3P42A

Structure of gfcc (ymcb), protein encoded by the e. coli group 4 capsule operon
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
QGMVTIYLPGEQQTLSVGPVENVAQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWLAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia coli Group 4 Capsule Protein GfcC Reveals a Domain Organization Resembling That of Wza.
pubmed doi rcsb
source organism Escherichia coli o127:h6
molecule tags Unknown function
molecule keywords Predicted protein
total genus 56
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.700 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p42A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 3p42A03
2W8HA 2W8IA 3P42A 2J58A
chains in the Genus database with same CATH superfamily
3ZJUA 3R7RA 1TS4A 3AE3B 3DVGX 4G3XB 5GMVA 2DAFA 2ZW0A 3IG3A 3MJWA 2JYEA 4YXDB 1JW9D 3RMKC 2K39A 2KFKA 4ARIA 1FPYA 4BOSC 4S17A 2CJOA 1AARA 4JE3B 3M95A 2J7QB 1ZXIA 4HVBA 3NVWA 1V5TA 3RPFC 4TUUA 3HVZA 2C9WB 1WJ4A 3R2IA 2WP9B 1FM0D 2XK5B 1WFYA 4I6NB 4K7UA 3WIMA 1EWYC 4C80A 5DPSA 1HZ6A 3C8YA 2K1FA 4YTPB 3SDLC 2PE6B 3IT4B 2FUHB 5EE3A 4MH8A 5C2TB 2JZZA 1LGRA 2ACZB 1I7HA 2LRWA 4JIOU 5IKCM 5E6OA 3V62A 4LDTD 1TS5A 2Z8LA 3W5VB 1MHXA 2KMAA 1MG8A 2KYWA 5HI1A 1D3ZA 3QHTA 3P63A 1H4RA 1T6BX 2L0TA 2WHIA 4HPPA 2VH1A 3QX1A 3KLSX 5BYRA 3PREA 2FAZA 5JZEB 2MBQA 4WJOA 2INDC 4KKJA 3R8BA 2LJ5A 4EZJA 2JT4B 2V3NA 4WWPA 2KQ7A 2AQ1B 2L0FA 3RNBC 1T0YA 1IUEA 2NMQA 2WDVB 3NVYA 1FXAA 2MJ3A 5GXGB 3GS2A 3U4EG 1ZKHA 1WY8A 2MCNB 1UUPA 4K3BA 4ACFA 4C4VA 3Q8FA 4NZLB 5D3IB 3Q3OC 3K9PB 4A6QA 2R61A 2D3GA 3A1QB 4TQ0A 3U2SC 1OQQA 4X57B 2B76B 4HKZE 4MSMB 3B2FA 2DENB 3WALA 1E5WA 1EF5A 1XQQA 3LYYA 1WXSA 2J0KA 1C9FA 3JSVA 4US8A 1LQBA 1QILA 1KM7A 2YEPB 1UWMA 4IM0A 1QOAA 1YX6B 2V4LA 3BY4B 1KLUD 3H1UA 2V1YA 3MC8A 2K8CA 1TY2A 1XLQA 1C3TA 2KQSA 2JF5A 2KK8A 3LJ3A 1PUTA 4BOZB 2BYFA 2D5GA 1E7PB 3TCAA 1I35A 4AJWA 2K6DB 3M3JA 1XF5L 1JRPA 1D5ZC 1FRDA 3RNFC 2KN5A 3R7QA 4JQWC 1YIWA 5KHOA 1E6EB 1UF0A 3U7DA 1Z5SB 1DOIA 2IDYA 3N30A 5LNK1 2DX5B 4LNFA 2PMVA 3EECA 3EFUA 4EZLA 4REZA 4O1NA 1KLGD 5HKHA 1EF1A 3ZUNA 3W1SC 1DGJA 5BYSA 3TEYA 1EWCA 3Q8CA 4MGZE 3MHZA 2KLGA 3OJ4B 2D3CA 3Q69A 4PT5A 4EOYA 2LMCA 1I42A 4F1SA 1RFKA 1QOBA 1SE4A 3GZNI 2AQ2B 4CHKA 3RZFA 4BKTA 3APFA 1YJ1A 1TKYA 1FO4A 4NPNA 4C7ZA 4TSSA 3FKYA 5G2NA 1M94A 2NTTA 2RDBC 1BUIC 1KH0A 5KHQA 4DQOC 1XLPA 4DK5A 2VZKB 2BPSA 1KTKA 2INCC 3QIJA 2LXCA 1VRAB 1F0ZA 3T8MA 3IT6B 2KOXA 4PS3A 1TKGA 1T0QC 1YQBA 3PRPB 1HA5A 1SBBB 4LJOB 1E8YA 5EE1A 2DWQA 2PEAA 4B0EA 5I4DA 2KHWB 1ZPSA 1RWSA 2JRIB 4LNKA 2M17A 1P3QU 3PS6A 1UBIA 1V97A 1ZE3D 3QJZA 3DVGY 2ZJDA 2NS5A 4NJCA 4IM3A 3RCZA 2GMIC 4NQLB 4YSZB 2ZNVC 5D3DA 3PV1A 3VXWA 1RM6C 3ETRA 2NPTA 1WSPA 1JWUD 4DXGA 3DBSA 1ZOYB 1IYFA 1JCKB 2SEBD 2IGHA 2PPHA 2FUG1 2KN4A 1ET6A 2WXKA 4BAXA 4AQ7A 3AU5A 1ZXHA 4US9A 3WANA 5J18A 3Q3NC 3BIID 2NPTB 4DXFA 1OEYJ 3NHEB 1ENFA 2FCQA 2WGSA 4ZRPA 1EM7A 3C19A 1IP9A 1BXTA 4XX5A 1WXVA 4WQMA 1QLBB 4W9KA 4ICUA 1F9JA 3MP9A 3V6CB 1JRUA 2QCZA 2GOWA 4ZHOA 1C4AA 4RGNA 5DPTA 2YEPF 4LNOA 2C7MB 2VRRB 4BVUC 3FILB 3UGBB 4BBNC 2DZIA 1XCQL 3CMMB 4LDTB 3DVNV 4MM3A 1V49A 2J0MA 1WR1A 1YN5A 2G1EA 3X23A 3PT2B 3RN9C 1K8RB 1PDXA 4CO7A 4C56C 2WLBA 1ZP0B 4MJSA 4WWNA 3GZNB 1C77A 4WQOB 1WXQA 4N9F4 2WXOA 1WR6E 3LB8C 3DBRI 3L13A 3ZIMA 1RLFA 2BS4B 4HK2A 3VAWA 1E9MA 4WJPA 5D7GA 3QWZB 1N5WA 2O6VB 2W8HA 2NBVB 1ZUD2 2G3QB 1G6JA 2KFKB 1WGRA 2O6VD 3TEZA 4W9LA 1E0ZA 2JPHA 4HCNB 2KDFB 2ZW1A 1KOTA 1VDVA 3IHPC 3A9KA 4B9KA 2Y5PA 2KDEB 4EKUA 1CJEA 2CU3A 1Q1OA 2JWZA 5JHAA 1AN8A 2WXIA 4NJ7A 2KWUB 4WWMA 4GMVA 1RYJA 3V61A 2K6QA 4BBNF 4E71A 2D3AA 1NI3A 1TZ1A 4DHZE 3N20C 2LGIA 1L6VA 4OZBA 3URYA 2RPVA 2J58A 4IW0A 4ARCA 2EMTA 2KC2A 2REXA 2HE7A 3PLUA 1R7SA 4WURA 4KGTA 3P4SB 1FCCC 1YJJA 2MX2A 1CZPA 3IVFA 3DBHI 1E7UA 3A33B 4ZRKA 1HXYD 3B2GA 4ZRQA 2DZMA 1T5XD 3AULA 2MBHA 4RMAA 1N61A 4IG7B 1D4BA 1WRDB 1NEKB 2AEHA 1F2RC 1OQRA 3L16A 3U7ZA 2R2QA 2IBIB 3AB5A 2AL6A 3Q3JA 1C76A 1V80A 3ZTCA 2I1KA 1CMXB 1EU3A 4ASWC 1UBQA 2L3ZA 2NR2A 2QILA 1FNWA 1OEYA 2HDEA 1A70A 4UDUC 1B9RA 3VR9B 2G4SA 1Q5WB 2E3TA 3MC9A 3DDCB 4RF1A 2E6XA 3TSSA 2PJHA 3PHWB 2JUOA 3BINA 3JVZX 2IZVB 1WM2A 1FXIA 3DOWA 1PGXA 2ZCBA 4HRSA 1WH3A 2G4DB 4HPLB 3JW0X 2CHZA 2IGDA 4KV2A 4KZCA 4MGIE 2MWSB 5C23A 1SE3A 3AE5B 4ITKA 3ZRFA 1WXAA 2LVOA 2HJ8A 2GBKA 4K7SA 2Y5BB 1OFFA 4OZAA 2AWTA 2ZPNA 2WDQB 4GGQA 2JXTA 4FHKA 3QARA 4MSQB 4W9CA 4OVUA 1ZDVA 2KFJA 2L00B 2WNMA 4MACA 3L08A 2C7NB 1AW7A 1SB3C 1WGHA 2GI9A 1JWAD 2KMMA 1FEHA 3ZRCA 4N58A 5AZGA 3CF6E 1LM8B 3AH7A 4HKQA 4L2YA 2I38A 4HPMB 3I9V1 1UELA 4YTNB 3BVGA 3KUDB 3R66C 4TQ1A 1WJUA 2BWFA 2MP2B 3H7SA 3BYTB 4A3PA 1F2RI 2CKHB 4PK1A 3W1YA 1FXTB 3B0AA 2KZRA 3S2AA 1VCBA 3GP7A 1P7FA 3HHMA 3IAM1 3KYCD 2PE9A 1D5XC 3ZNID 4RM8A 4I6PA 2KTRA 5AZFA 2KJ6A 1KFYB 1KF6B 4GDLB 2C5LC 1ESFA 4IC7B 3B1LX 4AP4C 2SAKA 2Y3AA 1WJ6A 1GC6A 2BKFA 4AOFA 1QZEA 1UGJA 3QAQA 3KUZA 4ICVA 1X1MA 3K9OB 2CHXA 2QHOA 1B1ZA 2L05A 2EKEC 1MG4A 3RULA 4M02A 3V6EB 1KJTA 2KT7A 4CQNA 4GDLA 2LASA 3ZNZB 2CJNA 3AMZA 1J19A 3BK1A 4KVGB 3VVWB 3ZW3A 4A20A 5BO4B 4TKNA 5T8IA 3PGEA 3E56A 3AEEB 2K0PA 4A8XC 1JROA 3AEBB 4KGSA 3GE8C 4FN2A 5FK9C 3RI7C 5DCNA 3OAWA 2MP2A 3PRZA 1N63A 5TSSA 2J4XA 2L1AA 1TJEA 4JGHB 4IWPA 1L0VB 2GLSA 2MJDA 4PS8A 3SFDB 4FBJB 3H9DA 4AUQC 4M8MA 4FA6A 3APDA 3CSTA 4BKSA 4DDGD 2W8IA 2JYTA 2WXLA 4E74A 2JWUA 1P1AA 1WWTA 1PQSA 4WJQA 3QA8A 4TMAB 3ZQ4A 2WXQA 5LLIA 1TS3A 1V1OA 3CWIA 3N1YC 5FKAC 1J7AA 4ZDVA 4HJGE 1MHHE 3ZXVA 1EO6A 4KGRA 1RRBA 3IXSA 2JX5A 3I5JC 4TV3A 1E8ZA 3NG0A 4L1BA 3ZNHB 1DYQA 2JZPA 3AI5A 3M63B 3T3NA 2QC8A 3AECB 2N4FA 3VFKA 4W9JA 3DWGC 1UWXA 1UNSA 1PGAA 1I4RA 3AEDB 3H7PA 2J52A 1PGBA 3KH0A 4MELA 3N9YC 1VZ8A 2DYBA 1OQYA 2LI5A 1V6EA 2KD0A 3ZDMC 4RGMA 5HHDG 5JH5C 4HCPB 3MC0B 2KTFA 4EEWA 2OJWA 1WE6A 3ONSA 3L17A 3U8ZA 4ZRJA 3RD2A 4XZ4A 3UQBA 4I6LB 3V05A 3ML9A 4JLCA 4YSYB 4FHJA 4P16A 4M0WB 2KJRA 2ZEQA 1L4ZB 2IPKD 1P9DU 2FCMA 4ANUA 5EDSA 1D5MC 4ZYNA 3PZ7A 2PW9A 2N9EB 3BK2A 3Q8AA 3H6NA 2BB6A 2LJIA 2QSDA 4M8NA 4P7IA 2BS3B 2X38A 2CU1A 4WAAA 4PS7A 2JSVX 3EUB2 2RMMA 3VR8B 3OJ3A 4XWWA 2L8JA 1IPGA 3LDZE 3FC4A 1JALA 1WYWB 5CHVC 3A1QA 5AZHA 3NY5A 1QQRA 4FADA 4NQKE 1V9JA 2KDIA 3AEGB 4C4VB 1WGYA 1I4PA 2N7DA 1YD8U 3O65B 2O6VA 4P1BC 1GAQB 2K5PA 2BYEA 4RF0A 2L76A 5C3JB 2INNE 3NUHB 3KW5B 4OW0A 3P4RB 2G45B 5J17A 4LJPB 1HEZE 3NZSA 1I4QA 1Y8RC 1TZOA 2XN9C 4FJYA 1NVID 3X0WA 2O2VB 1I4XA 1BMLC 3JYUA 2NBUA 1FMAD 1UH6A 1I4GA 2LZ6A 1P98A 5DPRA 1C78A 1UGMA 3VH4B 3IBEA 3NOBA 3HM6X 2BS2B 2MBBB 1WIAA 2H89B 2WXRA 2KLCA 2KO3A 2IO1B 1R4NI 1FRRA 2LUEA 2BGFA 1L5PA 1XXGA 2MEKA 2K22A 2KC1A 2JXXA 1R4MI 2KVZA 3ZGZA 2R2OA 3Q3FA 1FFUA 3VH3B 3MHSD 4GXBA 4B0MA 3M62B 3SFEB 3DHIC 4KDIC 4DHJD 3ZO5B 2DAJA 2NBWB 2L52A 1NI2A 2WDRB 2BWES 4K7WA 4USAA 2M0AA 2K3UA 2M1MA 5IOIA 4L23A 1QOGA 3P42A 1T0RC 2LGSA 3HM3A 4IDIA 3L10B 5D6JB 2Y5CA 3RFZB 2KQ4X 4IOIE 2KKCA 4M01A 3SU8X 1ZDXA 2LGDA 4HDOA 1K51A 3P4PB 2WU2B 1WX9A 2RDGA 4IKGA 1HTQA 4B6WA 3AN1A 4K3CA 3WCQA 1M4VA 4ANWA 1ZW7A 5AUIA 3J9CA 3R3MA 2ZNVB 3Q8EA 2N9KA 1V8CA 5IN7A 2KVRA 1FIQA 2BYTA 4MGKE 5HG2A 3TJPA 4ANXA 4KDLB 3T9LA 4IWOA 3NVVA 3ZTDA 4OHJA 2KTRB 4YL8A 4W9DA 2W82A 3KWVA 1VZ7A 2B3AA 2KMCA 3BZDB 4CYEA 1HZ5A 3N3KB 4NAWA 3WAPA 3KYDD 5CTRC 2FE8A 3BVZA 3AV8A 3RNEC 3D32A 4M0WA 5G5GA 2W9NA 2BKRB 3PTFC 1L7YA 4JWSC 2KXJA 3E9SA 1E8XA 3SD5A 4K81A 2LEKA 3A9JA 4URKA 4RCOA 3I57A 2LUMA 1RFAA 3MTNB 3PRMB 5H8YE 3DCGA 3RZWC 2LVPA 1IGDA 5MPOA 1ROEA 4WIPA 2WXMA 3WA0A 3ALBA 1HE8A 4DWFA 1WRIA 1F77A 1H8CA 1TYGB 1TBEA 1WGDA 3SEBA 2PKOA 4WH4A 1WMHA 5CHFA 3NZUA 4LCDE 3A9KB 3AXCA 4C7YA 1LFDA 1K50A 4LLGM 1C79A 1XO3A 3ZKJC 2N7EA 1ET9A 4RM9A 1NENB 2AQ3B 4OVVA 3NVZA 3NJTA 1YQ4B 2FCSA 2WX0A 1WMHB 2ZZPB 2OEDA 3FAHA 1LXDA 1KRHA 4EFOA 3R2TA 2IY1B 5H92C 2FBWB 4MDKE 5BMGA 2MA9B 2OOBB 5TR5A 1K53A 1QOFA 3Q14C 1V2YA 2ZCCA 4II3B 2BTEA 1XLOA 3Q3MC 3ABVB 1L0XB 1YX5B 3A9JB 2D2QA 4C00A 2ZPYA 2LXAA 2WXHA 4FLHA 3W5UB 1C1YB 2MRPA 1S1QB 4NNJB 3DBRB 1KLVA 2D3BA 4II2B 3UIOB 2MW5A 3Q2AC 1FFVA 2ASQA 5FR3A 1T3QA 4YSXB 2IO3B 1GB1A 4RFBA 3BVMA 4PYZA 3RT3B 2IJ0A 4XDDA 1GOZA 1YN3A 2D07B 3TEXA 3VHTC 2INPE 2D10A 2QEJC 1VJKA 2XNAC 4M00A 4JPSA 4KX6B 4W9FA 3AE1B 1V86A 3A4RA 2KWCA 2GRIA 4D2KA 4GLSC 2BB5A 3EHVA 1SJED 2BVCA 1J0GA 2EKIA 1TT5B 3Q6BA 4ZHPA 2WS3B 1HQRD 3ZJTA 2TSSA 2GBJA 3BWUD 2KANA 2RSUA 3VUYA 3KVFB 2ZVNA 1SXTA 4RGOS 4PYUA 2M19A 1WM3A 1FNUA 4XYCA 4LTUA 3L0WB 1AYFA 4GOCA 2IO0B 3NZ3A 2Z0EB 2J0JA 2MH7A 1BT0A 4RGTA 5LXIB 2XBBC 1SIJA 3AE4B 2W55A 2CHWA 4YWGG 2WXGA 2HTHA 3DVNU 1GPXA 4ZYSA 2PVOD 2YLMA 1VD2A 4FULA 1XCTL 3ML8A 3ZJVA 1L4DB 1NDDA 5CHWA 3PO0A 2QJLA 2M0XA 3VTVA 1VZ6A 2IY0B 3V3XA 1J7BA 2RR9A 3PPAA 4OZCA 4MJSB 2VH2A 4HLEA 3VDZA 2DLBA 1Q0WB 1VLBA 2KX3A 2Q5WD 2DYOA 2M8SA 2KWVB 3UF8A 1K52A 1V81A 3B9JA 2JQRB 3PVLA 1F1HA 1S3SG 2UU7A 2KJHB 3OWEB 2LHEA 4BKSD 2IGGA 4A55A 2BT6A 2XEWA 2I2YA 2LVQA 4ZOHC 3EA6A 2FIDA 1QKZA 1Y56A 2PIAA 1T0SC 1GG3A 1JWMD 3TBLD 4AS1A 4K1RB 4R3DA 5L95C 2WX1A 2JU6X 4G0NB 3DQVA 4NAMA 1SEBD 4RH6A 2KX0A 2DZKA 1NYRA 4YT0B 3NS1A 1YMHE 1MI0A 1OTRB 5L83A 4BFRA 5E6JA 4W9GA 1GJZA 3P1MA 4KSKC 4KIKA 2AYOB 2N1WA 3A4SC 1E10A 2IYDB 1Q10A 2X8XX 4A9AA 5G55A 3AE8B 2AL3A 2MQJA 2WDTB 1L2NA 1VR9A 2V3PA 4G11A 2JZ3B 1SE2A 2DZJA 4ZRIA 2K8HA 1P0RA 3DBHB 4F7ZA 1SF0A 5IA7A 2CR5A 1I4HA 3ZLZA 4IM2A 2WXFA 3PZ8A 4B95A 1WX8A 1SJHD 1LO5D 1PFDA 4J3OD 1P7EA 3W2DA 5IP4D 3QQ8B 3EFCA 3GE3C 4KZ0A 3TUOA 1GC7A 2GBRA 2V0GA 1MFWA 3OLMD 2GBMA 5BMIA 1WXMA 3VTUA 2WQYB 2N7JA 1WJNA 3IAS1 2PLPA 2J42A 4S0RA 4A90A 3NRZA 3KQ4A 3JSVB 1STEA 2J53A 4DBGA 1ISNA 2M4NA 3H7PB 4N6EB 2ONQA 3APCA 1JMLA 3C0RB 1WZ3A 2MSED 2UWQA 3AM9A 1FCLA 3DBLB 5FR6A 4HROA 1D6EC 3BYYB 5JHBA 2BQQA 4F8CB 3V60A 3CSFA 2KDBA 2GB1A 4EUTA 3DPDA 3P4QB 3ZXRA 1CK1A 3N32A 2K8BA 2KAJA 1WE7A 3AU4A 4HEA1 2BW2A 4GSWA 3ZVVA 2DNFA 3H8HA 4DHZB 4JX1C 4RNAA 2IO2B 3ENEA 4DDID 4G50A 3SR6A 3VTWA 1JWSD 1TTNA 1A5RA 3AE7B 3RUIB 2RGFA 5C1ZA 3GB1A 2W3RA 4OVZA 4W9IA 4GU2A 3EGRA 1IGCA 3TEWA 3MJ5A 2EELA 2N9XA 1GNUA 4KSLC 3VRAB 4GDKA 2LGYA 3I63C 1CQVA 3RYTA 1EU4A 1UD7A 3AE6B 4LK0M 4LNNA 2MHJA 2WXJA 5E6NA 1NBFC 4GN1A 1RAXA 2L7RA 2N0SB 2VZKD 4MGYE 1E90A 5IO9A 2K25A 4MM3B 3CIRB 5G5HA 2OJRA 2HD5B 3FILA 1Z2MA 1E8WA 3PZDA 3UINB 1C4CA 1UZXB 1YJIA 2XK5A 4HXDA 4WWOA 5CX3A 1YN4A 2GBNA 3I3TB 1WGGA 2WXPA 4NAWB 2NTSA 2NVUI 1N6ZA 2UYZB 4GIVA 1JQ4A 5BMHA 1JWBD 4BZAA 5JXVA 2LD9A 2Z0DB 4IUMB 2KNBA 2BYVE 1E7VA 4A3OA 1IBXA 4DHJB 2LHDA 3MFGA 2KDMA 2W3SA 2QDFA 1HTOA 3LXFA 1TGZB 2H88B 3PSEB 3Q8BA 3IFWB 3NS8A 4HWIB 4GB9A 1N62A 5AEKB 1QT9A 5E6PA 2LRUA 3ZNGC 4YTMB 1L6UA 5J2RA 2D11A 2V4IB 1NYQA 1MPEA 1SIFA 1TIFA 4P1CC 4Q2JA 3O13A 1IBXB 2CS4A 2AX5A 2HJ1A 4HDQA 3N1XC 3W9CB 1WI0A 4ANVA 4W9EA 4DXAB 2HTME 2DHZA 1YNTE 2V3SA 2DYMA 3ZYYX 3B08A 3TMPB 1MJDA 1WX7A 1ACCA 3GOEA 1ZGUB 1YQ3B 4HJKA 5EE0A 5AUKA 5EE9A 1L0YB 2N9LA 2JRHA 3HRDD 2EMSA 4MT5A 1XLNA 1C4PA 3SHQA 4LNIA 3WAMA 3P2BA 2C7HA 2KWDA 1WZ0A 3QK0A 2ON8A 5IAAC 1V1PA 3PLVA 3QC8B 2WWZA 2ZVOA 3L54A 3VUWA 4GDKB 3DWMA 1GUAB 1SE9A 1YOVB 1QF6A 1N5XA 3U30A 2A4ZA 3TIXA 1MVKA 2O2VA 3QCAA 3UQAA 4FJVB 2WXNA 1FD6A 2LFIA 3RNCC 1GB4A 3ZDTA 1PYWD 3TL5A 4XDCA 4XWTA 2FNJB 2W54A 4H2AA 2WYQA 1WYGA 3W1SA 4XC2A 4NJ6A 2V9HA 3UI3A 5BYQA 4N59A 4NY0A 3HK0A 3U52E 3HVDA 3UIPB 4IWQA 2I1JA 3AEFB 2ICIA 1WGKA 2G9HD 2QMTA 3DHHC 1WF9A 4KKIA 1SGHA 2N1VA 2JVCA 2BBCA 3PHXB 2KACA 5DPWA 3VUXA 1AWDA 4J6IA 1U4AA 4AJYB 1TY0A 4MEMA 4EE2A 3T3OA 1TS2A 3RNAC 2YVCA 2N9PC 2A5UA 1R4NB 2MBOA 1V5OA 4W9HA 2C60A 4JWUC 2QIEB 2RDHA 3N1ZC 2PTLA 2MJEA 1XD3B 2M56B 1TKEA 3EC8A 4WJNA 4WAFA 4E3CA 1OGWA 1R4MB 2K9XA 1V1PB 3OG5A 2JY6A 2RD0A 1N60A 3VQIA 2MBEA 4EZKA 2PVGC 2LWPA 4XGAB 3RNGC 3KUCB 3DHGC 2Z59B 5LXHA 2RPQA 3AE2B 3WAOA 2L83A 3L4PA 1DOYA 1XEEA 4P6VF 3DBLI 4MH0E 3HUIA 1FNVA 3KWLA 1J7CA 4XE0A 2BF8B 2NCNA 1F52A 2OHFA 4FJZA 4AWJA 4JL9A 2FCNA 3AE9B 5D94A 5D2MB 2L32A 4FXCA 2FIFA 2WU5B 1J8CA 2DBYA 2LGXA 1SSNA 3HIZA 4BKGA 3VRBB 1XT9B 5HFYA 3AEAB 3ECIA 1DOXA 4QAYA 1EUVB 4KIKB 2MLBA
chains in the Genus database with same CATH topology
1E0ZA 3ZJUA 1TS4A 3AE3B 1QQRA 2ZW1A 5E6JA 2ZW0A 3AEGB 1VDVA 3P1MA 2JYEA 4YXDB 1I4PA 1JW9D 4ARIA 2Y5PA 1E10A 1CJEA 1Q10A 2CU3A 1AN8A 2CJOA 4A9AA 1GAQB 2WXIA 2K5PA 4JE3B 4RF0A 4WWMA 5C3JB 3AE8B 2INNE 3NUHB 3P4RB 4OW0A 1VR9A 1ZXIA 2V3PA 1HEZE 1RYJA 1SE2A 3NVWA 1I4QA 3RPFC 1NI3A 1TZOA 3HVZA 2XN9C 1SF0A 3R2IA 2WP9B 1I4HA 1NVID 2LGIA 1L6VA 2WXFA 3PZ8A 4OZBA 1FM0D 1SJHD 3URYA 2RPVA 1I4XA 1BMLC 1LO5D 1PFDA 4J3OD 2J58A 4C80A 1EWYC 1P7EA 1HZ6A 3C8YA 3W2DA 4ARCA 1FMAD 4YTPB 1I4GA 1R7SA 3IT4B 4WURA 4KGTA 5EE3A 4MH8A 3P4SB 5C2TB 1FCCC 1C78A 1YJJA 1CZPA 3TUOA 2BS2B 2ACZB 1HXYD 1I7HA 3B2GA 2V0GA 2H89B 2WXRA 4ZRQA 1TS5A 2Z8LA 1T5XD 3W5VB 1MHXA 1FRRA 5BMIA 1N61A 1D4BA 1L5PA 5HI1A 2WQYB 1XXGA 2N7JA 2MEKA 1NEKB 2K22A 3IAS1 1F2RC 3P63A 2PLPA 2J42A 1T6BX 1OQRA 3U7ZA 4A90A 3NRZA 3ZGZA 3KQ4A 3AB5A 1C76A 3KLSX 5BYRA 1FFUA 1STEA 2J53A 1EU3A 4B0MA 3SFEB 2QILA 1FNWA 2HDEA 1A70A 4KKJA 3R8BA 4UDUC 1B9RA 4N6EB 2V3NA 2ONQA 1JMLA 2L52A 2AQ1B 3VR9B 2WDRB 3AM9A 1FCLA 4HROA 1D6EC 4USAA 2E3TA 2M0AA 3BYYB 4RF1A 2E6XA 2K3UA 3TSSA 1IUEA 2NMQA 2WDVB 3NVYA 4L23A 1FXAA 1QOGA 2MJ3A 5GXGB 3GS2A 3P42A 3U4EG 2GB1A 3P4QB 1FXIA 1CK1A 4IDIA 1PGXA 1UUPA 2KAJA 2Y5CA 3RFZB 4HRSA 2KQ4X 4IOIE 3Q8FA 2IGDA 4HEA1 4NZLB 1ZDXA 5D3IB 2BW2A 3H8HA 2R61A 4A6QA 4JX1C 4RNAA 1SE3A 1K51A 3AE5B 3P4PB 2WU2B 3SR6A 1JWSD 4TQ0A 2RDGA 4IKGA 4ITKA 3U2SC 1OQQA 3AN1A 3AE7B 2B76B 4HKZE 3WCQA 1M4VA 5AUIA 3J9CA 3B2FA 3Q8EA 2N9KA 1V8CA 1OFFA 3GB1A 2W3RA 3LYYA 1FIQA 4OZAA 4OVZA 2BYTA 5HG2A 1C9FA 4US8A 2WDQB 1QILA 2JXTA 3EGRA 1IGCA 3TEWA 3NVVA 3MJ5A 2EELA 4OHJA 2YEPB 3VRAB 2W82A 1UWMA 3KWVA 1VZ7A 1ZDVA 1CQVA 3BZDB 1QOAA 1HZ5A 1EU4A 2WNMA 3AE6B 4LK0M 4MACA 1KLUD 1AW7A 1SB3C 2GI9A 1JWAD 2WXJA 2KMMA 1FEHA 2FE8A 4N58A 1TY2A 1XLQA 2N0SB 2VZKD 3AH7A 4HKQA 4L2YA 4MM3B 3CIRB 2I38A 1PUTA 3BVZA 5G5HA 3AV8A 3I9V1 2D5GA 4YTNB 1E7PB 4M0WA 3BVGA 3FILA 5G5GA 4TQ1A 4JWSC 3BYTB 3E9SA 1C4CA 1F2RI 1YJIA 1XF5L 2LEKA 4RCOA 1YN4A 1JRPA 1D5ZC 1FRDA 2LUMA 3I57A 2WXPA 3GP7A 1P7FA 2NTSA 4NAWB 5H8YE 3IAM1 1IGDA 5MPOA 1E6EB 1JQ4A 5BMHA 1JWBD 1ROEA 1D5XC 4WIPA 5JXVA 2WXMA 1DOIA 2IDYA 5LNK1 1WRIA 2PMVA 1F77A 1KFYB 1TYGB 1KF6B 4GDLB 1IBXA 4REZA 4O1NA 1KLGD 2LHDA 3MFGA 2KDMA 2W3SA 3SEBA 1ESFA 2PKOA 4WH4A 2SAKA 3LXFA 1DGJA 2H88B 5BYSA 2Y3AA 3Q8BA 3TEYA 1EWCA 4C7YA 1N62A 3Q8CA 1UGJA 1K50A 4LLGM 1QT9A 1C79A 1XO3A 4YTMB 3MHZA 3TEZA 1L6UA 1ET9A 2V4IB 1NYQA 1B1ZA 3Q69A 1NENB 2AQ3B 3NVZA 4PT5A 1MPEA 1YQ4B 4Q2JA 2LMCA 2OEDA 3FAHA 3O13A 1KRHA 4CQNA 1IBXB 1RFKA 1QOBA 1SE4A 2AQ2B 3R2TA 2AX5A 5H92C 1TKYA 2CJNA 2FBWB 5BMGA 1FO4A 3AMZA 1K53A 3BK1A 3W9CB 1QOFA 4C7ZA 4TSSA 2HTME 5T8IA 3E56A 3AEEB 1YNTE 2K0PA 2DYMA 2NTTA 1MI0A 4A8XC 1JROA 3ZYYX 2BTEA 1BUIC 1XLOA 1ACCA 1KH0A 3ABVB 3AEBB 1L0XB 4KGSA 5FK9C 1YQ3B 5EE0A 4DQOC 5AUKA 5EE9A 1L0YB 2N9LA 1N63A 5TSSA 2WXHA 3W5UB 1XLPA 2J4XA 2L1AA 1TJEA 3HRDD 2VZKB 1L0VB 1KTKA 4MT5A 1XLNA 1VRAB 1C4PA 1F0ZA 3IT6B 2KWDA 2MJDA 2ON8A 3SFDB 1TKGA 1V1PA 1FFVA 5FR3A 1HA5A 1T3QA 4YSXB 1GB1A 4RFBA 1SBBB 3BVMA 2IJ0A 4XDDA 5EE1A 1GOZA 1YN3A 2DWQA 3TEXA 4GDKB 3DWMA 2INPE 4B0EA 2W8IA 2QEJC 1QF6A 1VJKA 2JYTA 2WXLA 2XNAC 4KX6B 1N5XA 4JPSA 5I4DA 2JWUA 1MVKA 1WWTA 3AE1B 1ZPSA 1RWSA 2GRIA 4D2KA 4GLSC 2WXNA 4TMAB 2BB5A 3ZQ4A 1FD6A 2WXQA 1TS3A 2LFIA 1V1OA 1SJED 3CWIA 5FKAC 1GB4A 2EKIA 1PYWD 1V97A 1J7AA 4HJGE 1ZE3D 4XDCA 4ZHPA 4XWTA 2WS3B 2W54A 4H2AA 1HQRD 4NJCA 1MHHE 3ZJTA 2TSSA 1WYGA 3BWUD 4YSZB 5D3DA 4KGRA 1RM6C 3ETRA 3W1SA 3IXSA 2JX5A 1WSPA 1JWUD 3UI3A 1SXTA 4RGOS 4DXGA 4L1BA 5BYQA 1DYQA 2JZPA 1ZOYB 4N59A 1JCKB 2SEBD 2IGHA 3T3NA 3AECB 2M19A 3U52E 2FUG1 1FNUA 2KN4A 1ET6A 2WXKA 3HVDA 4LTUA 4AQ7A 1AYFA 1ZXHA 3AEFB 4US9A 2ICIA 3NZ3A 1WGKA 2G9HD 2QMTA 4KKIA 3BIID 4DXFA 3DWGC 1UWXA 1UNSA 2BBCA 2MH7A 1PGAA 2KACA 1I4RA 3AEDB 2J52A 4RGTA 1PGBA 1AWDA 1ENFA 1SIJA 3AE4B 4ZRPA 2W55A 1VZ8A 3N9YC 1EM7A 2WXGA 4YWGG 1GPXA 1TY0A 1BXTA 4ZYSA 2PVOD 4EE2A 4RGMA 5HHDG 4WQMA 3T3OA 1TS2A 1XCTL 3ZJVA 1QLBB 1L4DB 3MC0B 3PO0A 2QJLA 3MP9A 1VZ6A 3V3XA 1J7BA 4OZCA 4JWUC 2QIEB 2RDHA 2PTLA 2DLBA 4ZHOA 2MJEA 1VLBA 2M56B 1TKEA 2Q5WD 4WAFA 1C4AA 2K9XA 1V1PB 4RGNA 3V05A 1N60A 2DYOA 4YSYB 2YEPF 3VQIA 1K52A 3B9JA 2JQRB 4P16A 3FILB 2PVGC 1XCQL 1L4ZB 2IPKD 3OWEB 2LHEA 2IGGA 3AE2B 1D5MC 4A55A 1YN5A 2L83A 2G1EA 3L4PA 3PZ7A 1DOYA 1XEEA 2PW9A 4P6VF 2BT6A 1PDXA 2I2YA 3BK2A 3Q8AA 3HUIA 4ZOHC 1FNVA 3EA6A 4C56C 2BB6A 1J7CA 2LJIA 1ZP0B 1QKZA 2WLBA 3KWLA 4XE0A 1Y56A 2QSDA 2PIAA 2OHFA 1C77A 1JWMD 1WXQA 2BS3B 3AE9B 4AS1A 2X38A 2WXOA 3LB8C 2JSVX 3EUB2 2L32A 2RMMA 4FXCA 3VR8B 2BS4B 4R3DA 4XWWA 2WU5B 1E9MA 2DBYA 2JU6X 5D7GA 1N5WA 2W8HA 1SSNA 4NAMA 3VRBB 1ZUD2 5HFYA 3AEAB 1SEBD 4RH6A 1DOXA 3FC4A 1JALA 1NYRA 4YT0B 3NS1A 1YMHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8H A;  2W8I A;  3P42 A;  2J58 A; 
#chains in the Genus database with same CATH topology
 3ZJU A;  3R7R A;  1TS4 A;  3AE3 B;  3DVG X;  4G3X B;  5GMV A;  2DAF A;  2ZW0 A;  3IG3 A;  3MJW A;  2JYE A;  4YXD B;  1JW9 D;  3RMK C;  2K39 A;  2KFK A;  4ARI A;  1FPY A;  4BOS C;  4S17 A;  2CJO A;  1AAR A;  4JE3 B;  3M95 A;  2J7Q B;  1ZXI A;  4HVB A;  3NVW A;  1V5T A;  3RPF C;  4TUU A;  3HVZ A;  2C9W B;  1WJ4 A;  3R2I A;  2WP9 B;  1FM0 D;  2XK5 B;  1WFY A;  4I6N B;  4K7U A;  3WIM A;  1EWY C;  4C80 A;  5DPS A;  1HZ6 A;  3C8Y A;  2K1F A;  4YTP B;  3SDL C;  2PE6 B;  3IT4 B;  2FUH B;  5EE3 A;  4MH8 A;  5C2T B;  2JZZ A;  1LGR A;  2ACZ B;  1I7H A;  2LRW A;  4JIO U;  5IKC M;  5E6O A;  3V62 A;  4LDT D;  1TS5 A;  2Z8L A;  3W5V B;  1MHX A;  2KMA A;  1MG8 A;  2KYW A;  5HI1 A;  1D3Z A;  3QHT A;  3P63 A;  1H4R A;  1T6B X;  2L0T A;  2WHI A;  4HPP A;  2VH1 A;  3QX1 A;  3KLS X;  5BYR A;  3PRE A;  2FAZ A;  5JZE B;  2MBQ A;  4WJO A;  2IND C;  4KKJ A;  3R8B A;  2LJ5 A;  4EZJ A;  2JT4 B;  2V3N A;  4WWP A;  2KQ7 A;  2AQ1 B;  2L0F A;  3RNB C;  1T0Y A;  1IUE A;  2NMQ A;  2WDV B;  3NVY A;  1FXA A;  2MJ3 A;  5GXG B;  3GS2 A;  3U4E G;  1ZKH A;  1WY8 A;  2MCN B;  1UUP A;  4K3B A;  4ACF A;  4C4V A;  3Q8F A;  4NZL B;  5D3I B;  3Q3O C;  3K9P B;  4A6Q A;  2R61 A;  2D3G A;  3A1Q B;  4TQ0 A;  3U2S C;  1OQQ A;  4X57 B;  2B76 B;  4HKZ E;  4MSM B;  3B2F A;  2DEN B;  3WAL A;  1E5W A;  1EF5 A;  1XQQ A;  3LYY A;  1WXS A;  2J0K A;  1C9F A;  3JSV A;  4US8 A;  1LQB A;  1QIL A;  1KM7 A;  2YEP B;  1UWM A;  4IM0 A;  1QOA A;  1YX6 B;  2V4L A;  3BY4 B;  1KLU D;  3H1U A;  2V1Y A;  3MC8 A;  2K8C A;  1TY2 A;  1XLQ A;  1C3T A;  2KQS A;  2JF5 A;  2KK8 A;  3LJ3 A;  1PUT A;  4BOZ B;  2BYF A;  2D5G A;  1E7P B;  3TCA A;  1I35 A;  4AJW A;  2K6D B;  3M3J A;  1XF5 L;  1JRP A;  1D5Z C;  1FRD A;  3RNF C;  2KN5 A;  3R7Q A;  4JQW C;  1YIW A;  5KHO A;  1E6E B;  1UF0 A;  3U7D A;  1Z5S B;  1DOI A;  2IDY A;  3N30 A;  5LNK 1;  2DX5 B;  4LNF A;  2PMV A;  3EEC A;  3EFU A;  4EZL A;  4REZ A;  4O1N A;  1KLG D;  5HKH A;  1EF1 A;  3ZUN A;  3W1S C;  1DGJ A;  5BYS A;  3TEY A;  1EWC A;  3Q8C A;  4MGZ E;  3MHZ A;  2KLG A;  3OJ4 B;  2D3C A;  3Q69 A;  4PT5 A;  4EOY A;  2LMC A;  1I42 A;  4F1S A;  1RFK A;  1QOB A;  1SE4 A;  3GZN I;  2AQ2 B;  4CHK A;  3RZF A;  4BKT A;  3APF A;  1YJ1 A;  1TKY A;  1FO4 A;  4NPN A;  4C7Z A;  4TSS A;  3FKY A;  5G2N A;  1M94 A;  2NTT A;  2RDB C;  1BUI C;  1KH0 A;  5KHQ A;  4DQO C;  1XLP A;  4DK5 A;  2VZK B;  2BPS A;  1KTK A;  2INC C;  3QIJ A;  2LXC A;  1VRA B;  1F0Z A;  3T8M A;  3IT6 B;  2KOX A;  4PS3 A;  1TKG A;  1T0Q C;  1YQB A;  3PRP B;  1HA5 A;  1SBB B;  4LJO B;  1E8Y A;  5EE1 A;  2DWQ A;  2PEA A;  4B0E A;  5I4D A;  2KHW B;  1ZPS A;  1RWS A;  2JRI B;  4LNK A;  2M17 A;  1P3Q U;  3PS6 A;  1UBI A;  1V97 A;  1ZE3 D;  3QJZ A;  3DVG Y;  2ZJD A;  2NS5 A;  4NJC A;  4IM3 A;  3RCZ A;  2GMI C;  4NQL B;  4YSZ B;  2ZNV C;  5D3D A;  3PV1 A;  3VXW A;  1RM6 C;  3ETR A;  2NPT A;  1WSP A;  1JWU D;  4DXG A;  3DBS A;  1ZOY B;  1IYF A;  1JCK B;  2SEB D;  2IGH A;  2PPH A;  2FUG 1;  2KN4 A;  1ET6 A;  2WXK A;  4BAX A;  4AQ7 A;  3AU5 A;  1ZXH A;  4US9 A;  3WAN A;  5J18 A;  3Q3N C;  3BII D;  2NPT B;  4DXF A;  1OEY J;  3NHE B;  1ENF A;  2FCQ A;  2WGS A;  4ZRP A;  1EM7 A;  3C19 A;  1IP9 A;  1BXT A;  4XX5 A;  1WXV A;  4WQM A;  1QLB B;  4W9K A;  4ICU A;  1F9J A;  3MP9 A;  3V6C B;  1JRU A;  2QCZ A;  2GOW A;  4ZHO A;  1C4A A;  4RGN A;  5DPT A;  2YEP F;  4LNO A;  2C7M B;  2VRR B;  4BVU C;  3FIL B;  3UGB B;  4BBN C;  2DZI A;  1XCQ L;  3CMM B;  4LDT B;  3DVN V;  4MM3 A;  1V49 A;  2J0M A;  1WR1 A;  1YN5 A;  2G1E A;  3X23 A;  3PT2 B;  3RN9 C;  1K8R B;  1PDX A;  4CO7 A;  4C56 C;  2WLB A;  1ZP0 B;  4MJS A;  4WWN A;  3GZN B;  1C77 A;  4WQO B;  1WXQ A;  4N9F 4;  2WXO A;  1WR6 E;  3LB8 C;  3DBR I;  3L13 A;  3ZIM A;  1RLF A;  2BS4 B;  4HK2 A;  3VAW A;  1E9M A;  4WJP A;  5D7G A;  3QWZ B;  1N5W A;  2O6V B;  2W8H A;  2NBV B;  1ZUD 2;  2G3Q B;  1G6J A;  2KFK B;  1WGR A;  2O6V D;  3TEZ A;  4W9L A;  1E0Z A;  2JPH A;  4HCN B;  2KDF B;  2ZW1 A;  1KOT A;  1VDV A;  3IHP C;  3A9K A;  4B9K A;  2Y5P A;  2KDE B;  4EKU A;  1CJE A;  2CU3 A;  1Q1O A;  2JWZ A;  5JHA A;  1AN8 A;  2WXI A;  4NJ7 A;  2KWU B;  4WWM A;  4GMV A;  1RYJ A;  3V61 A;  2K6Q A;  4BBN F;  4E71 A;  2D3A A;  1NI3 A;  1TZ1 A;  4DHZ E;  3N20 C;  2LGI A;  1L6V A;  4OZB A;  3URY A;  2RPV A;  2J58 A;  4IW0 A;  4ARC A;  2EMT A;  2KC2 A;  2REX A;  2HE7 A;  3PLU A;  1R7S A;  4WUR A;  4KGT A;  3P4S B;  1FCC C;  1YJJ A;  2MX2 A;  1CZP A;  3IVF A;  3DBH I;  1E7U A;  3A33 B;  4ZRK A;  1HXY D;  3B2G A;  4ZRQ A;  2DZM A;  1T5X D;  3AUL A;  2MBH A;  4RMA A;  1N61 A;  4IG7 B;  1D4B A;  1WRD B;  1NEK B;  2AEH A;  1F2R C;  1OQR A;  3L16 A;  3U7Z A;  2R2Q A;  2IBI B;  3AB5 A;  2AL6 A;  3Q3J A;  1C76 A;  1V80 A;  3ZTC A;  2I1K A;  1CMX B;  1EU3 A;  4ASW C;  1UBQ A;  2L3Z A;  2NR2 A;  2QIL A;  1FNW A;  1OEY A;  2HDE A;  1A70 A;  4UDU C;  1B9R A;  3VR9 B;  2G4S A;  1Q5W B;  2E3T A;  3MC9 A;  3DDC B;  4RF1 A;  2E6X A;  3TSS A;  2PJH A;  3PHW B;  2JUO A;  3BIN A;  3JVZ X;  2IZV B;  1WM2 A;  1FXI A;  3DOW A;  1PGX A;  2ZCB A;  4HRS A;  1WH3 A;  2G4D B;  4HPL B;  3JW0 X;  2CHZ A;  2IGD A;  4KV2 A;  4KZC A;  4MGI E;  2MWS B;  5C23 A;  1SE3 A;  3AE5 B;  4ITK A;  3ZRF A;  1WXA A;  2LVO A;  2HJ8 A;  2GBK A;  4K7S A;  2Y5B B;  1OFF A;  4OZA A;  2AWT A;  2ZPN A;  2WDQ B;  4GGQ A;  2JXT A;  4FHK A;  3QAR A;  4MSQ B;  4W9C A;  4OVU A;  1ZDV A;  2KFJ A;  2L00 B;  2WNM A;  4MAC A;  3L08 A;  2C7N B;  1AW7 A;  1SB3 C;  1WGH A;  2GI9 A;  1JWA D;  2KMM A;  1FEH A;  3ZRC A;  4N58 A;  5AZG A;  3CF6 E;  1LM8 B;  3AH7 A;  4HKQ A;  4L2Y A;  2I38 A;  4HPM B;  3I9V 1;  1UEL A;  4YTN B;  3BVG A;  3KUD B;  3R66 C;  4TQ1 A;  1WJU A;  2BWF A;  2MP2 B;  3H7S A;  3BYT B;  4A3P A;  1F2R I;  2CKH B;  4PK1 A;  3W1Y A;  1FXT B;  3B0A A;  2KZR A;  3S2A A;  1VCB A;  3GP7 A;  1P7F A;  3HHM A;  3IAM 1;  3KYC D;  2PE9 A;  1D5X C;  3ZNI D;  4RM8 A;  4I6P A;  2KTR A;  5AZF A;  2KJ6 A;  1KFY B;  1KF6 B;  4GDL B;  2C5L C;  1ESF A;  4IC7 B;  3B1L X;  4AP4 C;  2SAK A;  2Y3A A;  1WJ6 A;  1GC6 A;  2BKF A;  4AOF A;  1QZE A;  1UGJ A;  3QAQ A;  3KUZ A;  4ICV A;  1X1M A;  3K9O B;  2CHX A;  2QHO A;  1B1Z A;  2L05 A;  2EKE C;  1MG4 A;  3RUL A;  4M02 A;  3V6E B;  1KJT A;  2KT7 A;  4CQN A;  4GDL A;  2LAS A;  3ZNZ B;  2CJN A;  3AMZ A;  1J19 A;  3BK1 A;  4KVG B;  3VVW B;  3ZW3 A;  4A20 A;  5BO4 B;  4TKN A;  5T8I A;  3PGE A;  3E56 A;  3AEE B;  2K0P A;  4A8X C;  1JRO A;  3AEB B;  4KGS A;  3GE8 C;  4FN2 A;  5FK9 C;  3RI7 C;  5DCN A;  3OAW A;  2MP2 A;  3PRZ A;  1N63 A;  5TSS A;  2J4X A;  2L1A A;  1TJE A;  4JGH B;  4IWP A;  1L0V B;  2GLS A;  2MJD A;  4PS8 A;  3SFD B;  4FBJ B;  3H9D A;  4AUQ C;  4M8M A;  4FA6 A;  3APD A;  3CST A;  4BKS A;  4DDG D;  2W8I A;  2JYT A;  2WXL A;  4E74 A;  2JWU A;  1P1A A;  1WWT A;  1PQS A;  4WJQ A;  3QA8 A;  4TMA B;  3ZQ4 A;  2WXQ A;  5LLI A;  1TS3 A;  1V1O A;  3CWI A;  3N1Y C;  5FKA C;  1J7A A;  4ZDV A;  4HJG E;  1MHH E;  3ZXV A;  1EO6 A;  4KGR A;  1RRB A;  3IXS A;  2JX5 A;  3I5J C;  4TV3 A;  1E8Z A;  3NG0 A;  4L1B A;  3ZNH B;  1DYQ A;  2JZP A;  3AI5 A;  3M63 B;  3T3N A;  2QC8 A;  3AEC B;  2N4F A;  3VFK A;  4W9J A;  3DWG C;  1UWX A;  1UNS A;  1PGA A;  1I4R A;  3AED B;  3H7P A;  2J52 A;  1PGB A;  3KH0 A;  4MEL A;  3N9Y C;  1VZ8 A;  2DYB A;  1OQY A;  2LI5 A;  1V6E A;  2KD0 A;  3ZDM C;  4RGM A;  5HHD G;  5JH5 C;  4HCP B;  3MC0 B;  2KTF A;  4EEW A;  2OJW A;  1WE6 A;  3ONS A;  3L17 A;  3U8Z A;  4ZRJ A;  3RD2 A;  4XZ4 A;  3UQB A;  4I6L B;  3V05 A;  3ML9 A;  4JLC A;  4YSY B;  4FHJ A;  4P16 A;  4M0W B;  2KJR A;  2ZEQ A;  1L4Z B;  2IPK D;  1P9D U;  2FCM A;  4ANU A;  5EDS A;  1D5M C;  4ZYN A;  3PZ7 A;  2PW9 A;  2N9E B;  3BK2 A;  3Q8A A;  3H6N A;  2BB6 A;  2LJI A;  2QSD A;  4M8N A;  4P7I A;  2BS3 B;  2X38 A;  2CU1 A;  4WAA A;  4PS7 A;  2JSV X;  3EUB 2;  2RMM A;  3VR8 B;  3OJ3 A;  4XWW A;  2L8J A;  1IPG A;  3LDZ E;  3FC4 A;  1JAL A;  1WYW B;  5CHV C;  3A1Q A;  5AZH A;  3NY5 A;  1QQR A;  4FAD A;  4NQK E;  1V9J A;  2KDI A;  3AEG B;  4C4V B;  1WGY A;  1I4P A;  2N7D A;  1YD8 U;  3O65 B;  2O6V A;  4P1B C;  1GAQ B;  2K5P A;  2BYE A;  4RF0 A;  2L76 A;  5C3J B;  2INN E;  3NUH B;  3KW5 B;  4OW0 A;  3P4R B;  2G45 B;  5J17 A;  4LJP B;  1HEZ E;  3NZS A;  1I4Q A;  1Y8R C;  1TZO A;  2XN9 C;  4FJY A;  1NVI D;  3X0W A;  2O2V B;  1I4X A;  1BML C;  3JYU A;  2NBU A;  1FMA D;  1UH6 A;  1I4G A;  2LZ6 A;  1P98 A;  5DPR A;  1C78 A;  1UGM A;  3VH4 B;  3IBE A;  3NOB A;  3HM6 X;  2BS2 B;  2MBB B;  1WIA A;  2H89 B;  2WXR A;  2KLC A;  2KO3 A;  2IO1 B;  1R4N I;  1FRR A;  2LUE A;  2BGF A;  1L5P A;  1XXG A;  2MEK A;  2K22 A;  2KC1 A;  2JXX A;  1R4M I;  2KVZ A;  3ZGZ A;  2R2O A;  3Q3F A;  1FFU A;  3VH3 B;  3MHS D;  4GXB A;  4B0M A;  3M62 B;  3SFE B;  3DHI C;  4KDI C;  4DHJ D;  3ZO5 B;  2DAJ A;  2NBW B;  2L52 A;  1NI2 A;  2WDR B;  2BWE S;  4K7W A;  4USA A;  2M0A A;  2K3U A;  2M1M A;  5IOI A;  4L23 A;  1QOG A;  3P42 A;  1T0R C;  2LGS A;  3HM3 A;  4IDI A;  3L10 B;  5D6J B;  2Y5C A;  3RFZ B;  2KQ4 X;  4IOI E;  2KKC A;  4M01 A;  3SU8 X;  1ZDX A;  2LGD A;  4HDO A;  1K51 A;  3P4P B;  2WU2 B;  1WX9 A;  2RDG A;  4IKG A;  1HTQ A;  4B6W A;  3AN1 A;  4K3C A;  3WCQ A;  1M4V A;  4ANW A;  1ZW7 A;  5AUI A;  3J9C A;  3R3M A;  2ZNV B;  3Q8E A;  2N9K A;  1V8C A;  5IN7 A;  2KVR A;  1FIQ A;  2BYT A;  4MGK E;  5HG2 A;  3TJP A;  4ANX A;  4KDL B;  3T9L A;  4IWO A;  3NVV A;  3ZTD A;  4OHJ A;  2KTR B;  4YL8 A;  4W9D A;  2W82 A;  3KWV A;  1VZ7 A;  2B3A A;  2KMC A;  3BZD B;  4CYE A;  1HZ5 A;  3N3K B;  4NAW A;  3WAP A;  3KYD D;  5CTR C;  2FE8 A;  3BVZ A;  3AV8 A;  3RNE C;  3D32 A;  4M0W A;  5G5G A;  2W9N A;  2BKR B;  3PTF C;  1L7Y A;  4JWS C;  2KXJ A;  3E9S A;  1E8X A;  3SD5 A;  4K81 A;  2LEK A;  3A9J A;  4URK A;  4RCO A;  3I57 A;  2LUM A;  1RFA A;  3MTN B;  3PRM B;  5H8Y E;  3DCG A;  3RZW C;  2LVP A;  1IGD A;  5MPO A;  1ROE A;  4WIP A;  2WXM A;  3WA0 A;  3ALB A;  1HE8 A;  4DWF A;  1WRI A;  1F77 A;  1H8C A;  1TYG B;  1TBE A;  1WGD A;  3SEB A;  2PKO A;  4WH4 A;  1WMH A;  5CHF A;  3NZU A;  4LCD E;  3A9K B;  3AXC A;  4C7Y A;  1LFD A;  1K50 A;  4LLG M;  1C79 A;  1XO3 A;  3ZKJ C;  2N7E A;  1ET9 A;  4RM9 A;  1NEN B;  2AQ3 B;  4OVV A;  3NVZ A;  3NJT A;  1YQ4 B;  2FCS A;  2WX0 A;  1WMH B;  2ZZP B;  2OED A;  3FAH A;  1LXD A;  1KRH A;  4EFO A;  3R2T A;  2IY1 B;  5H92 C;  2FBW B;  4MDK E;  5BMG A;  2MA9 B;  2OOB B;  5TR5 A;  1K53 A;  1QOF A;  3Q14 C;  1V2Y A;  2ZCC A;  4II3 B;  2BTE A;  1XLO A;  3Q3M C;  3ABV B;  1L0X B;  1YX5 B;  3A9J B;  2D2Q A;  4C00 A;  2ZPY A;  2LXA A;  2WXH A;  4FLH A;  3W5U B;  1C1Y B;  2MRP A;  1S1Q B;  4NNJ B;  3DBR B;  1KLV A;  2D3B A;  4II2 B;  3UIO B;  2MW5 A;  3Q2A C;  1FFV A;  2ASQ A;  5FR3 A;  1T3Q A;  4YSX B;  2IO3 B;  1GB1 A;  4RFB A;  3BVM A;  4PYZ A;  3RT3 B;  2IJ0 A;  4XDD A;  1GOZ A;  1YN3 A;  2D07 B;  3TEX A;  3VHT C;  2INP E;  2D10 A;  2QEJ C;  1VJK A;  2XNA C;  4M00 A;  4JPS A;  4KX6 B;  4W9F A;  3AE1 B;  1V86 A;  3A4R A;  2KWC A;  2GRI A;  4D2K A;  4GLS C;  2BB5 A;  3EHV A;  1SJE D;  2BVC A;  1J0G A;  2EKI A;  1TT5 B;  3Q6B A;  4ZHP A;  2WS3 B;  1HQR D;  3ZJT A;  2TSS A;  2GBJ A;  3BWU D;  2KAN A;  2RSU A;  3VUY A;  3KVF B;  2ZVN A;  1SXT A;  4RGO S;  4PYU A;  2M19 A;  1WM3 A;  1FNU A;  4XYC A;  4LTU A;  3L0W B;  1AYF A;  4GOC A;  2IO0 B;  3NZ3 A;  2Z0E B;  2J0J A;  2MH7 A;  1BT0 A;  4RGT A;  5LXI B;  2XBB C;  1SIJ A;  3AE4 B;  2W55 A;  2CHW A;  4YWG G;  2WXG A;  2HTH A;  3DVN U;  1GPX A;  4ZYS A;  2PVO D;  2YLM A;  1VD2 A;  4FUL A;  1XCT L;  3ML8 A;  3ZJV A;  1L4D B;  1NDD A;  5CHW A;  3PO0 A;  2QJL A;  2M0X A;  3VTV A;  1VZ6 A;  2IY0 B;  3V3X A;  1J7B A;  2RR9 A;  3PPA A;  4OZC A;  4MJS B;  2VH2 A;  4HLE A;  3VDZ A;  2DLB A;  1Q0W B;  1VLB A;  2KX3 A;  2Q5W D;  2DYO A;  2M8S A;  2KWV B;  3UF8 A;  1K52 A;  1V81 A;  3B9J A;  2JQR B;  3PVL A;  1F1H A;  1S3S G;  2UU7 A;  2KJH B;  3OWE B;  2LHE A;  4BKS D;  2IGG A;  4A55 A;  2BT6 A;  2XEW A;  2I2Y A;  2LVQ A;  4ZOH C;  3EA6 A;  2FID A;  1QKZ A;  1Y56 A;  2PIA A;  1T0S C;  1GG3 A;  1JWM D;  3TBL D;  4AS1 A;  4K1R B;  4R3D A;  5L95 C;  2WX1 A;  2JU6 X;  4G0N B;  3DQV A;  4NAM A;  1SEB D;  4RH6 A;  2KX0 A;  2DZK A;  1NYR A;  4YT0 B;  3NS1 A;  1YMH E;  1MI0 A;  1OTR B;  5L83 A;  4BFR A;  5E6J A;  4W9G A;  1GJZ A;  3P1M A;  4KSK C;  4KIK A;  2AYO B;  2N1W A;  3A4S C;  1E10 A;  2IYD B;  1Q10 A;  2X8X X;  4A9A A;  5G55 A;  3AE8 B;  2AL3 A;  2MQJ A;  2WDT B;  1L2N A;  1VR9 A;  2V3P A;  4G11 A;  2JZ3 B;  1SE2 A;  2DZJ A;  4ZRI A;  2K8H A;  1P0R A;  3DBH B;  4F7Z A;  1SF0 A;  5IA7 A;  2CR5 A;  1I4H A;  3ZLZ A;  4IM2 A;  2WXF A;  3PZ8 A;  4B95 A;  1WX8 A;  1SJH D;  1LO5 D;  1PFD A;  4J3O D;  1P7E A;  3W2D A;  5IP4 D;  3QQ8 B;  3EFC A;  3GE3 C;  4KZ0 A;  3TUO A;  1GC7 A;  2GBR A;  2V0G A;  1MFW A;  3OLM D;  2GBM A;  5BMI A;  1WXM A;  3VTU A;  2WQY B;  2N7J A;  1WJN A;  3IAS 1;  2PLP A;  2J42 A;  4S0R A;  4A90 A;  3NRZ A;  3KQ4 A;  3JSV B;  1STE A;  2J53 A;  4DBG A;  1ISN A;  2M4N A;  3H7P B;  4N6E B;  2ONQ A;  3APC A;  1JML A;  3C0R B;  1WZ3 A;  2MSE D;  2UWQ A;  3AM9 A;  1FCL A;  3DBL B;  5FR6 A;  4HRO A;  1D6E C;  3BYY B;  5JHB A;  2BQQ A;  4F8C B;  3V60 A;  3CSF A;  2KDB A;  2GB1 A;  4EUT A;  3DPD A;  3P4Q B;  3ZXR A;  1CK1 A;  3N32 A;  2K8B A;  2KAJ A;  1WE7 A;  3AU4 A;  4HEA 1;  2BW2 A;  4GSW A;  3ZVV A;  2DNF A;  3H8H A;  4DHZ B;  4JX1 C;  4RNA A;  2IO2 B;  3ENE A;  4DDI D;  4G50 A;  3SR6 A;  3VTW A;  1JWS D;  1TTN A;  1A5R A;  3AE7 B;  3RUI B;  2RGF A;  5C1Z A;  3GB1 A;  2W3R A;  4OVZ A;  4W9I A;  4GU2 A;  3EGR A;  1IGC A;  3TEW A;  3MJ5 A;  2EEL A;  2N9X A;  1GNU A;  4KSL C;  3VRA B;  4GDK A;  2LGY A;  3I63 C;  1CQV A;  3RYT A;  1EU4 A;  1UD7 A;  3AE6 B;  4LK0 M;  4LNN A;  2MHJ A;  2WXJ A;  5E6N A;  1NBF C;  4GN1 A;  1RAX A;  2L7R A;  2N0S B;  2VZK D;  4MGY E;  1E90 A;  5IO9 A;  2K25 A;  4MM3 B;  3CIR B;  5G5H A;  2OJR A;  2HD5 B;  3FIL A;  1Z2M A;  1E8W A;  3PZD A;  3UIN B;  1C4C A;  1UZX B;  1YJI A;  2XK5 A;  4HXD A;  4WWO A;  5CX3 A;  1YN4 A;  2GBN A;  3I3T B;  1WGG A;  2WXP A;  4NAW B;  2NTS A;  2NVU I;  1N6Z A;  2UYZ B;  4GIV A;  1JQ4 A;  5BMH A;  1JWB D;  4BZA A;  5JXV A;  2LD9 A;  2Z0D B;  4IUM B;  2KNB A;  2BYV E;  1E7V A;  4A3O A;  1IBX A;  4DHJ B;  2LHD A;  3MFG A;  2KDM A;  2W3S A;  2QDF A;  1HTO A;  3LXF A;  1TGZ B;  2H88 B;  3PSE B;  3Q8B A;  3IFW B;  3NS8 A;  4HWI B;  4GB9 A;  1N62 A;  5AEK B;  1QT9 A;  5E6P A;  2LRU A;  3ZNG C;  4YTM B;  1L6U A;  5J2R A;  2D11 A;  2V4I B;  1NYQ A;  1MPE A;  1SIF A;  1TIF A;  4P1C C;  4Q2J A;  3O13 A;  1IBX B;  2CS4 A;  2AX5 A;  2HJ1 A;  4HDQ A;  3N1X C;  3W9C B;  1WI0 A;  4ANV A;  4W9E A;  4DXA B;  2HTM E;  2DHZ A;  1YNT E;  2V3S A;  2DYM A;  3ZYY X;  3B08 A;  3TMP B;  1MJD A;  1WX7 A;  1ACC A;  3GOE A;  1ZGU B;  1YQ3 B;  4HJK A;  5EE0 A;  5AUK A;  5EE9 A;  1L0Y B;  2N9L A;  2JRH A;  3HRD D;  2EMS A;  4MT5 A;  1XLN A;  1C4P A;  3SHQ A;  4LNI A;  3WAM A;  3P2B A;  2C7H A;  2KWD A;  1WZ0 A;  3QK0 A;  2ON8 A;  5IAA C;  1V1P A;  3PLV A;  3QC8 B;  2WWZ A;  2ZVO A;  3L54 A;  3VUW A;  4GDK B;  3DWM A;  1GUA B;  1SE9 A;  1YOV B;  1QF6 A;  1N5X A;  3U30 A;  2A4Z A;  3TIX A;  1MVK A;  2O2V A;  3QCA A;  3UQA A;  4FJV B;  2WXN A;  1FD6 A;  2LFI A;  3RNC C;  1GB4 A;  3ZDT A;  1PYW D;  3TL5 A;  4XDC A;  4XWT A;  2FNJ B;  2W54 A;  4H2A A;  2WYQ A;  1WYG A;  3W1S A;  4XC2 A;  4NJ6 A;  2V9H A;  3UI3 A;  5BYQ A;  4N59 A;  4NY0 A;  3HK0 A;  3U52 E;  3HVD A;  3UIP B;  4IWQ A;  2I1J A;  3AEF B;  2ICI A;  1WGK A;  2G9H D;  2QMT A;  3DHH C;  1WF9 A;  4KKI A;  1SGH A;  2N1V A;  2JVC A;  2BBC A;  3PHX B;  2KAC A;  5DPW A;  3VUX A;  1AWD A;  4J6I A;  1U4A A;  4AJY B;  1TY0 A;  4MEM A;  4EE2 A;  3T3O A;  1TS2 A;  3RNA C;  2YVC A;  2N9P C;  2A5U A;  1R4N B;  2MBO A;  1V5O A;  4W9H A;  2C60 A;  4JWU C;  2QIE B;  2RDH A;  3N1Z C;  2PTL A;  2MJE A;  1XD3 B;  2M56 B;  1TKE A;  3EC8 A;  4WJN A;  4WAF A;  4E3C A;  1OGW A;  1R4M B;  2K9X A;  1V1P B;  3OG5 A;  2JY6 A;  2RD0 A;  1N60 A;  3VQI A;  2MBE A;  4EZK A;  2PVG C;  2LWP A;  4XGA B;  3RNG C;  3KUC B;  3DHG C;  2Z59 B;  5LXH A;  2RPQ A;  3AE2 B;  3WAO A;  2L83 A;  3L4P A;  1DOY A;  1XEE A;  4P6V F;  3DBL I;  4MH0 E;  3HUI A;  1FNV A;  3KWL A;  1J7C A;  4XE0 A;  2BF8 B;  2NCN A;  1F52 A;  2OHF A;  4FJZ A;  4AWJ A;  4JL9 A;  2FCN A;  3AE9 B;  5D94 A;  5D2M B;  2L32 A;  4FXC A;  2FIF A;  2WU5 B;  1J8C A;  2DBY A;  2LGX A;  1SSN A;  3HIZ A;  4BKG A;  3VRB B;  1XT9 B;  5HFY A;  3AEA B;  3ECI A;  1DOX A;  4QAY A;  1EUV B;  4KIK B;  2MLB A; 
#chains in the Genus database with same CATH homology
 1E0Z A;  3ZJU A;  1TS4 A;  3AE3 B;  1QQR A;  2ZW1 A;  5E6J A;  2ZW0 A;  3AEG B;  1VDV A;  3P1M A;  2JYE A;  4YXD B;  1I4P A;  1JW9 D;  4ARI A;  2Y5P A;  1E10 A;  1CJE A;  1Q10 A;  2CU3 A;  1AN8 A;  2CJO A;  4A9A A;  1GAQ B;  2WXI A;  2K5P A;  4JE3 B;  4RF0 A;  4WWM A;  5C3J B;  3AE8 B;  2INN E;  3NUH B;  3P4R B;  4OW0 A;  1VR9 A;  1ZXI A;  2V3P A;  1HEZ E;  1RYJ A;  1SE2 A;  3NVW A;  1I4Q A;  3RPF C;  1NI3 A;  1TZO A;  3HVZ A;  2XN9 C;  1SF0 A;  3R2I A;  2WP9 B;  1I4H A;  1NVI D;  2LGI A;  1L6V A;  2WXF A;  3PZ8 A;  4OZB A;  1FM0 D;  1SJH D;  3URY A;  2RPV A;  1I4X A;  1BML C;  1LO5 D;  1PFD A;  4J3O D;  2J58 A;  4C80 A;  1EWY C;  1P7E A;  1HZ6 A;  3C8Y A;  3W2D A;  4ARC A;  1FMA D;  4YTP B;  1I4G A;  1R7S A;  3IT4 B;  4WUR A;  4KGT A;  5EE3 A;  4MH8 A;  3P4S B;  5C2T B;  1FCC C;  1C78 A;  1YJJ A;  1CZP A;  3TUO A;  2BS2 B;  2ACZ B;  1HXY D;  1I7H A;  3B2G A;  2V0G A;  2H89 B;  2WXR A;  4ZRQ A;  1TS5 A;  2Z8L A;  1T5X D;  3W5V B;  1MHX A;  1FRR A;  5BMI A;  1N61 A;  1D4B A;  1L5P A;  5HI1 A;  2WQY B;  1XXG A;  2N7J A;  2MEK A;  1NEK B;  2K22 A;  3IAS 1;  1F2R C;  3P63 A;  2PLP A;  2J42 A;  1T6B X;  1OQR A;  3U7Z A;  4A90 A;  3NRZ A;  3ZGZ A;  3KQ4 A;  3AB5 A;  1C76 A;  3KLS X;  5BYR A;  1FFU A;  1STE A;  2J53 A;  1EU3 A;  4B0M A;  3SFE B;  2QIL A;  1FNW A;  2HDE A;  1A70 A;  4KKJ A;  3R8B A;  4UDU C;  1B9R A;  4N6E B;  2V3N A;  2ONQ A;  1JML A;  2L52 A;  2AQ1 B;  3VR9 B;  2WDR B;  3AM9 A;  1FCL A;  4HRO A;  1D6E C;  4USA A;  2E3T A;  2M0A A;  3BYY B;  4RF1 A;  2E6X A;  2K3U A;  3TSS A;  1IUE A;  2NMQ A;  2WDV B;  3NVY A;  4L23 A;  1FXA A;  1QOG A;  2MJ3 A;  5GXG B;  3GS2 A;  3P42 A;  3U4E G;  2GB1 A;  3P4Q B;  1FXI A;  1CK1 A;  4IDI A;  1PGX A;  1UUP A;  2KAJ A;  2Y5C A;  3RFZ B;  4HRS A;  2KQ4 X;  4IOI E;  3Q8F A;  2IGD A;  4HEA 1;  4NZL B;  1ZDX A;  5D3I B;  2BW2 A;  3H8H A;  2R61 A;  4A6Q A;  4JX1 C;  4RNA A;  1SE3 A;  1K51 A;  3AE5 B;  3P4P B;  2WU2 B;  3SR6 A;  1JWS D;  4TQ0 A;  2RDG A;  4IKG A;  4ITK A;  3U2S C;  1OQQ A;  3AN1 A;  3AE7 B;  2B76 B;  4HKZ E;  3WCQ A;  1M4V A;  5AUI A;  3J9C A;  3B2F A;  3Q8E A;  2N9K A;  1V8C A;  1OFF A;  3GB1 A;  2W3R A;  3LYY A;  1FIQ A;  4OZA A;  4OVZ A;  2BYT A;  5HG2 A;  1C9F A;  4US8 A;  2WDQ B;  1QIL A;  2JXT A;  3EGR A;  1IGC A;  3TEW A;  3NVV A;  3MJ5 A;  2EEL A;  4OHJ A;  2YEP B;  3VRA B;  2W82 A;  1UWM A;  3KWV A;  1VZ7 A;  1ZDV A;  1CQV A;  3BZD B;  1QOA A;  1HZ5 A;  1EU4 A;  2WNM A;  3AE6 B;  4LK0 M;  4MAC A;  1KLU D;  1AW7 A;  1SB3 C;  2GI9 A;  1JWA D;  2WXJ A;  2KMM A;  1FEH A;  2FE8 A;  4N58 A;  1TY2 A;  1XLQ A;  2N0S B;  2VZK D;  3AH7 A;  4HKQ A;  4L2Y A;  4MM3 B;  3CIR B;  2I38 A;  1PUT A;  3BVZ A;  5G5H A;  3AV8 A;  3I9V 1;  2D5G A;  4YTN B;  1E7P B;  4M0W A;  3BVG A;  3FIL A;  5G5G A;  4TQ1 A;  4JWS C;  3BYT B;  3E9S A;  1C4C A;  1F2R I;  1YJI A;  1XF5 L;  2LEK A;  4RCO A;  1YN4 A;  1JRP A;  1D5Z C;  1FRD A;  2LUM A;  3I57 A;  2WXP A;  3GP7 A;  1P7F A;  2NTS A;  4NAW B;  5H8Y E;  3IAM 1;  1IGD A;  5MPO A;  1E6E B;  1JQ4 A;  5BMH A;  1JWB D;  1ROE A;  1D5X C;  4WIP A;  5JXV A;  2WXM A;  1DOI A;  2IDY A;  5LNK 1;  1WRI A;  2PMV A;  1F77 A;  1KFY B;  1TYG B;  1KF6 B;  4GDL B;  1IBX A;  4REZ A;  4O1N A;  1KLG D;  2LHD A;  3MFG A;  2KDM A;  2W3S A;  3SEB A;  1ESF A;  2PKO A;  4WH4 A;  2SAK A;  3LXF A;  1DGJ A;  2H88 B;  5BYS A;  2Y3A A;  3Q8B A;  3TEY A;  1EWC A;  4C7Y A;  1N62 A;  3Q8C A;  1UGJ A;  1K50 A;  4LLG M;  1QT9 A;  1C79 A;  1XO3 A;  4YTM B;  3MHZ A;  3TEZ A;  1L6U A;  1ET9 A;  2V4I B;  1NYQ A;  1B1Z A;  3Q69 A;  1NEN B;  2AQ3 B;  3NVZ A;  4PT5 A;  1MPE A;  1YQ4 B;  4Q2J A;  2LMC A;  2OED A;  3FAH A;  3O13 A;  1KRH A;  4CQN A;  1IBX B;  1RFK A;  1QOB A;  1SE4 A;  2AQ2 B;  3R2T A;  2AX5 A;  5H92 C;  1TKY A;  2CJN A;  2FBW B;  5BMG A;  1FO4 A;  3AMZ A;  1K53 A;  3BK1 A;  3W9C B;  1QOF A;  4C7Z A;  4TSS A;  2HTM E;  5T8I A;  3E56 A;  3AEE B;  1YNT E;  2K0P A;  2DYM A;  2NTT A;  1MI0 A;  4A8X C;  1JRO A;  3ZYY X;  2BTE A;  1BUI C;  1XLO A;  1ACC A;  1KH0 A;  3ABV B;  3AEB B;  1L0X B;  4KGS A;  5FK9 C;  1YQ3 B;  5EE0 A;  4DQO C;  5AUK A;  5EE9 A;  1L0Y B;  2N9L A;  1N63 A;  5TSS A;  2WXH A;  3W5U B;  1XLP A;  2J4X A;  2L1A A;  1TJE A;  3HRD D;  2VZK B;  1L0V B;  1KTK A;  4MT5 A;  1XLN A;  1VRA B;  1C4P A;  1F0Z A;  3IT6 B;  2KWD A;  2MJD A;  2ON8 A;  3SFD B;  1TKG A;  1V1P A;  1FFV A;  5FR3 A;  1HA5 A;  1T3Q A;  4YSX B;  1GB1 A;  4RFB A;  1SBB B;  3BVM A;  2IJ0 A;  4XDD A;  5EE1 A;  1GOZ A;  1YN3 A;  2DWQ A;  3TEX A;  4GDK B;  3DWM A;  2INP E;  4B0E A;  2W8I A;  2QEJ C;  1QF6 A;  1VJK A;  2JYT A;  2WXL A;  2XNA C;  4KX6 B;  1N5X A;  4JPS A;  5I4D A;  2JWU A;  1MVK A;  1WWT A;  3AE1 B;  1ZPS A;  1RWS A;  2GRI A;  4D2K A;  4GLS C;  2WXN A;  4TMA B;  2BB5 A;  3ZQ4 A;  1FD6 A;  2WXQ A;  1TS3 A;  2LFI A;  1V1O A;  1SJE D;  3CWI A;  5FKA C;  1GB4 A;  2EKI A;  1PYW D;  1V97 A;  1J7A A;  4HJG E;  1ZE3 D;  4XDC A;  4ZHP A;  4XWT A;  2WS3 B;  2W54 A;  4H2A A;  1HQR D;  4NJC A;  1MHH E;  3ZJT A;  2TSS A;  1WYG A;  3BWU D;  4YSZ B;  5D3D A;  4KGR A;  1RM6 C;  3ETR A;  3W1S A;  3IXS A;  2JX5 A;  1WSP A;  1JWU D;  3UI3 A;  1SXT A;  4RGO S;  4DXG A;  4L1B A;  5BYQ A;  1DYQ A;  2JZP A;  1ZOY B;  4N59 A;  1JCK B;  2SEB D;  2IGH A;  3T3N A;  3AEC B;  2M19 A;  3U52 E;  2FUG 1;  1FNU A;  2KN4 A;  1ET6 A;  2WXK A;  3HVD A;  4LTU A;  4AQ7 A;  1AYF A;  1ZXH A;  3AEF B;  4US9 A;  2ICI A;  3NZ3 A;  1WGK A;  2G9H D;  2QMT A;  4KKI A;  3BII D;  4DXF A;  3DWG C;  1UWX A;  1UNS A;  2BBC A;  2MH7 A;  1PGA A;  2KAC A;  1I4R A;  3AED B;  2J52 A;  4RGT A;  1PGB A;  1AWD A;  1ENF A;  1SIJ A;  3AE4 B;  4ZRP A;  2W55 A;  1VZ8 A;  3N9Y C;  1EM7 A;  2WXG A;  4YWG G;  1GPX A;  1TY0 A;  1BXT A;  4ZYS A;  2PVO D;  4EE2 A;  4RGM A;  5HHD G;  4WQM A;  3T3O A;  1TS2 A;  1XCT L;  3ZJV A;  1QLB B;  1L4D B;  3MC0 B;  3PO0 A;  2QJL A;  3MP9 A;  1VZ6 A;  3V3X A;  1J7B A;  4OZC A;  4JWU C;  2QIE B;  2RDH A;  2PTL A;  2DLB A;  4ZHO A;  2MJE A;  1VLB A;  2M56 B;  1TKE A;  2Q5W D;  4WAF A;  1C4A A;  2K9X A;  1V1P B;  4RGN A;  3V05 A;  1N60 A;  2DYO A;  4YSY B;  2YEP F;  3VQI A;  1K52 A;  3B9J A;  2JQR B;  4P16 A;  3FIL B;  2PVG C;  1XCQ L;  1L4Z B;  2IPK D;  3OWE B;  2LHE A;  2IGG A;  3AE2 B;  1D5M C;  4A55 A;  1YN5 A;  2L83 A;  2G1E A;  3L4P A;  3PZ7 A;  1DOY A;  1XEE A;  2PW9 A;  4P6V F;  2BT6 A;  1PDX A;  2I2Y A;  3BK2 A;  3Q8A A;  3HUI A;  4ZOH C;  1FNV A;  3EA6 A;  4C56 C;  2BB6 A;  1J7C A;  2LJI A;  1ZP0 B;  1QKZ A;  2WLB A;  3KWL A;  4XE0 A;  1Y56 A;  2QSD A;  2PIA A;  2OHF A;  1C77 A;  1JWM D;  1WXQ A;  2BS3 B;  3AE9 B;  4AS1 A;  2X38 A;  2WXO A;  3LB8 C;  2JSV X;  3EUB 2;  2L32 A;  2RMM A;  4FXC A;  3VR8 B;  2BS4 B;  4R3D A;  4XWW A;  2WU5 B;  1E9M A;  2DBY A;  2JU6 X;  5D7G A;  1N5W A;  2W8H A;  1SSN A;  4NAM A;  3VRB B;  1ZUD 2;  5HFY A;  3AEA B;  1SEB D;  4RH6 A;  1DOX A;  3FC4 A;  1JAL A;  1NYR A;  4YT0 B;  3NS1 A;  1YMH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...