HE5 A;  5AVW B;  2WSF H;  3A2A A;  1FZE A;  3GHG A;  1LGH B;  3MTU E;  1L4A A;  1SFC A;  1N73 C;  2FKW B;  1SFC C;  3OA7 A;  1HBW A;  1VDF A;  4JF7 A;  3VYI A;  3CLQ A;  1M1J A;  3HD7 B;  1LWU A;  3RL0 C;  3KYQ A;  1T2K C;  3V2N A;  1SQQ K;  1G2C A;  3M06 A;  1G1J A;  1M7L A;  3P42 A;  3TSI A;  1LTT C;  2J58 A;  2KSJ A;  2H43 A;  4AYC A;  3SWY A;  4RES B;  2IPP A;  1NKZ B;  2WPQ A;  2WTY A;  1VPC A;  4GIF A;  1J1E C;  2J59 M;  3L36 A;  2A45 I;  2GM4 A;  1JY3 P;  2LKM A;  1S9K E;  1DX7 A;  5APU A;  1WT6 A;  2E42 A;  1URQ C;  1SVF A;  3KQG A;  1CSB A;  5KJ7 C;  5APS A;  1GL2 C;  1X9V A;  1YTZ I;  2P1J A;  1FZF A;  1ZV8 A;  1X79 B;  1GD2 E;  3VN0 A;  3L4F A;  3N7N A;  1J2J B;  5CJ0 A;  1FAV A;  3MGN A;  2L5G B;  1GK4 A;  1L4A D;  1SFC D;  4I2L C;  3MIW A;  1FZC A;  1CI6 B;  2WIT A;  1NWQ A;  1CW5 A;  3KPE A;  1IJD B;  1NTM K;  2HPC B;  2HOD A;  2W27 A;  3CL3 D;  1FZC C;  5APW A;  1JY2 P;  1MV8 A;  1JTH A;  1ZR4 A;  2N1T B;  4B86 A;  2WPS A;  3CI9 A;  2XKM A;  3HUS A;  2I1J A;  1JOC A;  1QL2 A;  2CPB A;  2OAR A;  3RK3 D;  1N73 B;  1XTC C;  1FJK A;  1SFC B;  3G3Z A;  1G1I A;  5CCH A;  2HFE D;  1FZG A;  3HTK B;  1GU5 A;  1RF1 C;  5KLV K;  1EQ7 A;  1IFD A;  2Q3I A;  2FYZ A;  3V2P A;  3RL0 B;  3E1I A;  1GTW A;  2FFD C;  4C46 A;  1LTS C;  1NO4 A;  1IFM A;  1YYC A;  3BRV B;  5AW9 B;  1G2C B;  5APT A;  5AVT B;  3BAS A;  5AVR B;  2BAS A;  3P8C D;  1IFN A;  1GL2 D;  5BU8 B;  5AW4 B;  2ZXE B;  5KTB A;  1HUC A;  1RE4 C;  1JNM A;  1LT9 A;  2W8H A;  1J1E B;  4IFD K;  2H8P D;  1HH0 A;  1LTJ A;  3N4X A;  4N6J A;  5AVU B;  1FOS E;  2GUV A;  1KQL A;  4W7Y A;  5CHX A;  1T3J A;  1HJB A;  3TNU B;  1URQ B;  5CJ4 A;  1GL2 B;  2OYH A;  4C7N A;  2JJL A;  2FXM A;  1HWT C;  3OJA B;  3GHG C;  3L35 A;  1CZQ A;  1L4A C;  1HGV A;  2Q7C A;  2W8I A;  3LIE A;  3R2P A;  2O01 H;  3NFQ A;  3VP8 A;  2NPS A;  5CCH D;  1M1J C;  1FZC B;  3UIA A;  1HGZ A;  1LWU C;  2HOD B;  2NPS C;  4WBA A;  2W6B A;  3H32 A;  2OYI A;  2XZR A;  3LID A;  1IFI A;  2E43 A;  1J1D C;  1SLQ A;  3RK3 C;  4AQR D;  1IFJ A;  1XTG B;  2JEE A;  1LTA C;  3VMY A;  1WRG A;  1N86 A;  3II6 A;  4LGD E;  1S9K D;  4W80 A;  4M3L A;  5APV A;  4C7R A;  3V4W A;  1RF1 B;  1FOS F;  3WMM 0;  1NKN A;  2A45 G;  3B8E B;  1NHL A;  2FFD B;  2WSE H;  3VMZ A;  2YMY A;  1NAF A;  2WT7 A;  1IK9 A;  3B5N A;  1JCD A;  2C0W A;  1RE3 A;  3MUD A;  4DOJ A;  4Y99 C;  1GK6 A;  2YKO A;  1LTG C;  5AW3 B;  4IFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...