3P42A

Structure of gfcc (ymcb), protein encoded by the e. coli group 4 capsule operon
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
QGMVTIYLPGEQQTLSVGPVENVAQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWLAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Predicted protein
publication title The Crystal Structure of Escherichia coli Group 4 Capsule Protein GfcC Reveals a Domain Organization Resembling That of Wza.
pubmed doi rcsb
source organism Escherichia coli o127:h6
total genus 56
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.700 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p42A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 3p42A03
3P42A 2W8HA 2W8IA 2J58A
chains in the Genus database with same CATH superfamily
3QK0A 3RI7C 4IW0A 5LXIB 3AE7B 3QARA 1WFYA 4KZ0A 2HTME 3T9LA 3ZNID 4HK2A 1YQ4B 3Q3FA 2WXNA 2M0XA 2CR5A 1SF0A 5FK9C 2LD9A 2DNFA 4MJSA 3GE3C 3K9OB 2KK8A 1P7FA 3RNAC 3NG0A 2M19A 1V80A 3ZRCA 3RNBC 4HDOA 1EUVB 2FCMA 1V2YA 3SFEB 1MPEA 3VUYA 2KO3A 1WE7A 4MGIE 2R61A 4PS7A 3AE2B 3PRMB 4N58A 1UGJA 2EKIA 4YSZB 1TJEA 1TS4A 1WZ3A 4LK0M 2TSSA 2QILA 1V81A 4W9FA 3IXSA 4HWIB 3OJ4B 2DYBA 4EZJA 2DZIA 3BY4B 2NR2A 4N9F4 5J17A 2L7RA 2R2OA 1I35A 1MHXA 1ENFA 2ZCCA 2I38A 3TEYA 2XK5A 2M1MA 2KJ6A 1UD7A 4RCOA 2REXA 3U30A 3AECB 4BZAA 5T8IA 2WXPA 1GB4A 4CHKA 4HCNB 2L52A 2Y3AA 3N3KB 2MBOA 1E5WA 2MP2A 3U7ZA 1F2RI 5D6JB 5FR3A 2W54A 3KUZA 4JX1C 2L32A 3O13A 1V86A 3AEFB 2A5UA 3VH3B 2LXAA 2KZRA 4ANXA 2ONQA 1FNUA 3T3NA 2NPTB 4ZDVA 3QWZB 2LEKA 4F7ZA 3AU5A 1WGDA 1L6VA 2C7HA 2KN4A 1RRBA 3EGRA 4W9KA 5DCNA 1Y56A 2KC1A 1SE3A 2KYWA 5HKHA 3QJZA 1CZPA 2WYQA 4XGAB 3IFWB 1L2NA 4BKSA 4S17A 4WJNA 2QC8A 2E3TA 1KTKA 1TZOA 2RPQA 1WJ6A 4F1SA 1JCKB 1JALA 1YMHE 1F0ZA 2L76A 2GLSA 4EUTA 2X38A 1OQYA 4EKUA 1VRAB 3BZDB 3L16A 1D5MC 2DAJA 2PMVA 3U4EG 3R66C 4URKA 2M56B 2V3NA 3QHTA 2PJHA 4I6NB 1XEEA 4MSMB 3NY5A 2BKFA 2NBUA 1IUEA 4C7YA 4NAWB 3TMPB 2W82A 2ZNVC 1YX5B 4NJ7A 1ZE3D 1FD6A 2KVZA 3IAM1 2O2VB 2KWUB 3Q3OC 3UQBA 2JZZA 4LDTD 3UF8A 4M8NA 2FCNA 3Q14C 2V4IB 5E6JA 4CYEA 1IBXA 1XLPA 3HVZA 3NZ3A 4BKTA 3RNEC 2AWTA 3DHIC 2SAKA 3H7SA 3DBSA 2W3RA 4YT0B 4IWOA 1X1MA 4A90A 2LFIA 1K8RB 3ZNGC 4MM3B 3AE6B 1RFKA 3Q3MC 2KFJA 1Y8RC 5JXVA 1C77A 1E6EB 2I2YA 2GBRA 2QJLA 1YNTE 4C4VA 1JRPA 3VRAB 1DYQA 3RZFA 4RM9A 2INPE 3FAHA 2K39A 4ZYSA 4C00A 2KC2A 3B0AA 4A3PA 2LGYA 4W9GA 2M17A 1N61A 2XNAC 2N4FA 1SIFA 2W8IA 4C80A 1FO4A 3W1YA 4FJYA 2FAZA 2KWCA 2BYVE 2K1FA 4BFRA 2N1VA 3NVYA 1FNWA 1DOYA 3P4SB 5BYRA 1E10A 3PLUA 2WQYB 2IY1B 2FIDA 2VH1A 4UDUC 1VD2A 2RDGA 3VH4B 5L95C 1I4GA 4XDDA 2LASA 2Z0DB 5GXGB 3B9JA 1SEBD 1GAQB 4DBGA 2RGFA 4MGKE 3A1QB 1FRRA 5C2TB 1FFVA 1WIAA 3BWUD 1D5ZC 1VR9A 2KX0A 2J0MA 3KQ4A 3SD5A 1F1HA 4ZRQA 5FR6A 2QDFA 3PRZA 2OOBB 1P9DU 2BB6A 4PK1A 1WGYA 2DLBA 4RGTA 2ZJDA 4PYUA 3Q8EA 2LGIA 3N1ZC 4YSXB 3PT2B 3UI3A 2VZKD 4K7SA 4WWMA 1MHHE 4MGZE 2WXGA 1SJHD 2AQ1B 1TKYA 3RFZB 3PTFC 3RCZA 2I1KA 3V6CB 2BKRB 2GMIC 1N63A 2LUEA 2ICIA 2BYFA 2L0FA 1PDXA 2MX2A 3DPDA 3RULA 3Q8CA 4EOYA 3PO0A 1BUIC 2K8HA 4JL9A 3H8HA 3WIMA 3I57A 1Q1OA 1UZXB 2J0JA 2AL6A 1G6JA 3C19A 5CHVC 2FBWB 2RR9A 1WXAA 4M01A 1YJJA 4MT5A 1TKEA 3PZ8A 1YN4A 1TT5B 4PS3A 1TYGB 5IA7A 2H88B 3L10B 4WAFA 3DVGY 3AEGB 2WXHA 3A4SC 2MEKA 5C3JB 1QOFA 1LFDA 2EMTA 3MC9A 3DHGC 5C23A 2CU3A 2KDEB 2C5LC 1HEZE 2PLPA 2BB5A 2KJRA 1ZW7A 2WS3B 3P63A 1F9JA 3A9JB 3R2TA 2YEPB 1V1PA 2K9XA 3BK2A 3H9DA 5TR5A 3GS2A 4BKGA 5D7GA 3D32A 4RGMA 2VH2A 1WH3A 4ZRIA 2BS3B 1SJED 1Q5WB 1C78A 3BVGA 2KMMA 3H7PB 3WCQA 2G4DB 3I3TB 5H8YE 4G50A 4P6VF 3N30A 1V5OA 4HDQA 2NBVB 2UU7A 1L0XB 4A20A 4W9LA 1S1QB 4B6WA 4G11A 4WIPA 3M63B 4MDKE 4IM0A 4XZ4A 2CKHB 2LJIA 2GB1A 2QCZA 2K22A 4XE0A 2KFKB 5HG2A 2LUMA 1ACCA 2XBBC 4RH6A 3RNFC 4YSYB 4NQLB 3IT4B 3DBLI 1KJTA 3C8YA 2LHEA 1C3TA 1GNUA 2IO3B 4XYCA 1SGHA 5CHFA 2JWZA 2JXTA 5AZHA 2INNE 4YTPB 3EFUA 3DBHB 2R2QA 4IOIE 1YX6B 2KTRA 2RSUA 2MBBB 3SHQA 1WWTA 4BOZB 2KACA 2K8CA 3AE5B 2K25A 2WXJA 4ICUA 2BVCA 2HD5B 2V3SA 1LO5D 2FE8A 2KDIA 4ZRJA 1QT9A 2FCQA 2MJEA 1ZDXA 3RNGC 4ACFA 1NI3A 3UGBB 2MBHA 2PVGC 3MFGA 2WXRA 1HTQA 5J2RA 2N9PC 4PT5A 1T3QA 3A9KB 5BMHA 4WWNA 2PE6B 5BMGA 2N1WA 3DDCB 2ZVOA 5EE3A 1VZ6A 3AULA 1ZKHA 3CSFA 3PHWB 2Z8LA 1R4MI 3V05A 1MJDA 1R4NB 2ZNVB 3B2GA 2OEDA 3MJ5A 1HA5A 3RYTA 4FBJB 3P4RB 2JYTA 1XT9B 1HZ6A 1NYQA 1WX8A 2V9HA 3ZXVA 3VR8B 1K53A 1CK1A 2AQ2B 1JW9D 1EF1A 2PTLA 1P1AA 2NTSA 3UIPB 3DHHC 4E74A 2WXKA 3AMZA 1STEA 3A4RA 1WZ0A 3AE3B 3HRDD 1QKZA 2MW5A 4K81A 2LHDA 4CQNA 2WDVB 4WJQA 2KDFB 4KGTA 3KWVA 3W5VB 3PSEB 4ZRKA 3W5UB 3CMMB 1RAXA 3I5JC 3DQVA 2WDRB 3NRZA 2HJ1A 4ZHOA 4JLCA 4LJPB 4NY0A 2DZJA 4HPLB 5DPTA 2ZPYA 3QA8A 5EE0A 2J58A 3EECA 4DK5A 4AP4C 3ZJUA 3R7RA 4PS8A 3DWGC 3BVMA 1XLOA 3TCAA 5D3DA 2MA9B 2BF8B 3AEEB 1RFAA 4CO7A 2KDBA 2AQ3B 4BKSD 2BBCA 5AZGA 1MG4A 2LXCA 2W8HA 2V1YA 2CHZA 1JWBD 3NOBA 3WALA 3ZNHB 3BIID 1AN8A 1M94A 2JQRB 3EC8A 2NPTA 1N60A 1WGKA 3CWIA 5IO9A 4WURA 3EHVA 3ZNZB 5EE1A 4NAMA 1WR6E 2QHOA 3VDZA 3U7DA 4YWGG 4DHJB 4AQ7A 4N59A 2SEBD 1WX7A 2Z0EB 4FJZA 2JXXA 3ZDMC 4EZKA 2LGSA 5LXHA 2PKOA 4J3OD 4W9JA 4IM2A 2GOWA 1RWSA 4JPSA 3OJ3A 1IGDA 4DHZE 1NENB 3N9YC 1OFFA 3NZUA 1RM6C 4YTNB 3TEWA 3AU4A 3N1XC 1FMAD 3MHSD 4NJCA 5BYSA 4KKIA 3Q8FA 2JYEA 2MBEA 2NS5A 3SR6A 4NAWA 1SE9A 1PYWD 4NNJB 1PGXA 3OAWA 3AEAB 2J4XA 2O2VA 4BOSC 4LLGM 2KQ7A 4LNOA 1GUAB 2C7NB 2IO1B 1L0YB 2IGGA 3U8ZA 4I6LB 1IPGA 3PHXB 3TSSA 4W9IA 1KFYB 2C60A 1YJ1A 1D3ZA 2CU1A 4M0WB 3J9CA 4AS1A 4MM3A 4F8CB 3P1MA 4Q2JA 4KZCA 5G55A 2BT6A 1VZ7A 1OEYA 4TUUA 2H89B 2IJ0A 4KSKC 2L1AA 3PVLA 1C9FA 2LVOA 4II2B 1KM7A 1LQBA 2Y5PA 4IWPA 3GP7A 3PLVA 1N5WA 3B2FA 1WMHB 1VZ8A 3SDLC 1C1YB 2BS4B 3ZJVA 3VTUA 1TS2A 2INCC 4OVUA 4HVBA 1SBBB 1C4CA 3W2DA 2KANA 3TBLD 2DYOA 3MJWA 5JHAA 2GBMA 4LCDE 3LYYA 4HKZE 4IKGA 1PUTA 1J7BA 2X8XX 2FUG1 4I6PA 3P4PB 2MSED 3NVVA 2LVPA 1I7HA 3SFDB 5EDSA 1QILA 1QLBB 3W1SC 2IYDB 1A70A 3DCGA 2IY0B 2JX5A 2JWUA 3QAQA 2N7DA 2D3BA 1WJNA 2PPHA 2W3SA 1QF6A 4MGYE 1XLNA 1TTNA 3A1QA 1I4XA 4RMAA 3MP9A 4US8A 4HJKA 2LVQA 2LWPA 4OHJA 1OQQA 3PGEA 2WU2B 1VLBA 4YXDB 1JROA 5DPSA 1IGCA 3DOWA 2C9WB 2J0KA 3PS6A 2G1EA 2PVOD 2ACZB 1GPXA 1UBQA 2UYZB 5IOIA 1TS5A 1T5XD 1KRHA 1L7YA 2BW2A 3V61A 1EF5A 2WXIA 2QEJC 3NVWA 2IO2B 4WAAA 1K52A 2JPHA 1HQRD 3N20C 1GG3A 3P42A 1J19A 1F2RC 2ZPNA 2BGFA 1V97A 3EA6A 5G2NA 2ZEQA 3JW0X 2RD0A 1V6EA 5LLIA 4HROA 2K8BA 3JSVB 4XWWA 3ECIA 3BINA 1FCCC 1V9JA 3GZNI 2JRHA 3CF6E 4R3DA 3R3MA 3AI5A 3W9CB 4BAXA 1AWDA 1UH6A 1M4VA 2LRWA 2IZVB 1TY0A 1YOVB 2HDEA 4DDID 4ARIA 1ZUD2 5IN7A 1OQRA 2JU6X 4TMAB 2V4LA 1FFUA 1EU3A 2WXOA 3CSTA 3VRBB 3FILB 2L00B 2M0AA 4US9A 1JWSD 2ZVNA 4WH4A 4A3OA 1P7EA 2KLCA 1WSPA 4GDLB 4LJOB 4KGSA 2G3QB 3A9JA 2DHZA 5FKAC 4LDTB 1WI0A 2ZW0A 1E0ZA 2KXJA 3AXCA 4RF1A 4KVGB 2B76B 1EO6A 2K0PA 3RMKC 4FA6A 1TGZB 1K50A 3AEDB 2UWQA 2N9KA 3PREA 2Q5WD 2HJ8A 3AB5A 1I4QA 3H7PA 2JSVX 2PIAA 1ZXIA 2BS2B 1C76A 1LM8B 4KDIC 1J8CA 3ZUNA 3WA0A 2WXQA 3HM3A 4TQ1A 2DAFA 1FM0D 3L0WB 1J0GA 1UUPA 2RMMA 2AL3A 2KQSA 1QZEA 3B08A 4KSLC 4ANWA 2DYMA 3RUIB 3KYDD 1XD3B 5G5GA 2KVRA 1GC7A 4A6QA 3UQAA 2KFKA 1XO3A 4LNNA 1L4DB 4XDCA 2KX3A 1C79A 4FJVB 4G3XB 1YQ3B 1NI2A 4J6IA 3JVZX 1FIQA 4ZYNA 1BMLC 4ZOHC 3ENEA 2JF5A 3PV1A 1IYFA 3T3OA 2KKCA 2YLMA 5CX3A 1D6EC 4RFBA 5TSSA 2D07B 3A33B 4YTMB 1XF5L 3APDA 1WYGA 4NZLB 4BBNF 1AARA 2WXLA 1MI0A 4JQWC 4OZAA 2XN9C 3HHMA 3ML9A 1PQSA 1E7PB 3P2BA 3U52E 4RGNA 1V8CA 2M8SA 4ANUA 2JUOA 2KT7A 3PRPB 4P1BC 3V60A 4LTUA 2WX0A 4FHKA 3L13A 1R7SA 2MHJA 3AM9A 3V62A 4WJPA 2IPKD 4REZA 2N7EA 4DXAB 3AN1A 1WRIA 4ZRPA 2MJ3A 2LGDA 2N9LA 2YVCA 4B95A 2IBIB 1ZDVA 2LGXA 1AYFA 4NJ6A 2BWES 1KH0A 4FN2A 4A9AA 4B0MA 1FPYA 3VUXA 3A9KA 1OEYJ 2GBNA 2MLBA 3Q3NC 3IVFA 1ISNA 2FCSA 5AUIA 3HVDA 2IGHA 4TV3A 1WGRA 4P1CC 3E9SA 1KLUD 3ETRA 1UWMA 3FKYA 4NQKE 3NJTA 1QOBA 5BYQA 3P4QB 4OZBA 3VR9B 1SIJA 2EELA 2AYOB 4LNIA 3SEBA 2CJOA 2BWFA 4GB9A 2O6VB 4HRSA 1T0SC 1C4AA 4TQ0A 1WRDB 2EKEC 2L05A 2WDTB 3I63C 1OGWA 4K3CA 1YD8U 1WF9A 3KYCD 4OZCA 4JIOU 4QAYA 3X0WA 1NBFC 3NVZA 5HI1A 4HJGE 4HLEA 3ALBA 1HZ5A 4XC2A 3VXWA 1YN3A 3BVZA 1K51A 2ZZPB 3ZXRA 1TBEA 1WGGA 1CQVA 3DBRI 1DOIA 2D5GA 4II3B 1F77A 3QCAA 1SE2A 4JWSC 4DHJD 4EFOA 1CMXB 4TSSA 1ET9A 3JYUA 1UGMA 4IDIA 1KLVA 4G0NB 2YEPF 4LNKA 2L8JA 2KOXA 2V3PA 5DPRA 2MJDA 2RDHA 1J7CA 4DWFA 4GSWA 3OG5A 5HHDG 1N6ZA 1WY8A 2G45B 2NMQA 2W55A 2MCNB 3TJPA 1Q10A 3LB8C 1FNVA 2WWZA 3DVGX 1XXGA 1EM7A 4GN1A 3NUHB 1WJUA 1UWXA 3Q69A 3VVWB 3RPFC 4ANVA 4L1BA 2IO0B 4RM8A 2D2QA 4KIKB 2CJNA 4XX5A 2JZ3B 4MACA 4L23A 2V0GA 4E3CA 4FLHA 1DGJA 2JRIB 5D3IB 2B3AA 1JRUA 3KUCB 3VHTC 4GXBA 2WX1A 1ZGUB 5LNK1 2JT4B 1R4NI 4AJYB 2FIFA 4ASWC 2RPVA 4GIVA 3GE8C 3DVNU 1T0QC 2MQJA 4FULA 4GDKB 4KX6B 1N62A 2LI5A 4KV2A 3QC8B 3GB1A 3LDZE 1JWMD 5D94A 4FADA 2FUHB 5CTRC 3MC0B 1H4RA 2ZCBA 3PZ7A 4KDLB 1F52A 3MC8A 1E8YA 4M8MA 3MTNB 1GB1A 2KAJA 3L54A 2ASQA 1SSNA 2NCNA 1E9MA 4A8XC 1ZOYB 4WQMA 1ZP0B 2GRIA 3QX1A 4DXFA 1SB3C 5KHQA 2KJHB 4C56C 2BPSA 3KUDB 1FXTB 5J18A 4MJSB 1VCBA 4NPNA 1EU4A 3RZWC 3HIZA 4EEWA 5IKCM 3NS1A 2MH7A 4W9CA 4DDGD 4IUMB 1QOGA 2J7QB 2MWSB 3IAS1 3VQIA 3IHPC 2Z59B 4HKQA 1Z2MA 1WE6A 1JWAD 1RYJA 5H92C 2WU5B 1XLQA 3AE8B 3ZTCA 3WAMA 5AZFA 5EE9A 2AX5A 4M0WA 2WNMA 4YL8A 4HXDA 3IBEA 5IAAC 1I4PA 2NVUI 3UINB 4L2YA 2PE9A 1P98A 1I4RA 1FXIA 2KNBA 1JWUD 2GBKA 2OJWA 1V1OA 1T6BX 3RN9C 2NBWB 2EMSA 2BYTA 2WXMA 2XK5B 3LJ3A 1OTRB 2N7JA 1WMHA 3U2SC 1V5TA 1VJKA 1ET6A 3ZIMA 2M4NA 4M02A 2PW9A 2JY6A 4BVUC 1LXDA 4IWQA 2J52A 2NTTA 1D4BA 4AJWA 2MP2B 3RNCC 3IG3A 3AE4B 4GLSC 2D3AA 4W9EA 1WXMA 4PYZA 1UELA 3M62B 2OJRA 5JZEB 2D3GA 1MG8A 2KTFA 1KLGD 1D5XC 4WWPA 2IDYA 2I1JA 2WHIA 3IT6B 4ITKA 2KN5A 3EFCA 1QOAA 3AEBB 3ZJTA 3ZKJC 2QSDA 1E8WA 3E56A 2QIEB 4WWOA 3ZGZA 4A55A 1V49A 1TIFA 3ZDTA 1HXYD 3B1LX 3Q3JA 1MVKA 1KOTA 4C7ZA 3T8MA 2BQQA 1E90A 1H8CA 1I4HA 4HCPB 3MHZA 2Y5BB 3ZO5B 1SE4A 3GOEA 3Q8AA 2J42A 3GZNB 2WXFA 3JSVA 3BYYB 3RT3B 2KWVB 4MELA 1WR1A 3I9V1 2N9XA 4WJOA 1C4PA 1B1ZA 2QMTA 3Q2AC 2DBYA 4RNAA 1IBXB 4OVZA 1NEKB 1EWYC 2CHWA 4M00A 3BYTB 4RGOS 4ARCA 4GGQA 3N32A 4E71A 1PFDA 2KLGA 3ABVB 5BO4B 3FILA 3QQ8B 4DHZB 1NYRA 2W9NA 1UNSA 2DZMA 4S0RA 5L83A 1WJ4A 3EUB2 4GDLA 4P16A 3O65B 4C4VB 4AOFA 4OW0A 4D2KA 4ZHPA 2L0TA 5AEKB 1XCTL 3BK1A 3Q8BA 4IC7B 2XEWA 2J53A 5BMIA 1NDDA 4GOCA 5GMVA 1WM2A 2K6DB 4RF0A 3TEZA 2MBQA 2GI9A 2INDC 2G4SA 2G9HD 3AE1B 1B9RA 2AEHA 3ZTDA 1CJEA 3HK0A 1JMLA 4FXCA 1TKGA 3PPAA 4MH0E 1N5XA 3NS8A 4GMVA 1U4AA 1WM3A 3AE9B 2K3UA 2ON8A 1P3QU 1L6UA 1ZPSA 3VFKA 3NHEB 4B9KA 3TUOA 2DWQA 1LGRA 4HPMB 2PEAA 4EE2A 2CS4A 4JGHB 1I42A 3TIXA 1T0YA 2KDMA 3KW5B 2E6XA 1P0RA 3V3XA 1GJZA 4W9DA 4WQOB 3KVFB 3ZLZA 3ML8A 1BXTA 4W9HA 3C0RB 1ESFA 2DZKA 3R2IA 3RD2A 1UF0A 2IGDA 1SXTA 4HPPA 4N6EB 2D11A 3H6NA 4JWUC 1XCQL 4KKJA 3V6EB 2O6VD 3HUIA 5D2MB 4USAA 5E6PA 3ZRFA 4OVVA 1RLFA 3ZW3A 1JQ4A 4TKNA 1GC6A 1MFWA 1TY2A 1ROEA 3HM6X 1XQQA 2KQ4X 4AUQC 3ONSA 4AWJA 2ZW1A 4B0EA 1HE8A 1WGHA 1AW7A 3H1UA 3Q6BA 2RDBC 4K7WA 1E7VA 3DBLB 2FNJB 3TL5A 5JH5C 1ZXHA 2GBJA 4KGRA 3NZSA 2K5PA 2MRPA 4GU2A 1E8XA 3URYA 3AV8A 2WP9B 4DQOC 2HTHA 5JHBA 2D3CA 2Y5CA 3KH0A 2JVCA 3K9PB 2HE7A 3TEXA 2CHXA 2WDQB 4LNFA 3ZYYX 1WXQA 1L0VB 4K7UA 4IG7B 4X57B 4DXGA 1NVID 1TZ1A 1YJIA 1T0RC 1V1PB 3N1YC 5IP4D 1YQBA 3S2AA 2O6VA 3KWLA 1FRDA 4EZLA 2VZKB 2DENB 3WANA 1WXSA 1BT0A 2LJ5A 5G5HA 2A4ZA 3UIOB 2LMCA 3FC4A 2K6QA 1R4MB 3L4PA 3PZDA 4XWTA 2BTEA 1HTOA 3DBRB 3CIRB 2LRUA 3M3JA 4MH8A 3VTVA 3SU8X 2JZPA 4JE3B 3VAWA 1TS3A 1FEHA 4O1NA 4FHJA 2WLBA 2BYEA 2C7MB 5MPOA 3R7QA 1FCLA 1IP9A 2N9EB 1E7UA 2DX5B 3AH7A 3VUWA 4ICVA 2D10A 4BBNC 1WYWB 1YN5A 3L17A 2KD0A 2WGSA 1PGAA 1KF6B 2KWDA 4MSQB 3DVNV 1EWCA 3QIJA 3W1SA 2VRRB 3L08A 3OWEB 2N0SB 3ZQ4A 4HEA1 1GOZA 1WXVA 1YIWA 3OLMD 3KLSX 5KHOA 3R8BA 3WAPA 3APFA 4P7IA 2L3ZA 3APCA 5E6OA 1L5PA 1S3SG 1VDVA 5CHWA 3WAOA 4KIKA 1UBIA 1QQRA 1E8ZA 2KTRB 2OHFA 5I4DA 1Z5SB 3DBHI 4IM3A 5AUKA 5DPWA 5C1ZA 2L83A 1WX9A 4H2AA 4K3BA 5HFYA 2KMCA 1PGBA 1FXAA 4K1RB 3DWMA 5E6NA 3VTWA 4GDKA 2KHWB 2LZ6A 1Q0WB 3M95A 3LXFA 2KMAA 3X23A 1DOXA 4MEMA 3ZVVA 1L4ZB 1A5RA 1J7AA
chains in the Genus database with same CATH topology
4XWWA 2PW9A 1FCCC 4WIPA 2J52A 4R3DA 2NTTA 3AE7B 3W9CB 2LJIA 2GB1A 1D4BA 1AWDA 2K22A 2HTME 1M4VA 4XE0A 5HG2A 2LUMA 1ACCA 1TY0A 1YQ4B 4RH6A 2HDEA 3AE4B 4ARIA 4GLSC 2WXNA 1SF0A 1ZUD2 5FK9C 4YSYB 1OQRA 2JU6X 4TMAB 3IT4B 1FFUA 1EU3A 2WXOA 3VRBB 1P7FA 3FILB 3C8YA 2LHEA 2M0AA 2M19A 4US9A 1JWSD 4WH4A 1KLGD 1D5XC 1P7EA 2IDYA 1WSPA 3IT6B 4ITKA 3SFEB 4GDLB 1MPEA 2JXTA 4KGSA 2INNE 1QOAA 3AEBB 2R61A 4YTPB 3AE2B 5FKAC 4N58A 1UGJA 2EKIA 4YSZB 3ZJTA 2ZW0A 4IOIE 1TJEA 1TS4A 2QSDA 4LK0M 3E56A 1E0ZA 2TSSA 4RF1A 2QILA 2QIEB 2B76B 2K0PA 4A55A 3ZGZA 1WWTA 3IXSA 1HXYD 2KACA 1K50A 3AE5B 2WXJA 3AEDB 2N9KA 2Q5WD 1MVKA 1LO5D 2FE8A 4C7ZA 3AB5A 1I4QA 2JSVX 1MHXA 1ENFA 2PIAA 1ZXIA 2BS2B 1QT9A 2I38A 2MJEA 3TEYA 1C76A 1I4HA 1ZDXA 3MHZA 1NI3A 1SE4A 2PVGC 2WXQA 4RCOA 3Q8AA 2J42A 4TQ1A 1FM0D 3AECB 3MFGA 2WXRA 1UUPA 2RMMA 2WXFA 4PT5A 5T8IA 3BYYB 1T3QA 5BMHA 5BMGA 2DYMA 2WXPA 5G5GA 1GB4A 5EE3A 1VZ6A 2L52A 2Y3AA 2Z8LA 4A6QA 3I9V1 3V05A 3B2GA 1XO3A 1L4DB 1C4PA 1B1ZA 2QMTA 2OEDA 4XDCA 3MJ5A 1C79A 1HA5A 2DBYA 4RNAA 3U7ZA 3P4RB 1YQ3B 2JYTA 1HZ6A 1F2RI 5FR3A 1IBXB 4OVZA 1NYQA 2W54A 1NEKB 1EWYC 4JX1C 2L32A 3O13A 1FIQA 3BYTB 4RGOS 1BMLC 4ARCA 1PFDA 3ABVB 3AEFB 3VR8B 1K53A 3FILA 4ZOHC 1NYRA 1CK1A 2ONQA 2AQ2B 1UNSA 1FNUA 1JW9D 3T3NA 3T3OA 2LEKA 2PTLA 1D6EC 4RFBA 3EUB2 5TSSA 1L6VA 2NTSA 2KN4A 3EGRA 4P16A 4YTMB 1XF5L 4D2KA 4OW0A 4ZHPA 1WYGA 4NZLB 2WXKA 2WXLA 1MI0A 1XCTL 3AMZA 1Y56A 1STEA 4OZAA 3BK1A 3Q8BA 1SE3A 2XN9C 1CZPA 3AE3B 3HRDD 1E7PB 3U52E 4RGNA 2J53A 1QKZA 1V8CA 5BMIA 2LHDA 4CQNA 2E3TA 2WDVB 1KTKA 1TZOA 4LTUA 1JCKB 1JALA 1YMHE 4KGTA 1F0ZA 3KWVA 4RF0A 3W5VB 1R7SA 2X38A 3TEZA 3AM9A 2IPKD 2GI9A 3W5UB 4REZA 1VRAB 3AN1A 1WRIA 3BZDB 4ZRPA 2G9HD 1D5MC 2PMVA 2WDRB 2MJ3A 3AE1B 2N9LA 3NRZA 1B9RA 3U4EG 1CJEA 4ZHOA 1ZDVA 1JMLA 4FXCA 1TKGA 2M56B 2V3NA 1AYFA 1KH0A 4A9AA 4B0MA 1XEEA 1N5XA 5EE0A 2J58A 3AE9B 2K3UA 2ON8A 1ZPSA 1IUEA 1L6UA 4NAWB 4C7YA 3ZJUA 2W82A 3TUOA 3DWGC 1ZE3D 5AUIA 1FD6A 3BVMA 3HVDA 1XLOA 2IGHA 3IAM1 5D3DA 2DWQA 4EE2A 3E9SA 1KLUD 3AEEB 3ETRA 1UWMA 1QOBA 5BYQA 2V4IB 2KDMA 2E6XA 3P4QB 2AQ3B 5E6JA 1IBXA 2BBCA 4OZBA 3V3XA 3VR9B 1SIJA 1XLPA 3HVZA 2EELA 3NZ3A 2W8HA 3SEBA 2CJOA 2SAKA 1BXTA 1JWBD 4HRSA 2W3RA 4YT0B 1C4AA 4TQ0A 1ESFA 4A90A 2LFIA 3BIID 3R2IA 4MM3B 1AN8A 3AE6B 1RFKA 2JQRB 2IGDA 1SXTA 5JXVA 4N6EB 4JWUC 1XCQL 1N60A 1WGKA 4KKJA 3CWIA 1C77A 1E6EB 2I2YA 3HUIA 2QJLA 4WURA 1YNTE 4OZCA 4USAA 1JQ4A 1JRPA 3VRAB 1DYQA 3NVZA 5HI1A 4HJGE 5EE1A 4NAMA 1TY2A 1ROEA 2INPE 3FAHA 4ZYSA 2KQ4X 1HZ5A 1YN3A 2ZW1A 3BVZA 4B0EA 1K51A 4YWGG 4AQ7A 1AW7A 4N59A 2SEBD 1CQVA 1DOIA 2D5GA 1N61A 2XNAC 2W8IA 1F77A 4C80A 1FO4A 1SE2A 4JWSC 2PKOA 1ZXHA 4TSSA 1ET9A 4IDIA 4J3OD 4KGRA 1DOYA 3NVYA 1FNWA 3P4SB 2YEPF 5BYRA 2K5PA 1RWSA 3URYA 4JPSA 1IGDA 1NENB 3N9YC 1E10A 1OFFA 2V3PA 3AV8A 1RM6C 2MJDA 4YTNB 2WQYB 3TEWA 2RDHA 1J7CA 2WP9B 5HHDG 1FMAD 4NJCA 4DQOC 2NMQA 5BYSA 4UDUC 4KKIA 2RDGA 3Q8FA 2JYEA 2W55A 3SR6A 2Y5CA 1I4GA 4XDDA 1Q10A 5GXGB 1PYWD 1SEBD 3B9JA 3LB8C 3TEXA 1GAQB 1FNVA 2WDQB 1PGXA 3ZYYX 1XXGA 1WXQA 1EM7A 3AEAB 2J4XA 3NUHB 1FRRA 1L0VB 5C2TB 4LLGM 1FFVA 3BWUD 1UWXA 1D5ZC 1VR9A 3Q69A 3RPFC 3KQ4A 1L0YB 4DXGA 1NVID 1YJIA 2IGGA 4ZRQA 4L1BA 3TSSA 2BB6A 1V1PB 2CJNA 1KFYB 2DLBA 4RGTA 3KWLA 4MACA 4L23A 2V0GA 1FRDA 2VZKB 3J9CA 4AS1A 1DGJA 3Q8EA 5D3IB 3P1MA 4Q2JA 2LGIA 5LNK1 2BT6A 5G5HA 1VZ7A 4YSXB 2H89B 2IJ0A 2RPVA 3UI3A 2L1AA 2VZKD 4WWMA 1C9FA 1MHHE 2LMCA 3FC4A 2WXGA 3L4PA 1SJHD 4XWTA 4GDKB 2BTEA 4KX6B 2AQ1B 1N62A 1TKYA 3RFZB 2Y5PA 3GB1A 3GP7A 1JWMD 3CIRB 1N63A 4MH8A 1N5WA 2JZPA 3B2FA 4JE3B 1TS3A 2ICIA 1VZ8A 1FEHA 3MC0B 3PZ7A 4O1NA 1PDXA 2BS4B 3Q8CA 2WLBA 3ZJVA 1GB1A 1TS2A 3PO0A 1BUIC 2KAJA 5MPOA 1SSNA 3H8HA 1SBBB 1C4CA 1E9MA 3W2DA 3I57A 1FCLA 4A8XC 1ZOYB 2DYOA 4WQMA 3LYYA 1ZP0B 2FBWB 2GRIA 4HKZE 4IKGA 3AH7A 1PUTA 1YJJA 1J7BA 2FUG1 4MT5A 1TKEA 3PZ8A 1YN4A 3P4PB 1SB3C 4DXFA 3NVVA 1TYGB 1YN5A 4C56C 2H88B 1I7HA 4WAFA 3SFDB 1QILA 1QLBB 1PGAA 3AEGB 1A70A 2WXHA 1KF6B 2KWDA 2JX5A 2MEKA 2JWUA 5C3JB 1EWCA 3W1SA 1EU4A 1QOFA 3OWEB 2W3SA 1QF6A 2CU3A 2N0SB 1XLNA 3ZQ4A 4HEA1 1HEZE 1I4XA 1GOZA 2MH7A 3MP9A 3NS1A 3R8BA 3KLSX 4US8A 2PLPA 1QOGA 3IAS1 4OHJA 2BB5A 3VQIA 1OQQA 2WU2B 4HKQA 1VLBA 1L5PA 2WS3B 4YXDB 1JWAD 1RYJA 5H92C 1JROA 3P63A 1IGCA 2WU5B 1VDVA 3R2TA 1XLQA 3AE8B 2YEPB 1V1PA 1QQRA 2K9XA 2G1EA 3BK2A 2OHFA 2PVOD 2ACZB 5EE9A 1GPXA 2AX5A 4M0WA 3GS2A 5I4DA 2WNMA 5AUKA 1TS5A 2L83A 5D7GA 1T5XD 4RGMA 1KRHA 4H2AA 2BW2A 1I4PA 2WXIA 2QEJC 3NVWA 4L2YA 2BS3B 5HFYA 1PGBA 1FXAA 1FXIA 1I4RA 1C78A 1K52A 1SJED 3BVGA 1JWUD 2KMMA 3WCQA 1HQRD 3DWMA 1V1OA 1T6BX 3P42A 5H8YE 1F2RC 4P6VF 2BYTA 2WXMA 3LXFA 1V97A 2N7JA 3EA6A 1L0XB 3U2SC 1DOXA 1VJKA 1L4ZB 1J7AA 4HROA 1ET6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P42 A;  2W8H A;  2W8I A;  2J58 A; 
#chains in the Genus database with same CATH topology
 3QK0 A;  3RI7 C;  4IW0 A;  5LXI B;  3AE7 B;  3QAR A;  1WFY A;  4KZ0 A;  2HTM E;  3T9L A;  3ZNI D;  4HK2 A;  1YQ4 B;  3Q3F A;  2WXN A;  2M0X A;  2CR5 A;  1SF0 A;  5FK9 C;  2LD9 A;  2DNF A;  4MJS A;  3GE3 C;  3K9O B;  2KK8 A;  1P7F A;  3RNA C;  3NG0 A;  2M19 A;  1V80 A;  3ZRC A;  3RNB C;  4HDO A;  1EUV B;  2FCM A;  1V2Y A;  3SFE B;  1MPE A;  3VUY A;  2KO3 A;  1WE7 A;  4MGI E;  2R61 A;  4PS7 A;  3AE2 B;  3PRM B;  4N58 A;  1UGJ A;  2EKI A;  4YSZ B;  1TJE A;  1TS4 A;  1WZ3 A;  4LK0 M;  2TSS A;  2QIL A;  1V81 A;  4W9F A;  3IXS A;  4HWI B;  3OJ4 B;  2DYB A;  4EZJ A;  2DZI A;  3BY4 B;  2NR2 A;  4N9F 4;  5J17 A;  2L7R A;  2R2O A;  1I35 A;  1MHX A;  1ENF A;  2ZCC A;  2I38 A;  3TEY A;  2XK5 A;  2M1M A;  2KJ6 A;  1UD7 A;  4RCO A;  2REX A;  3U30 A;  3AEC B;  4BZA A;  5T8I A;  2WXP A;  1GB4 A;  4CHK A;  4HCN B;  2L52 A;  2Y3A A;  3N3K B;  2MBO A;  1E5W A;  2MP2 A;  3U7Z A;  1F2R I;  5D6J B;  5FR3 A;  2W54 A;  3KUZ A;  4JX1 C;  2L32 A;  3O13 A;  1V86 A;  3AEF B;  2A5U A;  3VH3 B;  2LXA A;  2KZR A;  4ANX A;  2ONQ A;  1FNU A;  3T3N A;  2NPT B;  4ZDV A;  3QWZ B;  2LEK A;  4F7Z A;  3AU5 A;  1WGD A;  1L6V A;  2C7H A;  2KN4 A;  1RRB A;  3EGR A;  4W9K A;  5DCN A;  1Y56 A;  2KC1 A;  1SE3 A;  2KYW A;  5HKH A;  3QJZ A;  1CZP A;  2WYQ A;  4XGA B;  3IFW B;  1L2N A;  4BKS A;  4S17 A;  4WJN A;  2QC8 A;  2E3T A;  1KTK A;  1TZO A;  2RPQ A;  1WJ6 A;  4F1S A;  1JCK B;  1JAL A;  1YMH E;  1F0Z A;  2L76 A;  2GLS A;  4EUT A;  2X38 A;  1OQY A;  4EKU A;  1VRA B;  3BZD B;  3L16 A;  1D5M C;  2DAJ A;  2PMV A;  3U4E G;  3R66 C;  4URK A;  2M56 B;  2V3N A;  3QHT A;  2PJH A;  4I6N B;  1XEE A;  4MSM B;  3NY5 A;  2BKF A;  2NBU A;  1IUE A;  4C7Y A;  4NAW B;  3TMP B;  2W82 A;  2ZNV C;  1YX5 B;  4NJ7 A;  1ZE3 D;  1FD6 A;  2KVZ A;  3IAM 1;  2O2V B;  2KWU B;  3Q3O C;  3UQB A;  2JZZ A;  4LDT D;  3UF8 A;  4M8N A;  2FCN A;  3Q14 C;  2V4I B;  5E6J A;  4CYE A;  1IBX A;  1XLP A;  3HVZ A;  3NZ3 A;  4BKT A;  3RNE C;  2AWT A;  3DHI C;  2SAK A;  3H7S A;  3DBS A;  2W3R A;  4YT0 B;  4IWO A;  1X1M A;  4A90 A;  2LFI A;  1K8R B;  3ZNG C;  4MM3 B;  3AE6 B;  1RFK A;  3Q3M C;  2KFJ A;  1Y8R C;  5JXV A;  1C77 A;  1E6E B;  2I2Y A;  2GBR A;  2QJL A;  1YNT E;  4C4V A;  1JRP A;  3VRA B;  1DYQ A;  3RZF A;  4RM9 A;  2INP E;  3FAH A;  2K39 A;  4ZYS A;  4C00 A;  2KC2 A;  3B0A A;  4A3P A;  2LGY A;  4W9G A;  2M17 A;  1N61 A;  2XNA C;  2N4F A;  1SIF A;  2W8I A;  4C80 A;  1FO4 A;  3W1Y A;  4FJY A;  2FAZ A;  2KWC A;  2BYV E;  2K1F A;  4BFR A;  2N1V A;  3NVY A;  1FNW A;  1DOY A;  3P4S B;  5BYR A;  1E10 A;  3PLU A;  2WQY B;  2IY1 B;  2FID A;  2VH1 A;  4UDU C;  1VD2 A;  2RDG A;  3VH4 B;  5L95 C;  1I4G A;  4XDD A;  2LAS A;  2Z0D B;  5GXG B;  3B9J A;  1SEB D;  1GAQ B;  4DBG A;  2RGF A;  4MGK E;  3A1Q B;  1FRR A;  5C2T B;  1FFV A;  1WIA A;  3BWU D;  1D5Z C;  1VR9 A;  2KX0 A;  2J0M A;  3KQ4 A;  3SD5 A;  1F1H A;  4ZRQ A;  5FR6 A;  2QDF A;  3PRZ A;  2OOB B;  1P9D U;  2BB6 A;  4PK1 A;  1WGY A;  2DLB A;  4RGT A;  2ZJD A;  4PYU A;  3Q8E A;  2LGI A;  3N1Z C;  4YSX B;  3PT2 B;  3UI3 A;  2VZK D;  4K7S A;  4WWM A;  1MHH E;  4MGZ E;  2WXG A;  1SJH D;  2AQ1 B;  1TKY A;  3RFZ B;  3PTF C;  3RCZ A;  2I1K A;  3V6C B;  2BKR B;  2GMI C;  1N63 A;  2LUE A;  2ICI A;  2BYF A;  2L0F A;  1PDX A;  2MX2 A;  3DPD A;  3RUL A;  3Q8C A;  4EOY A;  3PO0 A;  1BUI C;  2K8H A;  4JL9 A;  3H8H A;  3WIM A;  3I57 A;  1Q1O A;  1UZX B;  2J0J A;  2AL6 A;  1G6J A;  3C19 A;  5CHV C;  2FBW B;  2RR9 A;  1WXA A;  4M01 A;  1YJJ A;  4MT5 A;  1TKE A;  3PZ8 A;  1YN4 A;  1TT5 B;  4PS3 A;  1TYG B;  5IA7 A;  2H88 B;  3L10 B;  4WAF A;  3DVG Y;  3AEG B;  2WXH A;  3A4S C;  2MEK A;  5C3J B;  1QOF A;  1LFD A;  2EMT A;  3MC9 A;  3DHG C;  5C23 A;  2CU3 A;  2KDE B;  2C5L C;  1HEZ E;  2PLP A;  2BB5 A;  2KJR A;  1ZW7 A;  2WS3 B;  3P63 A;  1F9J A;  3A9J B;  3R2T A;  2YEP B;  1V1P A;  2K9X A;  3BK2 A;  3H9D A;  5TR5 A;  3GS2 A;  4BKG A;  5D7G A;  3D32 A;  4RGM A;  2VH2 A;  1WH3 A;  4ZRI A;  2BS3 B;  1SJE D;  1Q5W B;  1C78 A;  3BVG A;  2KMM A;  3H7P B;  3WCQ A;  2G4D B;  3I3T B;  5H8Y E;  4G50 A;  4P6V F;  3N30 A;  1V5O A;  4HDQ A;  2NBV B;  2UU7 A;  1L0X B;  4A20 A;  4W9L A;  1S1Q B;  4B6W A;  4G11 A;  4WIP A;  3M63 B;  4MDK E;  4IM0 A;  4XZ4 A;  2CKH B;  2LJI A;  2GB1 A;  2QCZ A;  2K22 A;  4XE0 A;  2KFK B;  5HG2 A;  2LUM A;  1ACC A;  2XBB C;  4RH6 A;  3RNF C;  4YSY B;  4NQL B;  3IT4 B;  3DBL I;  1KJT A;  3C8Y A;  2LHE A;  1C3T A;  1GNU A;  2IO3 B;  4XYC A;  1SGH A;  5CHF A;  2JWZ A;  2JXT A;  5AZH A;  2INN E;  4YTP B;  3EFU A;  3DBH B;  2R2Q A;  4IOI E;  1YX6 B;  2KTR A;  2RSU A;  2MBB B;  3SHQ A;  1WWT A;  4BOZ B;  2KAC A;  2K8C A;  3AE5 B;  2K25 A;  2WXJ A;  4ICU A;  2BVC A;  2HD5 B;  2V3S A;  1LO5 D;  2FE8 A;  2KDI A;  4ZRJ A;  1QT9 A;  2FCQ A;  2MJE A;  1ZDX A;  3RNG C;  4ACF A;  1NI3 A;  3UGB B;  2MBH A;  2PVG C;  3MFG A;  2WXR A;  1HTQ A;  5J2R A;  2N9P C;  4PT5 A;  1T3Q A;  3A9K B;  5BMH A;  4WWN A;  2PE6 B;  5BMG A;  2N1W A;  3DDC B;  2ZVO A;  5EE3 A;  1VZ6 A;  3AUL A;  1ZKH A;  3CSF A;  3PHW B;  2Z8L A;  1R4M I;  3V05 A;  1MJD A;  1R4N B;  2ZNV B;  3B2G A;  2OED A;  3MJ5 A;  1HA5 A;  3RYT A;  4FBJ B;  3P4R B;  2JYT A;  1XT9 B;  1HZ6 A;  1NYQ A;  1WX8 A;  2V9H A;  3ZXV A;  3VR8 B;  1K53 A;  1CK1 A;  2AQ2 B;  1JW9 D;  1EF1 A;  2PTL A;  1P1A A;  2NTS A;  3UIP B;  3DHH C;  4E74 A;  2WXK A;  3AMZ A;  1STE A;  3A4R A;  1WZ0 A;  3AE3 B;  3HRD D;  1QKZ A;  2MW5 A;  4K81 A;  2LHD A;  4CQN A;  2WDV B;  4WJQ A;  2KDF B;  4KGT A;  3KWV A;  3W5V B;  3PSE B;  4ZRK A;  3W5U B;  3CMM B;  1RAX A;  3I5J C;  3DQV A;  2WDR B;  3NRZ A;  2HJ1 A;  4ZHO A;  4JLC A;  4LJP B;  4NY0 A;  2DZJ A;  4HPL B;  5DPT A;  2ZPY A;  3QA8 A;  5EE0 A;  2J58 A;  3EEC A;  4DK5 A;  4AP4 C;  3ZJU A;  3R7R A;  4PS8 A;  3DWG C;  3BVM A;  1XLO A;  3TCA A;  5D3D A;  2MA9 B;  2BF8 B;  3AEE B;  1RFA A;  4CO7 A;  2KDB A;  2AQ3 B;  4BKS D;  2BBC A;  5AZG A;  1MG4 A;  2LXC A;  2W8H A;  2V1Y A;  2CHZ A;  1JWB D;  3NOB A;  3WAL A;  3ZNH B;  3BII D;  1AN8 A;  1M94 A;  2JQR B;  3EC8 A;  2NPT A;  1N60 A;  1WGK A;  3CWI A;  5IO9 A;  4WUR A;  3EHV A;  3ZNZ B;  5EE1 A;  4NAM A;  1WR6 E;  2QHO A;  3VDZ A;  3U7D A;  4YWG G;  4DHJ B;  4AQ7 A;  4N59 A;  2SEB D;  1WX7 A;  2Z0E B;  4FJZ A;  2JXX A;  3ZDM C;  4EZK A;  2LGS A;  5LXH A;  2PKO A;  4J3O D;  4W9J A;  4IM2 A;  2GOW A;  1RWS A;  4JPS A;  3OJ3 A;  1IGD A;  4DHZ E;  1NEN B;  3N9Y C;  1OFF A;  3NZU A;  1RM6 C;  4YTN B;  3TEW A;  3AU4 A;  3N1X C;  1FMA D;  3MHS D;  4NJC A;  5BYS A;  4KKI A;  3Q8F A;  2JYE A;  2MBE A;  2NS5 A;  3SR6 A;  4NAW A;  1SE9 A;  1PYW D;  4NNJ B;  1PGX A;  3OAW A;  3AEA B;  2J4X A;  2O2V A;  4BOS C;  4LLG M;  2KQ7 A;  4LNO A;  1GUA B;  2C7N B;  2IO1 B;  1L0Y B;  2IGG A;  3U8Z A;  4I6L B;  1IPG A;  3PHX B;  3TSS A;  4W9I A;  1KFY B;  2C60 A;  1YJ1 A;  1D3Z A;  2CU1 A;  4M0W B;  3J9C A;  4AS1 A;  4MM3 A;  4F8C B;  3P1M A;  4Q2J A;  4KZC A;  5G55 A;  2BT6 A;  1VZ7 A;  1OEY A;  4TUU A;  2H89 B;  2IJ0 A;  4KSK C;  2L1A A;  3PVL A;  1C9F A;  2LVO A;  4II2 B;  1KM7 A;  1LQB A;  2Y5P A;  4IWP A;  3GP7 A;  3PLV A;  1N5W A;  3B2F A;  1WMH B;  1VZ8 A;  3SDL C;  1C1Y B;  2BS4 B;  3ZJV A;  3VTU A;  1TS2 A;  2INC C;  4OVU A;  4HVB A;  1SBB B;  1C4C A;  3W2D A;  2KAN A;  3TBL D;  2DYO A;  3MJW A;  5JHA A;  2GBM A;  4LCD E;  3LYY A;  4HKZ E;  4IKG A;  1PUT A;  1J7B A;  2X8X X;  2FUG 1;  4I6P A;  3P4P B;  2MSE D;  3NVV A;  2LVP A;  1I7H A;  3SFD B;  5EDS A;  1QIL A;  1QLB B;  3W1S C;  2IYD B;  1A70 A;  3DCG A;  2IY0 B;  2JX5 A;  2JWU A;  3QAQ A;  2N7D A;  2D3B A;  1WJN A;  2PPH A;  2W3S A;  1QF6 A;  4MGY E;  1XLN A;  1TTN A;  3A1Q A;  1I4X A;  4RMA A;  3MP9 A;  4US8 A;  4HJK A;  2LVQ A;  2LWP A;  4OHJ A;  1OQQ A;  3PGE A;  2WU2 B;  1VLB A;  4YXD B;  1JRO A;  5DPS A;  1IGC A;  3DOW A;  2C9W B;  2J0K A;  3PS6 A;  2G1E A;  2PVO D;  2ACZ B;  1GPX A;  1UBQ A;  2UYZ B;  5IOI A;  1TS5 A;  1T5X D;  1KRH A;  1L7Y A;  2BW2 A;  3V61 A;  1EF5 A;  2WXI A;  2QEJ C;  3NVW A;  2IO2 B;  4WAA A;  1K52 A;  2JPH A;  1HQR D;  3N20 C;  1GG3 A;  3P42 A;  1J19 A;  1F2R C;  2ZPN A;  2BGF A;  1V97 A;  3EA6 A;  5G2N A;  2ZEQ A;  3JW0 X;  2RD0 A;  1V6E A;  5LLI A;  4HRO A;  2K8B A;  3JSV B;  4XWW A;  3ECI A;  3BIN A;  1FCC C;  1V9J A;  3GZN I;  2JRH A;  3CF6 E;  4R3D A;  3R3M A;  3AI5 A;  3W9C B;  4BAX A;  1AWD A;  1UH6 A;  1M4V A;  2LRW A;  2IZV B;  1TY0 A;  1YOV B;  2HDE A;  4DDI D;  4ARI A;  1ZUD 2;  5IN7 A;  1OQR A;  2JU6 X;  4TMA B;  2V4L A;  1FFU A;  1EU3 A;  2WXO A;  3CST A;  3VRB B;  3FIL B;  2L00 B;  2M0A A;  4US9 A;  1JWS D;  2ZVN A;  4WH4 A;  4A3O A;  1P7E A;  2KLC A;  1WSP A;  4GDL B;  4LJO B;  4KGS A;  2G3Q B;  3A9J A;  2DHZ A;  5FKA C;  4LDT B;  1WI0 A;  2ZW0 A;  1E0Z A;  2KXJ A;  3AXC A;  4RF1 A;  4KVG B;  2B76 B;  1EO6 A;  2K0P A;  3RMK C;  4FA6 A;  1TGZ B;  1K50 A;  3AED B;  2UWQ A;  2N9K A;  3PRE A;  2Q5W D;  2HJ8 A;  3AB5 A;  1I4Q A;  3H7P A;  2JSV X;  2PIA A;  1ZXI A;  2BS2 B;  1C76 A;  1LM8 B;  4KDI C;  1J8C A;  3ZUN A;  3WA0 A;  2WXQ A;  3HM3 A;  4TQ1 A;  2DAF A;  1FM0 D;  3L0W B;  1J0G A;  1UUP A;  2RMM A;  2AL3 A;  2KQS A;  1QZE A;  3B08 A;  4KSL C;  4ANW A;  2DYM A;  3RUI B;  3KYD D;  1XD3 B;  5G5G A;  2KVR A;  1GC7 A;  4A6Q A;  3UQA A;  2KFK A;  1XO3 A;  4LNN A;  1L4D B;  4XDC A;  2KX3 A;  1C79 A;  4FJV B;  4G3X B;  1YQ3 B;  1NI2 A;  4J6I A;  3JVZ X;  1FIQ A;  4ZYN A;  1BML C;  4ZOH C;  3ENE A;  2JF5 A;  3PV1 A;  1IYF A;  3T3O A;  2KKC A;  2YLM A;  5CX3 A;  1D6E C;  4RFB A;  5TSS A;  2D07 B;  3A33 B;  4YTM B;  1XF5 L;  3APD A;  1WYG A;  4NZL B;  4BBN F;  1AAR A;  2WXL A;  1MI0 A;  4JQW C;  4OZA A;  2XN9 C;  3HHM A;  3ML9 A;  1PQS A;  1E7P B;  3P2B A;  3U52 E;  4RGN A;  1V8C A;  2M8S A;  4ANU A;  2JUO A;  2KT7 A;  3PRP B;  4P1B C;  3V60 A;  4LTU A;  2WX0 A;  4FHK A;  3L13 A;  1R7S A;  2MHJ A;  3AM9 A;  3V62 A;  4WJP A;  2IPK D;  4REZ A;  2N7E A;  4DXA B;  3AN1 A;  1WRI A;  4ZRP A;  2MJ3 A;  2LGD A;  2N9L A;  2YVC A;  4B95 A;  2IBI B;  1ZDV A;  2LGX A;  1AYF A;  4NJ6 A;  2BWE S;  1KH0 A;  4FN2 A;  4A9A A;  4B0M A;  1FPY A;  3VUX A;  3A9K A;  1OEY J;  2GBN A;  2MLB A;  3Q3N C;  3IVF A;  1ISN A;  2FCS A;  5AUI A;  3HVD A;  2IGH A;  4TV3 A;  1WGR A;  4P1C C;  3E9S A;  1KLU D;  3ETR A;  1UWM A;  3FKY A;  4NQK E;  3NJT A;  1QOB A;  5BYQ A;  3P4Q B;  4OZB A;  3VR9 B;  1SIJ A;  2EEL A;  2AYO B;  4LNI A;  3SEB A;  2CJO A;  2BWF A;  4GB9 A;  2O6V B;  4HRS A;  1T0S C;  1C4A A;  4TQ0 A;  1WRD B;  2EKE C;  2L05 A;  2WDT B;  3I63 C;  1OGW A;  4K3C A;  1YD8 U;  1WF9 A;  3KYC D;  4OZC A;  4JIO U;  4QAY A;  3X0W A;  1NBF C;  3NVZ A;  5HI1 A;  4HJG E;  4HLE A;  3ALB A;  1HZ5 A;  4XC2 A;  3VXW A;  1YN3 A;  3BVZ A;  1K51 A;  2ZZP B;  3ZXR A;  1TBE A;  1WGG A;  1CQV A;  3DBR I;  1DOI A;  2D5G A;  4II3 B;  1F77 A;  3QCA A;  1SE2 A;  4JWS C;  4DHJ D;  4EFO A;  1CMX B;  4TSS A;  1ET9 A;  3JYU A;  1UGM A;  4IDI A;  1KLV A;  4G0N B;  2YEP F;  4LNK A;  2L8J A;  2KOX A;  2V3P A;  5DPR A;  2MJD A;  2RDH A;  1J7C A;  4DWF A;  4GSW A;  3OG5 A;  5HHD G;  1N6Z A;  1WY8 A;  2G45 B;  2NMQ A;  2W55 A;  2MCN B;  3TJP A;  1Q10 A;  3LB8 C;  1FNV A;  2WWZ A;  3DVG X;  1XXG A;  1EM7 A;  4GN1 A;  3NUH B;  1WJU A;  1UWX A;  3Q69 A;  3VVW B;  3RPF C;  4ANV A;  4L1B A;  2IO0 B;  4RM8 A;  2D2Q A;  4KIK B;  2CJN A;  4XX5 A;  2JZ3 B;  4MAC A;  4L23 A;  2V0G A;  4E3C A;  4FLH A;  1DGJ A;  2JRI B;  5D3I B;  2B3A A;  1JRU A;  3KUC B;  3VHT C;  4GXB A;  2WX1 A;  1ZGU B;  5LNK 1;  2JT4 B;  1R4N I;  4AJY B;  2FIF A;  4ASW C;  2RPV A;  4GIV A;  3GE8 C;  3DVN U;  1T0Q C;  2MQJ A;  4FUL A;  4GDK B;  4KX6 B;  1N62 A;  2LI5 A;  4KV2 A;  3QC8 B;  3GB1 A;  3LDZ E;  1JWM D;  5D94 A;  4FAD A;  2FUH B;  5CTR C;  3MC0 B;  1H4R A;  2ZCB A;  3PZ7 A;  4KDL B;  1F52 A;  3MC8 A;  1E8Y A;  4M8M A;  3MTN B;  1GB1 A;  2KAJ A;  3L54 A;  2ASQ A;  1SSN A;  2NCN A;  1E9M A;  4A8X C;  1ZOY B;  4WQM A;  1ZP0 B;  2GRI A;  3QX1 A;  4DXF A;  1SB3 C;  5KHQ A;  2KJH B;  4C56 C;  2BPS A;  3KUD B;  1FXT B;  5J18 A;  4MJS B;  1VCB A;  4NPN A;  1EU4 A;  3RZW C;  3HIZ A;  4EEW A;  5IKC M;  3NS1 A;  2MH7 A;  4W9C A;  4DDG D;  4IUM B;  1QOG A;  2J7Q B;  2MWS B;  3IAS 1;  3VQI A;  3IHP C;  2Z59 B;  4HKQ A;  1Z2M A;  1WE6 A;  1JWA D;  1RYJ A;  5H92 C;  2WU5 B;  1XLQ A;  3AE8 B;  3ZTC A;  3WAM A;  5AZF A;  5EE9 A;  2AX5 A;  4M0W A;  2WNM A;  4YL8 A;  4HXD A;  3IBE A;  5IAA C;  1I4P A;  2NVU I;  3UIN B;  4L2Y A;  2PE9 A;  1P98 A;  1I4R A;  1FXI A;  2KNB A;  1JWU D;  2GBK A;  2OJW A;  1V1O A;  1T6B X;  3RN9 C;  2NBW B;  2EMS A;  2BYT A;  2WXM A;  2XK5 B;  3LJ3 A;  1OTR B;  2N7J A;  1WMH A;  3U2S C;  1V5T A;  1VJK A;  1ET6 A;  3ZIM A;  2M4N A;  4M02 A;  2PW9 A;  2JY6 A;  4BVU C;  1LXD A;  4IWQ A;  2J52 A;  2NTT A;  1D4B A;  4AJW A;  2MP2 B;  3RNC C;  3IG3 A;  3AE4 B;  4GLS C;  2D3A A;  4W9E A;  1WXM A;  4PYZ A;  1UEL A;  3M62 B;  2OJR A;  5JZE B;  2D3G A;  1MG8 A;  2KTF A;  1KLG D;  1D5X C;  4WWP A;  2IDY A;  2I1J A;  2WHI A;  3IT6 B;  4ITK A;  2KN5 A;  3EFC A;  1QOA A;  3AEB B;  3ZJT A;  3ZKJ C;  2QSD A;  1E8W A;  3E56 A;  2QIE B;  4WWO A;  3ZGZ A;  4A55 A;  1V49 A;  1TIF A;  3ZDT A;  1HXY D;  3B1L X;  3Q3J A;  1MVK A;  1KOT A;  4C7Z A;  3T8M A;  2BQQ A;  1E90 A;  1H8C A;  1I4H A;  4HCP B;  3MHZ A;  2Y5B B;  3ZO5 B;  1SE4 A;  3GOE A;  3Q8A A;  2J42 A;  3GZN B;  2WXF A;  3JSV A;  3BYY B;  3RT3 B;  2KWV B;  4MEL A;  1WR1 A;  3I9V 1;  2N9X A;  4WJO A;  1C4P A;  1B1Z A;  2QMT A;  3Q2A C;  2DBY A;  4RNA A;  1IBX B;  4OVZ A;  1NEK B;  1EWY C;  2CHW A;  4M00 A;  3BYT B;  4RGO S;  4ARC A;  4GGQ A;  3N32 A;  4E71 A;  1PFD A;  2KLG A;  3ABV B;  5BO4 B;  3FIL A;  3QQ8 B;  4DHZ B;  1NYR A;  2W9N A;  1UNS A;  2DZM A;  4S0R A;  5L83 A;  1WJ4 A;  3EUB 2;  4GDL A;  4P16 A;  3O65 B;  4C4V B;  4AOF A;  4OW0 A;  4D2K A;  4ZHP A;  2L0T A;  5AEK B;  1XCT L;  3BK1 A;  3Q8B A;  4IC7 B;  2XEW A;  2J53 A;  5BMI A;  1NDD A;  4GOC A;  5GMV A;  1WM2 A;  2K6D B;  4RF0 A;  3TEZ A;  2MBQ A;  2GI9 A;  2IND C;  2G4S A;  2G9H D;  3AE1 B;  1B9R A;  2AEH A;  3ZTD A;  1CJE A;  3HK0 A;  1JML A;  4FXC A;  1TKG A;  3PPA A;  4MH0 E;  1N5X A;  3NS8 A;  4GMV A;  1U4A A;  1WM3 A;  3AE9 B;  2K3U A;  2ON8 A;  1P3Q U;  1L6U A;  1ZPS A;  3VFK A;  3NHE B;  4B9K A;  3TUO A;  2DWQ A;  1LGR A;  4HPM B;  2PEA A;  4EE2 A;  2CS4 A;  4JGH B;  1I42 A;  3TIX A;  1T0Y A;  2KDM A;  3KW5 B;  2E6X A;  1P0R A;  3V3X A;  1GJZ A;  4W9D A;  4WQO B;  3KVF B;  3ZLZ A;  3ML8 A;  1BXT A;  4W9H A;  3C0R B;  1ESF A;  2DZK A;  3R2I A;  3RD2 A;  1UF0 A;  2IGD A;  1SXT A;  4HPP A;  4N6E B;  2D11 A;  3H6N A;  4JWU C;  1XCQ L;  4KKJ A;  3V6E B;  2O6V D;  3HUI A;  5D2M B;  4USA A;  5E6P A;  3ZRF A;  4OVV A;  1RLF A;  3ZW3 A;  1JQ4 A;  4TKN A;  1GC6 A;  1MFW A;  1TY2 A;  1ROE A;  3HM6 X;  1XQQ A;  2KQ4 X;  4AUQ C;  3ONS A;  4AWJ A;  2ZW1 A;  4B0E A;  1HE8 A;  1WGH A;  1AW7 A;  3H1U A;  3Q6B A;  2RDB C;  4K7W A;  1E7V A;  3DBL B;  2FNJ B;  3TL5 A;  5JH5 C;  1ZXH A;  2GBJ A;  4KGR A;  3NZS A;  2K5P A;  2MRP A;  4GU2 A;  1E8X A;  3URY A;  3AV8 A;  2WP9 B;  4DQO C;  2HTH A;  5JHB A;  2D3C A;  2Y5C A;  3KH0 A;  2JVC A;  3K9P B;  2HE7 A;  3TEX A;  2CHX A;  2WDQ B;  4LNF A;  3ZYY X;  1WXQ A;  1L0V B;  4K7U A;  4IG7 B;  4X57 B;  4DXG A;  1NVI D;  1TZ1 A;  1YJI A;  1T0R C;  1V1P B;  3N1Y C;  5IP4 D;  1YQB A;  3S2A A;  2O6V A;  3KWL A;  1FRD A;  4EZL A;  2VZK B;  2DEN B;  3WAN A;  1WXS A;  1BT0 A;  2LJ5 A;  5G5H A;  2A4Z A;  3UIO B;  2LMC A;  3FC4 A;  2K6Q A;  1R4M B;  3L4P A;  3PZD A;  4XWT A;  2BTE A;  1HTO A;  3DBR B;  3CIR B;  2LRU A;  3M3J A;  4MH8 A;  3VTV A;  3SU8 X;  2JZP A;  4JE3 B;  3VAW A;  1TS3 A;  1FEH A;  4O1N A;  4FHJ A;  2WLB A;  2BYE A;  2C7M B;  5MPO A;  3R7Q A;  1FCL A;  1IP9 A;  2N9E B;  1E7U A;  2DX5 B;  3AH7 A;  3VUW A;  4ICV A;  2D10 A;  4BBN C;  1WYW B;  1YN5 A;  3L17 A;  2KD0 A;  2WGS A;  1PGA A;  1KF6 B;  2KWD A;  4MSQ B;  3DVN V;  1EWC A;  3QIJ A;  3W1S A;  2VRR B;  3L08 A;  3OWE B;  2N0S B;  3ZQ4 A;  4HEA 1;  1GOZ A;  1WXV A;  1YIW A;  3OLM D;  3KLS X;  5KHO A;  3R8B A;  3WAP A;  3APF A;  4P7I A;  2L3Z A;  3APC A;  5E6O A;  1L5P A;  1S3S G;  1VDV A;  5CHW A;  3WAO A;  4KIK A;  1UBI A;  1QQR A;  1E8Z A;  2KTR B;  2OHF A;  5I4D A;  1Z5S B;  3DBH I;  4IM3 A;  5AUK A;  5DPW A;  5C1Z A;  2L83 A;  1WX9 A;  4H2A A;  4K3B A;  5HFY A;  2KMC A;  1PGB A;  1FXA A;  4K1R B;  3DWM A;  5E6N A;  3VTW A;  4GDK A;  2KHW B;  2LZ6 A;  1Q0W B;  3M95 A;  3LXF A;  2KMA A;  3X23 A;  1DOX A;  4MEM A;  3ZVV A;  1L4Z B;  1A5R A;  1J7A A; 
#chains in the Genus database with same CATH homology
 4XWW A;  2PW9 A;  1FCC C;  4WIP A;  2J52 A;  4R3D A;  2NTT A;  3AE7 B;  3W9C B;  2LJI A;  2GB1 A;  1D4B A;  1AWD A;  2K22 A;  2HTM E;  1M4V A;  4XE0 A;  5HG2 A;  2LUM A;  1ACC A;  1TY0 A;  1YQ4 B;  4RH6 A;  2HDE A;  3AE4 B;  4ARI A;  4GLS C;  2WXN A;  1SF0 A;  1ZUD 2;  5FK9 C;  4YSY B;  1OQR A;  2JU6 X;  4TMA B;  3IT4 B;  1FFU A;  1EU3 A;  2WXO A;  3VRB B;  1P7F A;  3FIL B;  3C8Y A;  2LHE A;  2M0A A;  2M19 A;  4US9 A;  1JWS D;  4WH4 A;  1KLG D;  1D5X C;  1P7E A;  2IDY A;  1WSP A;  3IT6 B;  4ITK A;  3SFE B;  4GDL B;  1MPE A;  2JXT A;  4KGS A;  2INN E;  1QOA A;  3AEB B;  2R61 A;  4YTP B;  3AE2 B;  5FKA C;  4N58 A;  1UGJ A;  2EKI A;  4YSZ B;  3ZJT A;  2ZW0 A;  4IOI E;  1TJE A;  1TS4 A;  2QSD A;  4LK0 M;  3E56 A;  1E0Z A;  2TSS A;  4RF1 A;  2QIL A;  2QIE B;  2B76 B;  2K0P A;  4A55 A;  3ZGZ A;  1WWT A;  3IXS A;  1HXY D;  2KAC A;  1K50 A;  3AE5 B;  2WXJ A;  3AED B;  2N9K A;  2Q5W D;  1MVK A;  1LO5 D;  2FE8 A;  4C7Z A;  3AB5 A;  1I4Q A;  2JSV X;  1MHX A;  1ENF A;  2PIA A;  1ZXI A;  2BS2 B;  1QT9 A;  2I38 A;  2MJE A;  3TEY A;  1C76 A;  1I4H A;  1ZDX A;  3MHZ A;  1NI3 A;  1SE4 A;  2PVG C;  2WXQ A;  4RCO A;  3Q8A A;  2J42 A;  4TQ1 A;  1FM0 D;  3AEC B;  3MFG A;  2WXR A;  1UUP A;  2RMM A;  2WXF A;  4PT5 A;  5T8I A;  3BYY B;  1T3Q A;  5BMH A;  5BMG A;  2DYM A;  2WXP A;  5G5G A;  1GB4 A;  5EE3 A;  1VZ6 A;  2L52 A;  2Y3A A;  2Z8L A;  4A6Q A;  3I9V 1;  3V05 A;  3B2G A;  1XO3 A;  1L4D B;  1C4P A;  1B1Z A;  2QMT A;  2OED A;  4XDC A;  3MJ5 A;  1C79 A;  1HA5 A;  2DBY A;  4RNA A;  3U7Z A;  3P4R B;  1YQ3 B;  2JYT A;  1HZ6 A;  1F2R I;  5FR3 A;  1IBX B;  4OVZ A;  1NYQ A;  2W54 A;  1NEK B;  1EWY C;  4JX1 C;  2L32 A;  3O13 A;  1FIQ A;  3BYT B;  4RGO S;  1BML C;  4ARC A;  1PFD A;  3ABV B;  3AEF B;  3VR8 B;  1K53 A;  3FIL A;  4ZOH C;  1NYR A;  1CK1 A;  2ONQ A;  2AQ2 B;  1UNS A;  1FNU A;  1JW9 D;  3T3N A;  3T3O A;  2LEK A;  2PTL A;  1D6E C;  4RFB A;  3EUB 2;  5TSS A;  1L6V A;  2NTS A;  2KN4 A;  3EGR A;  4P16 A;  4YTM B;  1XF5 L;  4D2K A;  4OW0 A;  4ZHP A;  1WYG A;  4NZL B;  2WXK A;  2WXL A;  1MI0 A;  1XCT L;  3AMZ A;  1Y56 A;  1STE A;  4OZA A;  3BK1 A;  3Q8B A;  1SE3 A;  2XN9 C;  1CZP A;  3AE3 B;  3HRD D;  1E7P B;  3U52 E;  4RGN A;  2J53 A;  1QKZ A;  1V8C A;  5BMI A;  2LHD A;  4CQN A;  2E3T A;  2WDV B;  1KTK A;  1TZO A;  4LTU A;  1JCK B;  1JAL A;  1YMH E;  4KGT A;  1F0Z A;  3KWV A;  4RF0 A;  3W5V B;  1R7S A;  2X38 A;  3TEZ A;  3AM9 A;  2IPK D;  2GI9 A;  3W5U B;  4REZ A;  1VRA B;  3AN1 A;  1WRI A;  3BZD B;  4ZRP A;  2G9H D;  1D5M C;  2PMV A;  2WDR B;  2MJ3 A;  3AE1 B;  2N9L A;  3NRZ A;  1B9R A;  3U4E G;  1CJE A;  4ZHO A;  1ZDV A;  1JML A;  4FXC A;  1TKG A;  2M56 B;  2V3N A;  1AYF A;  1KH0 A;  4A9A A;  4B0M A;  1XEE A;  1N5X A;  5EE0 A;  2J58 A;  3AE9 B;  2K3U A;  2ON8 A;  1ZPS A;  1IUE A;  1L6U A;  4NAW B;  4C7Y A;  3ZJU A;  2W82 A;  3TUO A;  3DWG C;  1ZE3 D;  5AUI A;  1FD6 A;  3BVM A;  3HVD A;  1XLO A;  2IGH A;  3IAM 1;  5D3D A;  2DWQ A;  4EE2 A;  3E9S A;  1KLU D;  3AEE B;  3ETR A;  1UWM A;  1QOB A;  5BYQ A;  2V4I B;  2KDM A;  2E6X A;  3P4Q B;  2AQ3 B;  5E6J A;  1IBX A;  2BBC A;  4OZB A;  3V3X A;  3VR9 B;  1SIJ A;  1XLP A;  3HVZ A;  2EEL A;  3NZ3 A;  2W8H A;  3SEB A;  2CJO A;  2SAK A;  1BXT A;  1JWB D;  4HRS A;  2W3R A;  4YT0 B;  1C4A A;  4TQ0 A;  1ESF A;  4A90 A;  2LFI A;  3BII D;  3R2I A;  4MM3 B;  1AN8 A;  3AE6 B;  1RFK A;  2JQR B;  2IGD A;  1SXT A;  5JXV A;  4N6E B;  4JWU C;  1XCQ L;  1N60 A;  1WGK A;  4KKJ A;  3CWI A;  1C77 A;  1E6E B;  2I2Y A;  3HUI A;  2QJL A;  4WUR A;  1YNT E;  4OZC A;  4USA A;  1JQ4 A;  1JRP A;  3VRA B;  1DYQ A;  3NVZ A;  5HI1 A;  4HJG E;  5EE1 A;  4NAM A;  1TY2 A;  1ROE A;  2INP E;  3FAH A;  4ZYS A;  2KQ4 X;  1HZ5 A;  1YN3 A;  2ZW1 A;  3BVZ A;  4B0E A;  1K51 A;  4YWG G;  4AQ7 A;  1AW7 A;  4N59 A;  2SEB D;  1CQV A;  1DOI A;  2D5G A;  1N61 A;  2XNA C;  2W8I A;  1F77 A;  4C80 A;  1FO4 A;  1SE2 A;  4JWS C;  2PKO A;  1ZXH A;  4TSS A;  1ET9 A;  4IDI A;  4J3O D;  4KGR A;  1DOY A;  3NVY A;  1FNW A;  3P4S B;  2YEP F;  5BYR A;  2K5P A;  1RWS A;  3URY A;  4JPS A;  1IGD A;  1NEN B;  3N9Y C;  1E10 A;  1OFF A;  2V3P A;  3AV8 A;  1RM6 C;  2MJD A;  4YTN B;  2WQY B;  3TEW A;  2RDH A;  1J7C A;  2WP9 B;  5HHD G;  1FMA D;  4NJC A;  4DQO C;  2NMQ A;  5BYS A;  4UDU C;  4KKI A;  2RDG A;  3Q8F A;  2JYE A;  2W55 A;  3SR6 A;  2Y5C A;  1I4G A;  4XDD A;  1Q10 A;  5GXG B;  1PYW D;  1SEB D;  3B9J A;  3LB8 C;  3TEX A;  1GAQ B;  1FNV A;  2WDQ B;  1PGX A;  3ZYY X;  1XXG A;  1WXQ A;  1EM7 A;  3AEA B;  2J4X A;  3NUH B;  1FRR A;  1L0V B;  5C2T B;  4LLG M;  1FFV A;  3BWU D;  1UWX A;  1D5Z C;  1VR9 A;  3Q69 A;  3RPF C;  3KQ4 A;  1L0Y B;  4DXG A;  1NVI D;  1YJI A;  2IGG A;  4ZRQ A;  4L1B A;  3TSS A;  2BB6 A;  1V1P B;  2CJN A;  1KFY B;  2DLB A;  4RGT A;  3KWL A;  4MAC A;  4L23 A;  2V0G A;  1FRD A;  2VZK B;  3J9C A;  4AS1 A;  1DGJ A;  3Q8E A;  5D3I B;  3P1M A;  4Q2J A;  2LGI A;  5LNK 1;  2BT6 A;  5G5H A;  1VZ7 A;  4YSX B;  2H89 B;  2IJ0 A;  2RPV A;  3UI3 A;  2L1A A;  2VZK D;  4WWM A;  1C9F A;  1MHH E;  2LMC A;  3FC4 A;  2WXG A;  3L4P A;  1SJH D;  4XWT A;  4GDK B;  2BTE A;  4KX6 B;  2AQ1 B;  1N62 A;  1TKY A;  3RFZ B;  2Y5P A;  3GB1 A;  3GP7 A;  1JWM D;  3CIR B;  1N63 A;  4MH8 A;  1N5W A;  2JZP A;  3B2F A;  4JE3 B;  1TS3 A;  2ICI A;  1VZ8 A;  1FEH A;  3MC0 B;  3PZ7 A;  4O1N A;  1PDX A;  2BS4 B;  3Q8C A;  2WLB A;  3ZJV A;  1GB1 A;  1TS2 A;  3PO0 A;  1BUI C;  2KAJ A;  5MPO A;  1SSN A;  3H8H A;  1SBB B;  1C4C A;  1E9M A;  3W2D A;  3I57 A;  1FCL A;  4A8X C;  1ZOY B;  2DYO A;  4WQM A;  3LYY A;  1ZP0 B;  2FBW B;  2GRI A;  4HKZ E;  4IKG A;  3AH7 A;  1PUT A;  1YJJ A;  1J7B A;  2FUG 1;  4MT5 A;  1TKE A;  3PZ8 A;  1YN4 A;  3P4P B;  1SB3 C;  4DXF A;  3NVV A;  1TYG B;  1YN5 A;  4C56 C;  2H88 B;  1I7H A;  4WAF A;  3SFD B;  1QIL A;  1QLB B;  1PGA A;  3AEG B;  1A70 A;  2WXH A;  1KF6 B;  2KWD A;  2JX5 A;  2MEK A;  2JWU A;  5C3J B;  1EWC A;  3W1S A;  1EU4 A;  1QOF A;  3OWE B;  2W3S A;  1QF6 A;  2CU3 A;  2N0S B;  1XLN A;  3ZQ4 A;  4HEA 1;  1HEZ E;  1I4X A;  1GOZ A;  2MH7 A;  3MP9 A;  3NS1 A;  3R8B A;  3KLS X;  4US8 A;  2PLP A;  1QOG A;  3IAS 1;  4OHJ A;  2BB5 A;  3VQI A;  1OQQ A;  2WU2 B;  4HKQ A;  1VLB A;  1L5P A;  2WS3 B;  4YXD B;  1JWA D;  1RYJ A;  5H92 C;  1JRO A;  3P63 A;  1IGC A;  2WU5 B;  1VDV A;  3R2T A;  1XLQ A;  3AE8 B;  2YEP B;  1V1P A;  1QQR A;  2K9X A;  2G1E A;  3BK2 A;  2OHF A;  2PVO D;  2ACZ B;  5EE9 A;  1GPX A;  2AX5 A;  4M0W A;  3GS2 A;  5I4D A;  2WNM A;  5AUK A;  1TS5 A;  2L83 A;  5D7G A;  1T5X D;  4RGM A;  1KRH A;  4H2A A;  2BW2 A;  1I4P A;  2WXI A;  2QEJ C;  3NVW A;  4L2Y A;  2BS3 B;  5HFY A;  1PGB A;  1FXA A;  1FXI A;  1I4R A;  1C78 A;  1K52 A;  1SJE D;  3BVG A;  1JWU D;  2KMM A;  3WCQ A;  1HQR D;  3DWM A;  1V1O A;  1T6B X;  3P42 A;  5H8Y E;  1F2R C;  4P6V F;  2BYT A;  2WXM A;  3LXF A;  1V97 A;  2N7J A;  3EA6 A;  1L0X B;  3U2S C;  1DOX A;  1VJK A;  1L4Z B;  1J7A A;  4HRO A;  1ET6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...