3P42A

Structure of gfcc (ymcb), protein encoded by the e. coli group 4 capsule operon
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
QGMVTIYLPGEQQTLSVGPVENVAQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWLAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia coli Group 4 Capsule Protein GfcC Reveals a Domain Organization Resembling That of Wza.
pubmed doi rcsb
source organism Escherichia coli o127:h6
molecule tags Unknown function
molecule keywords Predicted protein
total genus 56
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.700 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p42A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 3p42A03
2W8IA 2W8HA 2J58A 3P42A
chains in the Genus database with same CATH superfamily
1WRDB 5L83A 3AU5A 5JXVA 2CS4A 2WU5B 2MX2A 2KD0A 3ZDMC 1E5WA 1WZ0A 1I4PA 1ET9A 4B0EA 1AN8A 2D11A 4P16A 4DK5A 3AE5B 2RDGA 1L2NA 1SIFA 1UZXB 2LEKA 2QDFA 4WAAA 2O2VA 4TQ1A 4JLCA 1WE7A 1WY8A 1L6UA 4J6IA 1I35A 3MJWA 4QAYA 3DBRB 5DPRA 4C00A 2DAFA 4JWUC 4XDCA 4C4VB 1PYWD 5GXGB 2NBUA 2WU2B 3C8YA 4RF1A 2SAKA 3NVYA 1TS4A 3KUDB 2DYMA 4MGYE 1L0VB 2AX5A 1E6EB 1UD7A 1CZPA 4ZHOA 4IKGA 5JHAA 4MH8A 2MH7A 1S3SG 3ZVVA 2M8SA 3HUIA 1L6VA 2JZPA 5AUIA 2WX1A 3PS6A 1N62A 2VZKD 4W9CA 3VRAB 1ET6A 1N5XA 4PS3A 3DBLI 5CHWA 4L23A 1OFFA 1Q5WB 2KVRA 4P7IA 2ONQA 3CWIA 1F2RI 4ZYSA 2DBYA 3WALA 2IY0B 1FEHA 3O13A 2W3SA 3PZDA 3BVMA 5FR3A 5AZFA 1QKZA 3GZNB 2H89B 2R2OA 4RMAA 3VQIA 1TT5B 5LXHA 1C79A 3RD2A 2BF8B 1Q0WB 2IYDB 2FCQA 2ZVOA 2TSSA 3NVWA 3PZ8A 5J17A 3AEFB 3BVGA 2MLBA 1N60A 3WAMA 3AE1B 3CMMB 4IC7B 2CU1A 3SFEB 1QLBB 2IO3B 3JVZX 3A4SC 3PLUA 2KTFA 4M0WB 3QQ8B 3RNBC 1V6EA 4ZRPA 5FK9C 3DHGC 4O1NA 3Q3OC 2H88B 2NPTB 2BGFA 2QILA 1R4NI 4GSWA 1NVID 1JMLA 3LXFA 4LNKA 3Q3JA 1HQRD 4DHJD 1N6ZA 2NS5A 4I6PA 4RH6A 4W9LA 3CSTA 1ZUD2 2L00B 4JIOU 3Q2AC 1E7VA 3TEYA 1OQQA 1DYQA 2LHEA 2IZVB 1IPGA 1XO3A 4GN1A 4AQ7A 4WWPA 2YEPF 3Q69A 4HDQA 2NTTA 2N7JA 3DPDA 2SEBD 1KJTA 2YEPB 1H4RA 3B2GA 1P9DU 4LK0M 3K9PB 3VVWB 4IWPA 2BT6A 2LXCA 4C7ZA 1SB3C 1VZ8A 2AQ2B 1WWTA 3NJTA 2A5UA 1QOAA 2DWQA 2KJRA 2KQ7A 3FKYA 3ENEA 1KRHA 1RRBA 1XQQA 2VRRB 3HRDD 5C3JB 2MBEA 2AQ1B 2GBKA 2WQYB 1OQYA 2PVOD 3R8BA 2WXJA 4BKSD 1E8XA 1QT9A 5BYSA 3KQ4A 3UQAA 2OOBB 3BK2A 1SXTA 3QX1A 1ZXHA 2GI9A 2FAZA 4IWQA 3SDLC 3P1MA 1J8CA 2K8BA 4EFOA 3W1SA 1UNSA 4CQNA 3NZ3A 4PYUA 3K9OB 1FD6A 5D7GA 1WXMA 5EE9A 3NS8A 4NY0A 3B08A 1I4HA 2N0SB 1FNWA 4KX6B 2BB6A 1VCBA 3H6NA 4MSQB 1TKGA 1WRIA 4ZRKA 2N9PC 4MACA 3KLSX 3ZNID 2RPQA 2WXHA 3ZYYX 3NZSA 1NYQA 2WXKA 2PVGC 2K39A 2G9HD 3TSSA 2K25A 2WXPA 4RGOS 2G45B 1BUIC 1ENFA 1RLFA 2KOXA 5IA7A 3IAS1 1FXIA 1GAQB 1B1ZA 2LJ5A 1V1PA 5IP4D 4WJOA 4W9HA 2YLMA 1K53A 2RR9A 1V86A 1LO5D 1JCKB 3I57A 3GP7A 4C80A 1WM2A 2K9XA 4II2B 4AJYB 4R3DA 2L3ZA 1D6EC 3RFZB 3V60A 4G0NB 4DXFA 2MBOA 1RAXA 2WDQB 2QJLA 4XWWA 4RCOA 2C9WB 5HHDG 1Y8RC 1BMLC 2KYWA 2KMAA 2OHFA 5DPTA 1A5RA 2IGHA 1ZE3D 4S17A 3ABVB 2V4LA 3A4RA 4RFBA 1WXSA 1DOYA 3W5UB 2KNBA 2A4ZA 2CJOA 5E6PA 3B1LX 3VUXA 2M56B 2V9HA 2EMTA 4HCNB 4REZA 4YTPB 2J52A 4A90A 1HTOA 1IBXB 3W9CB 2Z8LA 2N9LA 4A9AA 4NQLB 3GZNI 2J7QB 1V97A 4LNOA 2M0AA 1SE9A 2FE8A 1P7EA 2RDBC 2CU3A 3DBSA 2JF5A 4EEWA 1M94A 2KACA 2LVPA 4ZRJA 3ZRCA 3GE3C 4JWSC 4USAA 5G2NA 2MRPA 2BS3B 1H8CA 4KVGB 2AL6A 4NZLB 1PGBA 5T8IA 1LFDA 2KWUB 3URYA 4F1SA 2LVQA 2V4IB 2WXGA 3ZKJC 1TY2A 3N1ZC 3RN9C 2X8XX 3AE3B 5CTRC 2W8IA 2OEDA 1RFKA 1C4CA 3V61A 2B76B 3AM9A 2KMMA 1C76A 1AW7A 2KMCA 4GOCA 4DHZE 2JQRB 5CHVC 5J18A 2LGSA 3SR6A 1PUTA 4ARCA 1GNUA 1ESFA 2INNE 4H2AA 5DCNA 3BINA 1V1OA 2UYZB 2G4SA 4K1RB 4GDLB 2RGFA 1I7HA 4NQKE 1YD8U 3X0WA 3AE9B 3TMPB 2PEAA 5AZGA 3TUOA 2LUEA 2MQJA 1JWUD 1AARA 1TGZB 3DDCB 1FIQA 2JXTA 1MPEA 1L7YA 1WXAA 2MBHA 3H1UA 3N20C 3EHVA 2NMQA 4MEMA 1MG8A 2V3PA 2L1AA 1MG4A 3FC4A 3L0WB 3AE6B 3ZRFA 1G6JA 2BS4B 5HKHA 1SJED 3OWEB 3GS2A 3FILB 1EWYC 4LTUA 3RPFC 4ANXA 3Q14C 2LGXA 4AP4C 2KWCA 2HJ8A 2WXFA 2K5PA 4LLGM 1QOGA 2BBCA 4RGTA 2GBJA 4HLEA 2DZIA 3PVLA 1D4BA 3S2AA 1GG3A 1FXTB 3P4PB 5BO4B 4WJNA 1WGKA 1X1MA 2DZJA 4UDUC 2IJ0A 1WMHB 2M19A 4WWNA 3EA6A 3PPAA 4NJ6A 4FJZA 3A9JB 3ZGZA 4XDDA 1XLQA 1WZ3A 4IG7B 4EZLA 1K51A 4G50A 4ARIA 2AEHA 2C7NB 4ICVA 3FILA 2V1YA 3NUHB 2JZZA 1T0YA 4XX5A 3H8HA 1JWBD 4FLHA 1KLUD 1FMAD 1SE2A 4AWJA 4BOZB 2PE9A 1JALA 3AULA 1YN5A 3I5JC 2FCSA 4KGSA 1OEYA 5JHBA 4HDOA 5D6JB 2ZW1A 3AN1A 4MJSB 3SEBA 1KH0A 2E3TA 4EE2A 4HEA1 1C4PA 1VRAB 2C5LC 3WCQA 1SIJA 3DVGX 2EMSA 3AB5A 3M95A 1WE6A 3N1XC 3MC0B 2WXNA 2BYTA 2I2YA 4E74A 3N30A 2DZMA 5IN7A 1QQRA 3VDZA 4K7UA 4L1BA 1C3TA 3TEZA 4E3CA 3DBLB 2KDBA 2K6DB 2L7RA 4ANWA 3W2DA 3T3NA 3ONSA 3B9JA 4KDLB 1DOXA 3MP9A 3OJ4B 1QOFA 3QCAA 2C7HA 3A1QB 4K7WA 4AUQC 1VD2A 1RWSA 3B0AA 3J9CA 3KWLA 3MHZA 4BVUC 3AMZA 1P3QU 4W9EA 3N1YC 1FFUA 2D2QA 3SHQA 2JPHA 1QOBA 4IDIA 3IAM1 4KZ0A 1XF5L 4M01A 2MJDA 4HKZE 2KZRA 2ZCBA 4TMAB 1T6BX 2WLBA 4WWMA 4YTMB 1BXTA 3UF8A 2FUHB 4BBNC 2KDIA 2WHIA 3DOWA 2LZ6A 3W1YA 1I4RA 1WGYA 4KIKA 4MM3B 2M4NA 2BPSA 3WA0A 2K22A 1GPXA 1WI0A 3JW0X 1TZOA 1HZ5A 1TZ1A 4KKIA 5D94A 3M63B 4K3CA 4A3PA 1K8RB 2XNAC 4PS7A 5IO9A 1UBIA 4DQOC 4WJPA 2PW9A 2L8JA 2XK5B 1YQ3B 2HJ1A 2BVCA 2L05A 4M8NA 3C0RB 4LCDE 2FIDA 1UELA 3APDA 4W9IA 3QJZA 2GBRA 4BKTA 2I1JA 2JYEA 5EE1A 4CO7A 1HTQA 1FO4A 3QAQA 1EO6A 3H7PB 1GOZA 2MSED 1V1PB 2QIEB 2J58A 1WYWB 3IXSA 1K50A 2ACZB 4S0RA 1WJ4A 5D3DA 3DWGC 1F52A 4IM2A 1EF5A 2LJIA 1EF1A 1NI3A 4GIVA 3RZWC 3ZW3A 2K8CA 2FNJB 3UIOB 4DXAB 1TKYA 4HRSA 1PGAA 1QZEA 4TUUA 1FM0D 3NRZA 3P63A 1TKEA 2JVCA 3OJ3A 1GC6A 4FA6A 2BQQA 2D3AA 3HIZA 2KK8A 3U4EG 2NR2A 1L5PA 1V81A 3T9LA 3AH7A 1C78A 4BOSC 2MEKA 3AI5A 3LJ3A 3DVGY 4D2KA 4K81A 4DXGA 2ZNVC 2BB5A 2KWDA 4GDLA 2IO1B 3BYYB 4FN2A 4OVVA 3PREA 4K7SA 3LB8C 2Y3AA 5IKCM 1FRDA 2ICIA 3ZJTA 2BYVE 4GDKA 4FHKA 4MGIE 2Z0DB 4ITKA 3AEAB 4LNIA 4XZ4A 1XLNA 3TEWA 2IGDA 2BW2A 2C7MB 3R7RA 1JWMD 3UGBB 4HJKA 4DBGA 4RM8A 2O6VA 1F0ZA 3ZUNA 1VJKA 3PTFC 1WX7A 4BKSA 4KSLC 3AEDB 3M62B 2BTEA 4MJSA 4A8XC 3BWUD 3AEGB 1XCQL 4B95A 2KFKA 2AQ3B 1JWSD 3L10B 4PYZA 4B6WA 2KTRA 3L17A 2KXJA 1BT0A 2K8HA 3DBRI 3APCA 1CJEA 4XWTA 4KGTA 4IW0A 3EFCA 2K6QA 2JZ3B 4KIKB 2L52A 1TS5A 2D3CA 3ZTCA 2OJWA 1E9MA 2RMMA 2D07B 3RNEC 2CJNA 2D3BA 5GMVA 1GB1A 5DPSA 2LGYA 2JT4B 2DYOA 3HVDA 4YXDB 4HCPB 1YQ4B 4OW0A 3I63C 2LGDA 4JE3B 1Q10A 4OVZA 4NAMA 1RFAA 2EELA 3Q8FA 3JSVB 2WXQA 4BKGA 3PHWB 3KYDD 3QK0A 1QILA 3R2TA 3DCGA 1V9JA 5J2RA 1N5WA 1E8WA 2LRUA 4GU2A 1OQRA 3TJPA 2DLBA 4RGNA 4WQMA 4EUTA 4OZCA 3NOBA 2L0TA 2INCC 2QHOA 3RNCC 3RT3B 3Q8AA 3DBHB 3P4QB 5AZHA 1WR6E 5BYQA 5MPOA 4XC2A 1WJ6A 3A9KA 4URKA 2N1VA 2WXLA 3H7SA 4MGKE 4E71A 3Q8BA 1WMHA 3OLMD 1E8ZA 2DNFA 3NZUA 4HROA 4A20A 2REXA 1UWMA 1DOIA 3EECA 3P4SB 1FNUA 1ISNA 2G3QB 5G55A 3V05A 2BS2B 5EE0A 4IWOA 2NCNA 1GB4A 3BYTB 4ANVA 2AL3A 1P98A 4WURA 3VAWA 1ZGUB 1C77A 3IT6B 4BAXA 2C60A 4A55A 2LMCA 1J7CA 3ZJUA 2KC1A 3MC9A 3PZ7A 3NS1A 4AOFA 1F77A 2R61A 2GMIC 3A33B 1L4DB 1CK1A 4L2YA 1D5ZC 5LNK1 2J0JA 2GBNA 2KHWB 4KSKC 2BKFA 2QCZA 3AEEB 4K3BA 3V3XA 5CX3A 3DBHI 3L16A 2O6VB 4WAFA 2KJ6A 2J0KA 1IP9A 4KDIC 4OHJA 3WANA 3RUIB 3PHXB 4M00A 2JRHA 1ZXIA 3Q6BA 4OVUA 3SFDB 1OGWA 2K3UA 1MI0A 4YSZB 2ZW0A 1D5XC 2FUG1 2W8HA 2LI5A 1E7UA 4YL8A 4ICUA 2KDFB 5LXIB 1EM7A 4DDID 4EZJA 2QSDA 1V8CA 1NBFC 1PQSA 4GXBA 2D5GA 2KANA 2V0GA 3R66C 3N9YC 1UBQA 2WXMA 1R4NB 3VUWA 1K52A 2MJEA 3UQBA 4HWIB 3CF6E 2JSVX 3NY5A 3NVZA 1NEKB 2NBWB 1XD3B 5AUKA 4HVBA 3H9DA 2I38A 3QC8B 3VH4B 1T0RC 2NPTA 3GOEA 3OG5A 5LLIA 2IO2B 1FNVA 3HHMA 2JY6A 5IAAC 5E6OA 3DWMA 4OZAA 2JX5A 1EWCA 2INDC 4ZOHC 5E6NA 1KLVA 2KJHB 2J53A 2ON8A 1SF0A 1ROEA 1SGHA 1WR1A 2BYEA 3AE7B 2G1EA 4LDTB 4ZRIA 2M1MA 3UIPB 1XLPA 4YWGG 3LDZE 1E90A 1F2RC 3MC8A 4CHKA 4C7YA 2N4FA 2EKEC 5TR5A 3PRMB 4YSYB 2ZPNA 4N6EB 4JPSA 3R7QA 2INPE 1T5XD 4MH0E 1N61A 1FCLA 1YQBA 2DHZA 4BFRA 4MT5A 3TEXA 2ZNVB 1ACCA 3DHHC 2FIFA 2IY1B 3AXCA 1V2YA 2KO3A 1JRPA 2XK5A 1WX8A 4KZCA 3AU4A 2XBBC 2D3GA 4NAWB 2ZPYA 2FCNA 1EU3A 3AV8A 4RGMA 1LM8B 2L32A 2NTSA 4ANUA 4NNJB 1V5TA 2OJRA 2IDYA 3VUYA 2MP2A 4WH4A 2PJHA 2JRIB 3T8MA 4DHZB 3BY4B 2Z0EB 2KQSA 4XYCA 5C23A 4KGRA 2J0MA 3ETRA 1PFDA 5FR6A 3PO0A 4LDTD 1D5MC 2R2QA 2V3NA 2KAJA 2MBBB 1IGCA 4NAWA 3V6CB 4RNAA 2LXAA 2PTLA 4MELA 1HEZE 2GOWA 1CMXB 4P6VF 3SD5A 2L83A 3U52E 1TY0A 1SJHD 2KQ4X 4FULA 2BYFA 3ZIMA 1E0ZA 3ML9A 5BMIA 4WWOA 1UWXA 2L0FA 3TL5A 3VFKA 3NG0A 1HA5A 2MCNB 2JU6X 4EZKA 3BVZA 2WDRB 2ZEQA 1J19A 4DWFA 4IUMB 2LWPA 1V49A 4HPMB 1OEYJ 4I6NB 3L4PA 4HPLB 3U2SC 5D2MB 4B9KA 3PT2B 1VLBA 2O6VD 1C1YB 4NJCA 3KUCB 1UUPA 3L13A 3RNGC 1YJIA 3IBEA 1JROA 4W9DA 4W9JA 4LJPB 3X23A 1YNTE 1GUAB 4ASWC 5EE3A 4NPNA 1ZDXA 1HXYD 4W9FA 5DPWA 3I3TB 1I4GA 2JWZA 3C19A 4LNNA 5BMGA 4FHJA 4MSMB 2AYOB 2RSUA 2D10A 1CQVA 1WIAA 1YOVB 1N63A 3TIXA 2FCMA 3ZLZA 2PMVA 1LXDA 3DHIC 1F1HA 2WDTB 2WDVB 2WXIA 3B2FA 2N7DA 2LASA 1JW9D 3ZJVA 4JL9A 2Y5PA 4G11A 5BMHA 3W1SC 2DENB 1WX9A 3VR9B 3NHEB 2MWSB 4IM3A 2PLPA 3MHSD 3T3OA 1STEA 2KFKB 3A1QA 3ZXRA 2KX3A 1FXAA 2KTRB 4RM9A 1JRUA 2W54A 1F9JA 4IM0A 3RCZA 2HD5B 1Q1OA 1WSPA 3O65B 3SU8X 1YIWA 2CHZA 1I4QA 1U4AA 2N1WA 4ZYNA 4I6LB 4MM3A 1TS3A 3Q3FA 1Y56A 2V3SA 3ZDTA 3KWVA 2PPHA 2WP9B 5JH5C 2QC8A 2PIAA 4HJGE 5C2TB 4PK1A 1WGDA 1LQBA 1PDXA 2DYBA 2LHDA 3Q3NC 1VZ7A 1E8YA 1D3ZA 3RNFC 2QMTA 4GLSC 3MJ5A 2WS3B 3AECB 1YJJA 1NI2A 1R7SA 4BBNF 1EU4A 3DQVA 2WWZA 4P1BC 4ZDVA 3R3MA 1P0RA 1ZOYB 3APFA 4KKJA 5L95C 2FBWB 4N9F4 2DX5B 3IT4B 3JYUA 2IBIB 4YTNB 2E6XA 4ZRQA 1JWAD 1KLGD 1IGDA 2WGSA 2KN4A 2HE7A 3PGEA 3R2IA 3VHTC 2LRWA 1VR9A 2M17A 2EKIA 4MGZE 1GC7A 1WXVA 2HTHA 2CHXA 2L76A 1P1AA 3ZQ4A 2LGIA 1SE3A 1RYJA 2K1FA 4LNFA 1WGHA 1C9FA 1VDVA 4RF0A 2KN5A 4WJQA 2VH2A 1ZP0B 4GGQA 3AE4B 1E10A 1J7BA 1UGJA 2N9KA 2NBVB 1YMHE 4IOIE 1GJZA 3A9KB 1FPYA 3RZFA 3CIRB 1HE8A 3U7ZA 3RULA 1SBBB 2W3RA 2Z59B 1L0YB 5C1ZA 1XEEA 3QHTA 2YVCA 1XXGA 3IVFA 3N3KB 3U8ZA 3P2BA 4HXDA 2MA9B 3ZXVA 1V5OA 4ACFA 1UGMA 1AWDA 2ZCCA 3RNAC 1I4XA 4BZAA 3Q8CA 1HZ6A 4HK2A 3PRZA 2KLGA 3EUB2 4FJVB 3ZTDA 4AJWA 2CKHB 1YN3A 3QWZB 1UF0A 2RDHA 2CHWA 1PGXA 1WGRA 1FFVA 2GBMA 1WJNA 2MBQA 5HI1A 3HM6X 2BKRB 3AE2B 2WXOA 3RMKC 4P1CC 1WH3A 3EFUA 2ZZPB 1S1QB 3ML8A 4KV2A 2DZKA 3PLVA 4J3OD 4FJYA 1P7FA 2B3AA 5KHQA 1IBXA 1V80A 5KHOA 4G3XB 3LYYA 2MW5A 2KLCA 3PSEB 2J4XA 2GLSA 3NVVA 1IYFA 1TJEA 2LUMA 3KVFB 1RM6C 5H8YE 1XCTL 2GB1A 3P42A 4WQOB 3U30A 1I42A 1VZ6A 2IGGA 3AEBB 3PV1A 3BZDB 4OZBA 5HG2A 1T3QA 1A70A 3CSFA 1WF9A 2LD9A 2W9NA 5I4DA 1ZW7A 3VTWA 3MFGA 2X38A 2W55A 5FKAC 3M3JA 3D32A 1L4ZB 2AWTA 4F8CB 1IUEA 3V6EB 1TIFA 4YSXB 1WM3A 3ZO5B 4M8MA 3Q3MC 2IPKD 3QARA 2BWFA 3ZNZB 4JQWC 2WYQA 5CHFA 4MDKE 2KX0A 3PRPB 2KC2A 1MFWA 2WNMA 2KKCA 2LFIA 3QIJA 5TSSA 4A6QA 1MJDA 2N7EA 2RPVA 4YT0B 1J0GA 5AEKB 1M4VA 3P4RB 2PKOA 4WIPA 1TYGB 2JUOA 3ZNGC 3GB1A 3UI3A 4ZHPA 2PE6B 3HVZA 1WXQA 4TKNA 3Q8EA 3RI7C 3RYTA 3VTUA 2ZVNA 4AS1A 3GE8C 2KDMA 4NJ7A 4LJOB 4JGHB 1UH6A 4FXCA 3VH3B 2UWQA 1KFYB 1TBEA 4TV3A 2KT7A 5JZEB 1NENB 3U7DA 2HDEA 3KYCD 4M0WA 4W9GA 1YN4A 1YJ1A 2G4DB 3FAHA 2WXRA 1C4AA 1WGGA 1EUVB 4DDGD 3ECIA 3WAPA 2K0PA 4EKUA 1TTNA 2VH1A 1B9RA 4EOYA 4N59A 4II3B 1KF6B 2MHJA 1XT9B 2GRIA 2MP2B 4US8A 3IG3A 1SSNA 1KTKA 4N58A 2HTME 1FRRA 2LVOA 3VR8B 3KUZA 2Y5CA 3W5VB 4TQ0A 1KOTA 1XLOA 2N9EB 4X57B 1JQ4A 2VZKB 5EDSA 1WJUA 2ASQA 3L08A 2M0XA 4B0MA 3HK0A 3BK1A 4W9KA 5IOIA 4Q2JA 3WAOA 3KH0A 2XEWA 4JX1C 3EC8A 1AYFA 2QEJC 5H92C 4C56C 3E9SA 3H7PA 1R4MI 2KFJA 3QA8A 3TBLD 1E7PB 4F7ZA 2MJ3A 2Q5WD 1NYRA 3IFWB 3VXWA 1Z5SB 3IHPC 3EGRA 2KDEB 1QF6A 1FCCC 3WIMA 4C4VA 1Z2MA 4US9A 3VRBB 3DVNV 3V62A 1TS2A 2N9XA 3AE8B 4GB9A 5G5GA 4A3OA 2JWUA 4DHJB 2IO0B 1ZKHA 2ZJDA 1WFYA 5BYRA 3MTNB 4M02A 2Y5BB 3N32A 1MHHE 1ZPSA 1YX5B 3A9JA 2BWES 3HM3A 4CYEA 1YX6B 3KW5B 2KVZA 4PT5A 1KM7A 2NVUI 3OAWA 3E56A 4GMVA 4FADA 3JSVA 1MHXA 2O2VB 1L0XB 1SEBD 2I1KA 3DVNU 2W82A 1LGRA 3VTVA 3TCAA 2WX0A 1NDDA 5E6JA 2JXXA 3ZNHB 2UU7A 2JYTA 4XE0A 4GDKB 5D3IB 1OTRB 1J7AA 3UINB 4HKQA 2RD0A 2J42A 4TSSA 5G5HA 1T0QC 1ZDVA 4PS8A 1SE4A 3L54A 1MVKA 4HPPA 2KWVB 2DAJA 4XGAB 3I9V1 3BIID 1R4MB 1DGJA 5HFYA 2CR5A 1T0SC 1WYGA 2XN9C 4FBJB 3ALBA
chains in the Genus database with same CATH topology
2L52A 1Y56A 1TS5A 3KWVA 3SR6A 1PUTA 1E9MA 4ARCA 2WP9B 2RMMA 1ESFA 2INNE 4H2AA 5JXVA 2WU5B 2CJNA 2PIAA 4HJGE 5C2TB 1V1OA 1GB1A 1I4PA 2LHDA 1ET9A 1PDXA 4B0EA 1AN8A 1VZ7A 2DYOA 3HVDA 4GDLB 4P16A 3AE5B 4YXDB 1YQ4B 1I7HA 4OW0A 2RDGA 3AE9B 4JE3B 1Q10A 3TUOA 2QMTA 4GLSC 2LEKA 4OVZA 3MJ5A 1JWUD 2WS3B 3AECB 4NAMA 4TQ1A 2EELA 1YJJA 3Q8FA 1R7SA 1L6UA 2WXQA 1EU4A 1FIQA 2JXTA 1MPEA 1QILA 3R2TA 4JWUC 4XDCA 1ZOYB 1PYWD 5GXGB 2NMQA 2WU2B 2V3PA 3C8YA 4KKJA 1N5WA 2L1AA 4RF1A 2SAKA 2FBWB 3NVYA 1TS4A 1OQRA 3FC4A 2DYMA 2DLBA 3AE6B 3IT4B 1L0VB 4RGNA 4WQMA 2BS4B 2AX5A 1SJED 1E6EB 4YTNB 3OWEB 2E6XA 1CZPA 3GS2A 4ZRQA 1JWAD 1KLGD 3FILB 1EWYC 4IKGA 4OZCA 4ZHOA 4LTUA 3RPFC 1IGDA 2KN4A 3R2IA 4MH8A 2MH7A 1VR9A 3HUIA 3Q8AA 2EKIA 1L6VA 2WXFA 3P4QB 2K5PA 4LLGM 2JZPA 5AUIA 1QOGA 5BYQA 2BBCA 5MPOA 4RGTA 1N62A 2VZKD 3ZQ4A 3VRAB 1ET6A 1N5XA 1D4BA 2LGIA 1SE3A 2WXLA 1RYJA 3Q8BA 4L23A 1OFFA 3P4PB 1C9FA 1VDVA 4HROA 2ONQA 3CWIA 1WGKA 4RF0A 4UDUC 2IJ0A 1F2RI 2M19A 1ZP0B 4ZYSA 2DBYA 3AE4B 1UWMA 3EA6A 1DOIA 3P4SB 1FNUA 1FEHA 1E10A 3O13A 1J7BA 1UGJA 3ZGZA 4XDDA 2W3SA 1XLQA 3V05A 2BS2B 5EE0A 2N9KA 3BVMA 5FR3A 1K51A 1QKZA 1YMHE 1GB4A 4IOIE 2H89B 4ARIA 3CIRB 3BYTB 4WURA 3VQIA 3U7ZA 1SBBB 1C79A 1C77A 3FILA 3IT6B 2W3RA 4A55A 2LMCA 1J7CA 3NUHB 3ZJUA 1L0YB 2TSSA 3NVWA 1XEEA 3PZ7A 3NS1A 3PZ8A 3H8HA 1JWBD 1F77A 2R61A 3AEFB 3BVGA 1XXGA 1KLUD 1FMAD 1SE2A 1JALA 1N60A 1YN5A 1L4DB 3AE1B 4KGSA 1CK1A 4L2YA 1D5ZC 5LNK1 2ZW1A 3AN1A 3SFEB 1QLBB 3SEBA 1AWDA 1I4XA 1KH0A 3Q8CA 2E3TA 1HZ6A 4ZRPA 5FK9C 4O1NA 3AEEB 3V3XA 4EE2A 4HEA1 2H88B 1C4PA 1VRAB 3WCQA 3EUB2 4WAFA 1SIJA 2QILA 4OHJA 1NVID 1JMLA 1YN3A 3LXFA 3AB5A 1HQRD 2RDHA 1PGXA 4RH6A 1FFVA 3MC0B 1ZUD2 2WXNA 2BYTA 2I2YA 5HI1A 1ZXIA 3AE2B 1QQRA 2WXOA 3TEYA 1OQQA 1DYQA 4L1BA 2LHEA 1XO3A 3SFDB 4AQ7A 3TEZA 2K3UA 2YEPF 3Q69A 1MI0A 4YSZB 2ZW0A 2NTTA 1D5XC 2FUG1 2W8HA 2N7JA 4J3OD 2SEBD 2YEPB 3W2DA 3T3NA 1P7FA 3B2GA 3B9JA 4LK0M 1EM7A 1IBXA 2QSDA 1V8CA 1DOXA 3MP9A 1QOFA 3LYYA 2J4XA 2BT6A 2D5GA 3NVVA 2V0GA 4C7ZA 1SB3C 1VZ8A 3N9YC 1RWSA 1TJEA 2AQ2B 2LUMA 2WXMA 1RM6C 3J9CA 5H8YE 3KWLA 1K52A 3MHZA 3AMZA 2MJEA 1WWTA 1XCTL 2GB1A 3P42A 1FFUA 1VZ6A 2IGGA 3AEBB 3BZDB 4OZBA 1QOAA 2JSVX 2DWQA 3NVZA 5HG2A 1T3QA 1A70A 1QOBA 4IDIA 3IAM1 1NEKB 1KRHA 1XF5L 2MJDA 4HKZE 5I4DA 3HRDD 5C3JB 5AUKA 2AQ1B 4TMAB 1T6BX 2I38A 3MFGA 2X38A 2W55A 2WLBA 5FKAC 1L4ZB 4WWMA 4YTMB 1IUEA 1BXTA 2WQYB 2PVOD 3R8BA 4YSXB 1FNVA 2WXJA 3DWMA 1QT9A 2IPKD 4OZAA 2JX5A 3KQ4A 5BYSA 1EWCA 4ZOHC 3BK2A 2J53A 1I4RA 1SXTA 2ON8A 1ZXHA 1SF0A 1ROEA 2GI9A 3AE7B 4MM3B 2G1EA 3P1MA 1XLPA 2WNMA 2LFIA 5TSSA 4YWGG 2K22A 4A6QA 1F2RC 2RPVA 4YT0B 1GPXA 3W1SA 1UNSA 4C7YA 1M4VA 3NZ3A 2PKOA 3P4RB 4CQNA 1TZOA 4WIPA 1FD6A 1HZ5A 1TYGB 4YSYB 5D7GA 3GB1A 3UI3A 4ZHPA 5EE9A 4KKIA 3HVZA 4N6EB 4JPSA 1WXQA 2INPE 1T5XD 3Q8EA 1N61A 1I4HA 1FCLA 2XNAC 2N0SB 4DQOC 1FNWA 2PW9A 4MT5A 4AS1A 4KX6B 2KDMA 2BB6A 3TEXA 1TKGA 1YQ3B 1ACCA 1WRIA 4MACA 1JRPA 4FXCA 3KLSX 4NAWB 1KFYB 2WXHA 3ZYYX 1NENB 1EU3A 3AV8A 4RGMA 2HDEA 2JYEA 2L32A 4M0WA 2NTSA 5EE1A 1YN4A 3FAHA 1NYQA 1FO4A 2WXRA 1C4AA 1GOZA 2IDYA 2PVGC 2WXKA 2G9HD 3TSSA 1V1PB 2K0PA 2WXPA 4RGOS 1BUIC 1ENFA 4WH4A 3IAS1 1B9RA 2QIEB 1FXIA 1GAQB 4N59A 2J58A 1B1ZA 3IXSA 1K50A 1KF6B 1V1PA 2GRIA 4US8A 1K53A 2ACZB 4KGRA 1SSNA 1KTKA 4N58A 2HTME 3ETRA 1PFDA 1FRRA 5D3DA 1LO5D 3VR8B 3PO0A 1JCKB 1D5MC 3GP7A 3I57A 4C80A 2K9XA 2V3NA 2KAJA 3DWGC 2Y5CA 3W5VB 4R3DA 4TQ0A 2LJIA 1D6EC 3RFZB 1IGCA 1XLOA 4RNAA 1NI3A 2PTLA 4DXFA 1JQ4A 2VZKB 1HEZE 2WDQB 2QJLA 4P6VF 1TKYA 4HRSA 4XWWA 4RCOA 1PGAA 5HHDG 4B0MA 2L83A 1BMLC 1FM0D 3BK1A 3NRZA 1TY0A 3P63A 3U52E 1TKEA 4Q2JA 1SJHD 2KQ4X 2OHFA 4JX1C 1C76A 2IGHA 1AYFA 2QEJC 5H92C 1ZE3D 4C56C 3E9SA 1E0ZA 5BMIA 3ABVB 3U4EG 1L5PA 4RFBA 1UWXA 1DOYA 3W5UB 1HA5A 1E7PB 2JU6X 3BVZA 2WDRB 3AH7A 1C78A 2MEKA 2CJOA 2MJ3A 2Q5WD 1NYRA 3EGRA 3L4PA 3U2SC 4D2KA 1QF6A 1FCCC 2M56B 1VLBA 3VRBB 4US9A 4DXGA 2BB5A 4NJCA 4REZA 2KWDA 1TS2A 4YTPB 2J52A 1UUPA 3AE8B 4A90A 3BYYB 1YJIA 5G5GA 1JROA 1IBXB 3W9CB 2JWUA 2Z8LA 2N9LA 5BYRA 1YNTE 4A9AA 3LB8C 2Y3AA 5EE3A 1ZDXA 1V97A 2M0AA 1FRDA 1HXYD 1MHHE 2ICIA 2FE8A 1ZPSA 1P7EA 3ZJTA 1I4GA 4ITKA 2CU3A 5BMGA 1XLNA 3TEWA 2IGDA 2BW2A 2KACA 1JWMD 4PT5A 1CQVA 1F0ZA 3E56A 4JWSC 1N63A 1VJKA 1MHXA 4USAA 1L0XB 1SEBD 2W82A 2PMVA 2BS3B 3AEDB 2BTEA 2WDVB 2WXIA 3B2FA 5E6JA 4A8XC 1JW9D 3ZJVA 2JYTA 4NZLB 4XE0A 4GDKB 5D3IB 1PGBA 3BWUD 3AEGB 5T8IA 1J7AA 1XCQL 3URYA 2AQ3B 1JWSD 2Y5PA 5BMHA 2V4IB 4HKQA 3VR9B 2WXGA 2J42A 1TY2A 2PLPA 4TSSA 5G5HA 3T3OA 3AE3B 1ZDVA 1STEA 1SE4A 1MVKA 2W8IA 2OEDA 3I9V1 3BIID 1FXAA 1CJEA 4XWTA 4KGTA 2W54A 1RFKA 1WSPA 1DGJA 5HFYA 1C4CA 1I4QA 2B76B 1WYGA 2XN9C 3AM9A 2KMMA 1AW7A 3AEAB 1TS3A 2JQRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8I A;  2W8H A;  2J58 A;  3P42 A; 
#chains in the Genus database with same CATH topology
 1WRD B;  5L83 A;  3AU5 A;  5JXV A;  2CS4 A;  2WU5 B;  2MX2 A;  2KD0 A;  3ZDM C;  1E5W A;  1WZ0 A;  1I4P A;  1ET9 A;  4B0E A;  1AN8 A;  2D11 A;  4P16 A;  4DK5 A;  3AE5 B;  2RDG A;  1L2N A;  1SIF A;  1UZX B;  2LEK A;  2QDF A;  4WAA A;  2O2V A;  4TQ1 A;  4JLC A;  1WE7 A;  1WY8 A;  1L6U A;  4J6I A;  1I35 A;  3MJW A;  4QAY A;  3DBR B;  5DPR A;  4C00 A;  2DAF A;  4JWU C;  4XDC A;  4C4V B;  1PYW D;  5GXG B;  2NBU A;  2WU2 B;  3C8Y A;  4RF1 A;  2SAK A;  3NVY A;  1TS4 A;  3KUD B;  2DYM A;  4MGY E;  1L0V B;  2AX5 A;  1E6E B;  1UD7 A;  1CZP A;  4ZHO A;  4IKG A;  5JHA A;  4MH8 A;  2MH7 A;  1S3S G;  3ZVV A;  2M8S A;  3HUI A;  1L6V A;  2JZP A;  5AUI A;  2WX1 A;  3PS6 A;  1N62 A;  2VZK D;  4W9C A;  3VRA B;  1ET6 A;  1N5X A;  4PS3 A;  3DBL I;  5CHW A;  4L23 A;  1OFF A;  1Q5W B;  2KVR A;  4P7I A;  2ONQ A;  3CWI A;  1F2R I;  4ZYS A;  2DBY A;  3WAL A;  2IY0 B;  1FEH A;  3O13 A;  2W3S A;  3PZD A;  3BVM A;  5FR3 A;  5AZF A;  1QKZ A;  3GZN B;  2H89 B;  2R2O A;  4RMA A;  3VQI A;  1TT5 B;  5LXH A;  1C79 A;  3RD2 A;  2BF8 B;  1Q0W B;  2IYD B;  2FCQ A;  2ZVO A;  2TSS A;  3NVW A;  3PZ8 A;  5J17 A;  3AEF B;  3BVG A;  2MLB A;  1N60 A;  3WAM A;  3AE1 B;  3CMM B;  4IC7 B;  2CU1 A;  3SFE B;  1QLB B;  2IO3 B;  3JVZ X;  3A4S C;  3PLU A;  2KTF A;  4M0W B;  3QQ8 B;  3RNB C;  1V6E A;  4ZRP A;  5FK9 C;  3DHG C;  4O1N A;  3Q3O C;  2H88 B;  2NPT B;  2BGF A;  2QIL A;  1R4N I;  4GSW A;  1NVI D;  1JML A;  3LXF A;  4LNK A;  3Q3J A;  1HQR D;  4DHJ D;  1N6Z A;  2NS5 A;  4I6P A;  4RH6 A;  4W9L A;  3CST A;  1ZUD 2;  2L00 B;  4JIO U;  3Q2A C;  1E7V A;  3TEY A;  1OQQ A;  1DYQ A;  2LHE A;  2IZV B;  1IPG A;  1XO3 A;  4GN1 A;  4AQ7 A;  4WWP A;  2YEP F;  3Q69 A;  4HDQ A;  2NTT A;  2N7J A;  3DPD A;  2SEB D;  1KJT A;  2YEP B;  1H4R A;  3B2G A;  1P9D U;  4LK0 M;  3K9P B;  3VVW B;  4IWP A;  2BT6 A;  2LXC A;  4C7Z A;  1SB3 C;  1VZ8 A;  2AQ2 B;  1WWT A;  3NJT A;  2A5U A;  1QOA A;  2DWQ A;  2KJR A;  2KQ7 A;  3FKY A;  3ENE A;  1KRH A;  1RRB A;  1XQQ A;  2VRR B;  3HRD D;  5C3J B;  2MBE A;  2AQ1 B;  2GBK A;  2WQY B;  1OQY A;  2PVO D;  3R8B A;  2WXJ A;  4BKS D;  1E8X A;  1QT9 A;  5BYS A;  3KQ4 A;  3UQA A;  2OOB B;  3BK2 A;  1SXT A;  3QX1 A;  1ZXH A;  2GI9 A;  2FAZ A;  4IWQ A;  3SDL C;  3P1M A;  1J8C A;  2K8B A;  4EFO A;  3W1S A;  1UNS A;  4CQN A;  3NZ3 A;  4PYU A;  3K9O B;  1FD6 A;  5D7G A;  1WXM A;  5EE9 A;  3NS8 A;  4NY0 A;  3B08 A;  1I4H A;  2N0S B;  1FNW A;  4KX6 B;  2BB6 A;  1VCB A;  3H6N A;  4MSQ B;  1TKG A;  1WRI A;  4ZRK A;  2N9P C;  4MAC A;  3KLS X;  3ZNI D;  2RPQ A;  2WXH A;  3ZYY X;  3NZS A;  1NYQ A;  2WXK A;  2PVG C;  2K39 A;  2G9H D;  3TSS A;  2K25 A;  2WXP A;  4RGO S;  2G45 B;  1BUI C;  1ENF A;  1RLF A;  2KOX A;  5IA7 A;  3IAS 1;  1FXI A;  1GAQ B;  1B1Z A;  2LJ5 A;  1V1P A;  5IP4 D;  4WJO A;  4W9H A;  2YLM A;  1K53 A;  2RR9 A;  1V86 A;  1LO5 D;  1JCK B;  3I57 A;  3GP7 A;  4C80 A;  1WM2 A;  2K9X A;  4II2 B;  4AJY B;  4R3D A;  2L3Z A;  1D6E C;  3RFZ B;  3V60 A;  4G0N B;  4DXF A;  2MBO A;  1RAX A;  2WDQ B;  2QJL A;  4XWW A;  4RCO A;  2C9W B;  5HHD G;  1Y8R C;  1BML C;  2KYW A;  2KMA A;  2OHF A;  5DPT A;  1A5R A;  2IGH A;  1ZE3 D;  4S17 A;  3ABV B;  2V4L A;  3A4R A;  4RFB A;  1WXS A;  1DOY A;  3W5U B;  2KNB A;  2A4Z A;  2CJO A;  5E6P A;  3B1L X;  3VUX A;  2M56 B;  2V9H A;  2EMT A;  4HCN B;  4REZ A;  4YTP B;  2J52 A;  4A90 A;  1HTO A;  1IBX B;  3W9C B;  2Z8L A;  2N9L A;  4A9A A;  4NQL B;  3GZN I;  2J7Q B;  1V97 A;  4LNO A;  2M0A A;  1SE9 A;  2FE8 A;  1P7E A;  2RDB C;  2CU3 A;  3DBS A;  2JF5 A;  4EEW A;  1M94 A;  2KAC A;  2LVP A;  4ZRJ A;  3ZRC A;  3GE3 C;  4JWS C;  4USA A;  5G2N A;  2MRP A;  2BS3 B;  1H8C A;  4KVG B;  2AL6 A;  4NZL B;  1PGB A;  5T8I A;  1LFD A;  2KWU B;  3URY A;  4F1S A;  2LVQ A;  2V4I B;  2WXG A;  3ZKJ C;  1TY2 A;  3N1Z C;  3RN9 C;  2X8X X;  3AE3 B;  5CTR C;  2W8I A;  2OED A;  1RFK A;  1C4C A;  3V61 A;  2B76 B;  3AM9 A;  2KMM A;  1C76 A;  1AW7 A;  2KMC A;  4GOC A;  4DHZ E;  2JQR B;  5CHV C;  5J18 A;  2LGS A;  3SR6 A;  1PUT A;  4ARC A;  1GNU A;  1ESF A;  2INN E;  4H2A A;  5DCN A;  3BIN A;  1V1O A;  2UYZ B;  2G4S A;  4K1R B;  4GDL B;  2RGF A;  1I7H A;  4NQK E;  1YD8 U;  3X0W A;  3AE9 B;  3TMP B;  2PEA A;  5AZG A;  3TUO A;  2LUE A;  2MQJ A;  1JWU D;  1AAR A;  1TGZ B;  3DDC B;  1FIQ A;  2JXT A;  1MPE A;  1L7Y A;  1WXA A;  2MBH A;  3H1U A;  3N20 C;  3EHV A;  2NMQ A;  4MEM A;  1MG8 A;  2V3P A;  2L1A A;  1MG4 A;  3FC4 A;  3L0W B;  3AE6 B;  3ZRF A;  1G6J A;  2BS4 B;  5HKH A;  1SJE D;  3OWE B;  3GS2 A;  3FIL B;  1EWY C;  4LTU A;  3RPF C;  4ANX A;  3Q14 C;  2LGX A;  4AP4 C;  2KWC A;  2HJ8 A;  2WXF A;  2K5P A;  4LLG M;  1QOG A;  2BBC A;  4RGT A;  2GBJ A;  4HLE A;  2DZI A;  3PVL A;  1D4B A;  3S2A A;  1GG3 A;  1FXT B;  3P4P B;  5BO4 B;  4WJN A;  1WGK A;  1X1M A;  2DZJ A;  4UDU C;  2IJ0 A;  1WMH B;  2M19 A;  4WWN A;  3EA6 A;  3PPA A;  4NJ6 A;  4FJZ A;  3A9J B;  3ZGZ A;  4XDD A;  1XLQ A;  1WZ3 A;  4IG7 B;  4EZL A;  1K51 A;  4G50 A;  4ARI A;  2AEH A;  2C7N B;  4ICV A;  3FIL A;  2V1Y A;  3NUH B;  2JZZ A;  1T0Y A;  4XX5 A;  3H8H A;  1JWB D;  4FLH A;  1KLU D;  1FMA D;  1SE2 A;  4AWJ A;  4BOZ B;  2PE9 A;  1JAL A;  3AUL A;  1YN5 A;  3I5J C;  2FCS A;  4KGS A;  1OEY A;  5JHB A;  4HDO A;  5D6J B;  2ZW1 A;  3AN1 A;  4MJS B;  3SEB A;  1KH0 A;  2E3T A;  4EE2 A;  4HEA 1;  1C4P A;  1VRA B;  2C5L C;  3WCQ A;  1SIJ A;  3DVG X;  2EMS A;  3AB5 A;  3M95 A;  1WE6 A;  3N1X C;  3MC0 B;  2WXN A;  2BYT A;  2I2Y A;  4E74 A;  3N30 A;  2DZM A;  5IN7 A;  1QQR A;  3VDZ A;  4K7U A;  4L1B A;  1C3T A;  3TEZ A;  4E3C A;  3DBL B;  2KDB A;  2K6D B;  2L7R A;  4ANW A;  3W2D A;  3T3N A;  3ONS A;  3B9J A;  4KDL B;  1DOX A;  3MP9 A;  3OJ4 B;  1QOF A;  3QCA A;  2C7H A;  3A1Q B;  4K7W A;  4AUQ C;  1VD2 A;  1RWS A;  3B0A A;  3J9C A;  3KWL A;  3MHZ A;  4BVU C;  3AMZ A;  1P3Q U;  4W9E A;  3N1Y C;  1FFU A;  2D2Q A;  3SHQ A;  2JPH A;  1QOB A;  4IDI A;  3IAM 1;  4KZ0 A;  1XF5 L;  4M01 A;  2MJD A;  4HKZ E;  2KZR A;  2ZCB A;  4TMA B;  1T6B X;  2WLB A;  4WWM A;  4YTM B;  1BXT A;  3UF8 A;  2FUH B;  4BBN C;  2KDI A;  2WHI A;  3DOW A;  2LZ6 A;  3W1Y A;  1I4R A;  1WGY A;  4KIK A;  4MM3 B;  2M4N A;  2BPS A;  3WA0 A;  2K22 A;  1GPX A;  1WI0 A;  3JW0 X;  1TZO A;  1HZ5 A;  1TZ1 A;  4KKI A;  5D94 A;  3M63 B;  4K3C A;  4A3P A;  1K8R B;  2XNA C;  4PS7 A;  5IO9 A;  1UBI A;  4DQO C;  4WJP A;  2PW9 A;  2L8J A;  2XK5 B;  1YQ3 B;  2HJ1 A;  2BVC A;  2L05 A;  4M8N A;  3C0R B;  4LCD E;  2FID A;  1UEL A;  3APD A;  4W9I A;  3QJZ A;  2GBR A;  4BKT A;  2I1J A;  2JYE A;  5EE1 A;  4CO7 A;  1HTQ A;  1FO4 A;  3QAQ A;  1EO6 A;  3H7P B;  1GOZ A;  2MSE D;  1V1P B;  2QIE B;  2J58 A;  1WYW B;  3IXS A;  1K50 A;  2ACZ B;  4S0R A;  1WJ4 A;  5D3D A;  3DWG C;  1F52 A;  4IM2 A;  1EF5 A;  2LJI A;  1EF1 A;  1NI3 A;  4GIV A;  3RZW C;  3ZW3 A;  2K8C A;  2FNJ B;  3UIO B;  4DXA B;  1TKY A;  4HRS A;  1PGA A;  1QZE A;  4TUU A;  1FM0 D;  3NRZ A;  3P63 A;  1TKE A;  2JVC A;  3OJ3 A;  1GC6 A;  4FA6 A;  2BQQ A;  2D3A A;  3HIZ A;  2KK8 A;  3U4E G;  2NR2 A;  1L5P A;  1V81 A;  3T9L A;  3AH7 A;  1C78 A;  4BOS C;  2MEK A;  3AI5 A;  3LJ3 A;  3DVG Y;  4D2K A;  4K81 A;  4DXG A;  2ZNV C;  2BB5 A;  2KWD A;  4GDL A;  2IO1 B;  3BYY B;  4FN2 A;  4OVV A;  3PRE A;  4K7S A;  3LB8 C;  2Y3A A;  5IKC M;  1FRD A;  2ICI A;  3ZJT A;  2BYV E;  4GDK A;  4FHK A;  4MGI E;  2Z0D B;  4ITK A;  3AEA B;  4LNI A;  4XZ4 A;  1XLN A;  3TEW A;  2IGD A;  2BW2 A;  2C7M B;  3R7R A;  1JWM D;  3UGB B;  4HJK A;  4DBG A;  4RM8 A;  2O6V A;  1F0Z A;  3ZUN A;  1VJK A;  3PTF C;  1WX7 A;  4BKS A;  4KSL C;  3AED B;  3M62 B;  2BTE A;  4MJS A;  4A8X C;  3BWU D;  3AEG B;  1XCQ L;  4B95 A;  2KFK A;  2AQ3 B;  1JWS D;  3L10 B;  4PYZ A;  4B6W A;  2KTR A;  3L17 A;  2KXJ A;  1BT0 A;  2K8H A;  3DBR I;  3APC A;  1CJE A;  4XWT A;  4KGT A;  4IW0 A;  3EFC A;  2K6Q A;  2JZ3 B;  4KIK B;  2L52 A;  1TS5 A;  2D3C A;  3ZTC A;  2OJW A;  1E9M A;  2RMM A;  2D07 B;  3RNE C;  2CJN A;  2D3B A;  5GMV A;  1GB1 A;  5DPS A;  2LGY A;  2JT4 B;  2DYO A;  3HVD A;  4YXD B;  4HCP B;  1YQ4 B;  4OW0 A;  3I63 C;  2LGD A;  4JE3 B;  1Q10 A;  4OVZ A;  4NAM A;  1RFA A;  2EEL A;  3Q8F A;  3JSV B;  2WXQ A;  4BKG A;  3PHW B;  3KYD D;  3QK0 A;  1QIL A;  3R2T A;  3DCG A;  1V9J A;  5J2R A;  1N5W A;  1E8W A;  2LRU A;  4GU2 A;  1OQR A;  3TJP A;  2DLB A;  4RGN A;  4WQM A;  4EUT A;  4OZC A;  3NOB A;  2L0T A;  2INC C;  2QHO A;  3RNC C;  3RT3 B;  3Q8A A;  3DBH B;  3P4Q B;  5AZH A;  1WR6 E;  5BYQ A;  5MPO A;  4XC2 A;  1WJ6 A;  3A9K A;  4URK A;  2N1V A;  2WXL A;  3H7S A;  4MGK E;  4E71 A;  3Q8B A;  1WMH A;  3OLM D;  1E8Z A;  2DNF A;  3NZU A;  4HRO A;  4A20 A;  2REX A;  1UWM A;  1DOI A;  3EEC A;  3P4S B;  1FNU A;  1ISN A;  2G3Q B;  5G55 A;  3V05 A;  2BS2 B;  5EE0 A;  4IWO A;  2NCN A;  1GB4 A;  3BYT B;  4ANV A;  2AL3 A;  1P98 A;  4WUR A;  3VAW A;  1ZGU B;  1C77 A;  3IT6 B;  4BAX A;  2C60 A;  4A55 A;  2LMC A;  1J7C A;  3ZJU A;  2KC1 A;  3MC9 A;  3PZ7 A;  3NS1 A;  4AOF A;  1F77 A;  2R61 A;  2GMI C;  3A33 B;  1L4D B;  1CK1 A;  4L2Y A;  1D5Z C;  5LNK 1;  2J0J A;  2GBN A;  2KHW B;  4KSK C;  2BKF A;  2QCZ A;  3AEE B;  4K3B A;  3V3X A;  5CX3 A;  3DBH I;  3L16 A;  2O6V B;  4WAF A;  2KJ6 A;  2J0K A;  1IP9 A;  4KDI C;  4OHJ A;  3WAN A;  3RUI B;  3PHX B;  4M00 A;  2JRH A;  1ZXI A;  3Q6B A;  4OVU A;  3SFD B;  1OGW A;  2K3U A;  1MI0 A;  4YSZ B;  2ZW0 A;  1D5X C;  2FUG 1;  2W8H A;  2LI5 A;  1E7U A;  4YL8 A;  4ICU A;  2KDF B;  5LXI B;  1EM7 A;  4DDI D;  4EZJ A;  2QSD A;  1V8C A;  1NBF C;  1PQS A;  4GXB A;  2D5G A;  2KAN A;  2V0G A;  3R66 C;  3N9Y C;  1UBQ A;  2WXM A;  1R4N B;  3VUW A;  1K52 A;  2MJE A;  3UQB A;  4HWI B;  3CF6 E;  2JSV X;  3NY5 A;  3NVZ A;  1NEK B;  2NBW B;  1XD3 B;  5AUK A;  4HVB A;  3H9D A;  2I38 A;  3QC8 B;  3VH4 B;  1T0R C;  2NPT A;  3GOE A;  3OG5 A;  5LLI A;  2IO2 B;  1FNV A;  3HHM A;  2JY6 A;  5IAA C;  5E6O A;  3DWM A;  4OZA A;  2JX5 A;  1EWC A;  2IND C;  4ZOH C;  5E6N A;  1KLV A;  2KJH B;  2J53 A;  2ON8 A;  1SF0 A;  1ROE A;  1SGH A;  1WR1 A;  2BYE A;  3AE7 B;  2G1E A;  4LDT B;  4ZRI A;  2M1M A;  3UIP B;  1XLP A;  4YWG G;  3LDZ E;  1E90 A;  1F2R C;  3MC8 A;  4CHK A;  4C7Y A;  2N4F A;  2EKE C;  5TR5 A;  3PRM B;  4YSY B;  2ZPN A;  4N6E B;  4JPS A;  3R7Q A;  2INP E;  1T5X D;  4MH0 E;  1N61 A;  1FCL A;  1YQB A;  2DHZ A;  4BFR A;  4MT5 A;  3TEX A;  2ZNV B;  1ACC A;  3DHH C;  2FIF A;  2IY1 B;  3AXC A;  1V2Y A;  2KO3 A;  1JRP A;  2XK5 A;  1WX8 A;  4KZC A;  3AU4 A;  2XBB C;  2D3G A;  4NAW B;  2ZPY A;  2FCN A;  1EU3 A;  3AV8 A;  4RGM A;  1LM8 B;  2L32 A;  2NTS A;  4ANU A;  4NNJ B;  1V5T A;  2OJR A;  2IDY A;  3VUY A;  2MP2 A;  4WH4 A;  2PJH A;  2JRI B;  3T8M A;  4DHZ B;  3BY4 B;  2Z0E B;  2KQS A;  4XYC A;  5C23 A;  4KGR A;  2J0M A;  3ETR A;  1PFD A;  5FR6 A;  3PO0 A;  4LDT D;  1D5M C;  2R2Q A;  2V3N A;  2KAJ A;  2MBB B;  1IGC A;  4NAW A;  3V6C B;  4RNA A;  2LXA A;  2PTL A;  4MEL A;  1HEZ E;  2GOW A;  1CMX B;  4P6V F;  3SD5 A;  2L83 A;  3U52 E;  1TY0 A;  1SJH D;  2KQ4 X;  4FUL A;  2BYF A;  3ZIM A;  1E0Z A;  3ML9 A;  5BMI A;  4WWO A;  1UWX A;  2L0F A;  3TL5 A;  3VFK A;  3NG0 A;  1HA5 A;  2MCN B;  2JU6 X;  4EZK A;  3BVZ A;  2WDR B;  2ZEQ A;  1J19 A;  4DWF A;  4IUM B;  2LWP A;  1V49 A;  4HPM B;  1OEY J;  4I6N B;  3L4P A;  4HPL B;  3U2S C;  5D2M B;  4B9K A;  3PT2 B;  1VLB A;  2O6V D;  1C1Y B;  4NJC A;  3KUC B;  1UUP A;  3L13 A;  3RNG C;  1YJI A;  3IBE A;  1JRO A;  4W9D A;  4W9J A;  4LJP B;  3X23 A;  1YNT E;  1GUA B;  4ASW C;  5EE3 A;  4NPN A;  1ZDX A;  1HXY D;  4W9F A;  5DPW A;  3I3T B;  1I4G A;  2JWZ A;  3C19 A;  4LNN A;  5BMG A;  4FHJ A;  4MSM B;  2AYO B;  2RSU A;  2D10 A;  1CQV A;  1WIA A;  1YOV B;  1N63 A;  3TIX A;  2FCM A;  3ZLZ A;  2PMV A;  1LXD A;  3DHI C;  1F1H A;  2WDT B;  2WDV B;  2WXI A;  3B2F A;  2N7D A;  2LAS A;  1JW9 D;  3ZJV A;  4JL9 A;  2Y5P A;  4G11 A;  5BMH A;  3W1S C;  2DEN B;  1WX9 A;  3VR9 B;  3NHE B;  2MWS B;  4IM3 A;  2PLP A;  3MHS D;  3T3O A;  1STE A;  2KFK B;  3A1Q A;  3ZXR A;  2KX3 A;  1FXA A;  2KTR B;  4RM9 A;  1JRU A;  2W54 A;  1F9J A;  4IM0 A;  3RCZ A;  2HD5 B;  1Q1O A;  1WSP A;  3O65 B;  3SU8 X;  1YIW A;  2CHZ A;  1I4Q A;  1U4A A;  2N1W A;  4ZYN A;  4I6L B;  4MM3 A;  1TS3 A;  3Q3F A;  1Y56 A;  2V3S A;  3ZDT A;  3KWV A;  2PPH A;  2WP9 B;  5JH5 C;  2QC8 A;  2PIA A;  4HJG E;  5C2T B;  4PK1 A;  1WGD A;  1LQB A;  1PDX A;  2DYB A;  2LHD A;  3Q3N C;  1VZ7 A;  1E8Y A;  1D3Z A;  3RNF C;  2QMT A;  4GLS C;  3MJ5 A;  2WS3 B;  3AEC B;  1YJJ A;  1NI2 A;  1R7S A;  4BBN F;  1EU4 A;  3DQV A;  2WWZ A;  4P1B C;  4ZDV A;  3R3M A;  1P0R A;  1ZOY B;  3APF A;  4KKJ A;  5L95 C;  2FBW B;  4N9F 4;  2DX5 B;  3IT4 B;  3JYU A;  2IBI B;  4YTN B;  2E6X A;  4ZRQ A;  1JWA D;  1KLG D;  1IGD A;  2WGS A;  2KN4 A;  2HE7 A;  3PGE A;  3R2I A;  3VHT C;  2LRW A;  1VR9 A;  2M17 A;  2EKI A;  4MGZ E;  1GC7 A;  1WXV A;  2HTH A;  2CHX A;  2L76 A;  1P1A A;  3ZQ4 A;  2LGI A;  1SE3 A;  1RYJ A;  2K1F A;  4LNF A;  1WGH A;  1C9F A;  1VDV A;  4RF0 A;  2KN5 A;  4WJQ A;  2VH2 A;  1ZP0 B;  4GGQ A;  3AE4 B;  1E10 A;  1J7B A;  1UGJ A;  2N9K A;  2NBV B;  1YMH E;  4IOI E;  1GJZ A;  3A9K B;  1FPY A;  3RZF A;  3CIR B;  1HE8 A;  3U7Z A;  3RUL A;  1SBB B;  2W3R A;  2Z59 B;  1L0Y B;  5C1Z A;  1XEE A;  3QHT A;  2YVC A;  1XXG A;  3IVF A;  3N3K B;  3U8Z A;  3P2B A;  4HXD A;  2MA9 B;  3ZXV A;  1V5O A;  4ACF A;  1UGM A;  1AWD A;  2ZCC A;  3RNA C;  1I4X A;  4BZA A;  3Q8C A;  1HZ6 A;  4HK2 A;  3PRZ A;  2KLG A;  3EUB 2;  4FJV B;  3ZTD A;  4AJW A;  2CKH B;  1YN3 A;  3QWZ B;  1UF0 A;  2RDH A;  2CHW A;  1PGX A;  1WGR A;  1FFV A;  2GBM A;  1WJN A;  2MBQ A;  5HI1 A;  3HM6 X;  2BKR B;  3AE2 B;  2WXO A;  3RMK C;  4P1C C;  1WH3 A;  3EFU A;  2ZZP B;  1S1Q B;  3ML8 A;  4KV2 A;  2DZK A;  3PLV A;  4J3O D;  4FJY A;  1P7F A;  2B3A A;  5KHQ A;  1IBX A;  1V80 A;  5KHO A;  4G3X B;  3LYY A;  2MW5 A;  2KLC A;  3PSE B;  2J4X A;  2GLS A;  3NVV A;  1IYF A;  1TJE A;  2LUM A;  3KVF B;  1RM6 C;  5H8Y E;  1XCT L;  2GB1 A;  3P42 A;  4WQO B;  3U30 A;  1I42 A;  1VZ6 A;  2IGG A;  3AEB B;  3PV1 A;  3BZD B;  4OZB A;  5HG2 A;  1T3Q A;  1A70 A;  3CSF A;  1WF9 A;  2LD9 A;  2W9N A;  5I4D A;  1ZW7 A;  3VTW A;  3MFG A;  2X38 A;  2W55 A;  5FKA C;  3M3J A;  3D32 A;  1L4Z B;  2AWT A;  4F8C B;  1IUE A;  3V6E B;  1TIF A;  4YSX B;  1WM3 A;  3ZO5 B;  4M8M A;  3Q3M C;  2IPK D;  3QAR A;  2BWF A;  3ZNZ B;  4JQW C;  2WYQ A;  5CHF A;  4MDK E;  2KX0 A;  3PRP B;  2KC2 A;  1MFW A;  2WNM A;  2KKC A;  2LFI A;  3QIJ A;  5TSS A;  4A6Q A;  1MJD A;  2N7E A;  2RPV A;  4YT0 B;  1J0G A;  5AEK B;  1M4V A;  3P4R B;  2PKO A;  4WIP A;  1TYG B;  2JUO A;  3ZNG C;  3GB1 A;  3UI3 A;  4ZHP A;  2PE6 B;  3HVZ A;  1WXQ A;  4TKN A;  3Q8E A;  3RI7 C;  3RYT A;  3VTU A;  2ZVN A;  4AS1 A;  3GE8 C;  2KDM A;  4NJ7 A;  4LJO B;  4JGH B;  1UH6 A;  4FXC A;  3VH3 B;  2UWQ A;  1KFY B;  1TBE A;  4TV3 A;  2KT7 A;  5JZE B;  1NEN B;  3U7D A;  2HDE A;  3KYC D;  4M0W A;  4W9G A;  1YN4 A;  1YJ1 A;  2G4D B;  3FAH A;  2WXR A;  1C4A A;  1WGG A;  1EUV B;  4DDG D;  3ECI A;  3WAP A;  2K0P A;  4EKU A;  1TTN A;  2VH1 A;  1B9R A;  4EOY A;  4N59 A;  4II3 B;  1KF6 B;  2MHJ A;  1XT9 B;  2GRI A;  2MP2 B;  4US8 A;  3IG3 A;  1SSN A;  1KTK A;  4N58 A;  2HTM E;  1FRR A;  2LVO A;  3VR8 B;  3KUZ A;  2Y5C A;  3W5V B;  4TQ0 A;  1KOT A;  1XLO A;  2N9E B;  4X57 B;  1JQ4 A;  2VZK B;  5EDS A;  1WJU A;  2ASQ A;  3L08 A;  2M0X A;  4B0M A;  3HK0 A;  3BK1 A;  4W9K A;  5IOI A;  4Q2J A;  3WAO A;  3KH0 A;  2XEW A;  4JX1 C;  3EC8 A;  1AYF A;  2QEJ C;  5H92 C;  4C56 C;  3E9S A;  3H7P A;  1R4M I;  2KFJ A;  3QA8 A;  3TBL D;  1E7P B;  4F7Z A;  2MJ3 A;  2Q5W D;  1NYR A;  3IFW B;  3VXW A;  1Z5S B;  3IHP C;  3EGR A;  2KDE B;  1QF6 A;  1FCC C;  3WIM A;  4C4V A;  1Z2M A;  4US9 A;  3VRB B;  3DVN V;  3V62 A;  1TS2 A;  2N9X A;  3AE8 B;  4GB9 A;  5G5G A;  4A3O A;  2JWU A;  4DHJ B;  2IO0 B;  1ZKH A;  2ZJD A;  1WFY A;  5BYR A;  3MTN B;  4M02 A;  2Y5B B;  3N32 A;  1MHH E;  1ZPS A;  1YX5 B;  3A9J A;  2BWE S;  3HM3 A;  4CYE A;  1YX6 B;  3KW5 B;  2KVZ A;  4PT5 A;  1KM7 A;  2NVU I;  3OAW A;  3E56 A;  4GMV A;  4FAD A;  3JSV A;  1MHX A;  2O2V B;  1L0X B;  1SEB D;  2I1K A;  3DVN U;  2W82 A;  1LGR A;  3VTV A;  3TCA A;  2WX0 A;  1NDD A;  5E6J A;  2JXX A;  3ZNH B;  2UU7 A;  2JYT A;  4XE0 A;  4GDK B;  5D3I B;  1OTR B;  1J7A A;  3UIN B;  4HKQ A;  2RD0 A;  2J42 A;  4TSS A;  5G5H A;  1T0Q C;  1ZDV A;  4PS8 A;  1SE4 A;  3L54 A;  1MVK A;  4HPP A;  2KWV B;  2DAJ A;  4XGA B;  3I9V 1;  3BII D;  1R4M B;  1DGJ A;  5HFY A;  2CR5 A;  1T0S C;  1WYG A;  2XN9 C;  4FBJ B;  3ALB A; 
#chains in the Genus database with same CATH homology
 2L52 A;  1Y56 A;  1TS5 A;  3KWV A;  3SR6 A;  1PUT A;  1E9M A;  4ARC A;  2WP9 B;  2RMM A;  1ESF A;  2INN E;  4H2A A;  5JXV A;  2WU5 B;  2CJN A;  2PIA A;  4HJG E;  5C2T B;  1V1O A;  1GB1 A;  1I4P A;  2LHD A;  1ET9 A;  1PDX A;  4B0E A;  1AN8 A;  1VZ7 A;  2DYO A;  3HVD A;  4GDL B;  4P16 A;  3AE5 B;  4YXD B;  1YQ4 B;  1I7H A;  4OW0 A;  2RDG A;  3AE9 B;  4JE3 B;  1Q10 A;  3TUO A;  2QMT A;  4GLS C;  2LEK A;  4OVZ A;  3MJ5 A;  1JWU D;  2WS3 B;  3AEC B;  4NAM A;  4TQ1 A;  2EEL A;  1YJJ A;  3Q8F A;  1R7S A;  1L6U A;  2WXQ A;  1EU4 A;  1FIQ A;  2JXT A;  1MPE A;  1QIL A;  3R2T A;  4JWU C;  4XDC A;  1ZOY B;  1PYW D;  5GXG B;  2NMQ A;  2WU2 B;  2V3P A;  3C8Y A;  4KKJ A;  1N5W A;  2L1A A;  4RF1 A;  2SAK A;  2FBW B;  3NVY A;  1TS4 A;  1OQR A;  3FC4 A;  2DYM A;  2DLB A;  3AE6 B;  3IT4 B;  1L0V B;  4RGN A;  4WQM A;  2BS4 B;  2AX5 A;  1SJE D;  1E6E B;  4YTN B;  3OWE B;  2E6X A;  1CZP A;  3GS2 A;  4ZRQ A;  1JWA D;  1KLG D;  3FIL B;  1EWY C;  4IKG A;  4OZC A;  4ZHO A;  4LTU A;  3RPF C;  1IGD A;  2KN4 A;  3R2I A;  4MH8 A;  2MH7 A;  1VR9 A;  3HUI A;  3Q8A A;  2EKI A;  1L6V A;  2WXF A;  3P4Q B;  2K5P A;  4LLG M;  2JZP A;  5AUI A;  1QOG A;  5BYQ A;  2BBC A;  5MPO A;  4RGT A;  1N62 A;  2VZK D;  3ZQ4 A;  3VRA B;  1ET6 A;  1N5X A;  1D4B A;  2LGI A;  1SE3 A;  2WXL A;  1RYJ A;  3Q8B A;  4L23 A;  1OFF A;  3P4P B;  1C9F A;  1VDV A;  4HRO A;  2ONQ A;  3CWI A;  1WGK A;  4RF0 A;  4UDU C;  2IJ0 A;  1F2R I;  2M19 A;  1ZP0 B;  4ZYS A;  2DBY A;  3AE4 B;  1UWM A;  3EA6 A;  1DOI A;  3P4S B;  1FNU A;  1FEH A;  1E10 A;  3O13 A;  1J7B A;  1UGJ A;  3ZGZ A;  4XDD A;  2W3S A;  1XLQ A;  3V05 A;  2BS2 B;  5EE0 A;  2N9K A;  3BVM A;  5FR3 A;  1K51 A;  1QKZ A;  1YMH E;  1GB4 A;  4IOI E;  2H89 B;  4ARI A;  3CIR B;  3BYT B;  4WUR A;  3VQI A;  3U7Z A;  1SBB B;  1C79 A;  1C77 A;  3FIL A;  3IT6 B;  2W3R A;  4A55 A;  2LMC A;  1J7C A;  3NUH B;  3ZJU A;  1L0Y B;  2TSS A;  3NVW A;  1XEE A;  3PZ7 A;  3NS1 A;  3PZ8 A;  3H8H A;  1JWB D;  1F77 A;  2R61 A;  3AEF B;  3BVG A;  1XXG A;  1KLU D;  1FMA D;  1SE2 A;  1JAL A;  1N60 A;  1YN5 A;  1L4D B;  3AE1 B;  4KGS A;  1CK1 A;  4L2Y A;  1D5Z C;  5LNK 1;  2ZW1 A;  3AN1 A;  3SFE B;  1QLB B;  3SEB A;  1AWD A;  1I4X A;  1KH0 A;  3Q8C A;  2E3T A;  1HZ6 A;  4ZRP A;  5FK9 C;  4O1N A;  3AEE B;  3V3X A;  4EE2 A;  4HEA 1;  2H88 B;  1C4P A;  1VRA B;  3WCQ A;  3EUB 2;  4WAF A;  1SIJ A;  2QIL A;  4OHJ A;  1NVI D;  1JML A;  1YN3 A;  3LXF A;  3AB5 A;  1HQR D;  2RDH A;  1PGX A;  4RH6 A;  1FFV A;  3MC0 B;  1ZUD 2;  2WXN A;  2BYT A;  2I2Y A;  5HI1 A;  1ZXI A;  3AE2 B;  1QQR A;  2WXO A;  3TEY A;  1OQQ A;  1DYQ A;  4L1B A;  2LHE A;  1XO3 A;  3SFD B;  4AQ7 A;  3TEZ A;  2K3U A;  2YEP F;  3Q69 A;  1MI0 A;  4YSZ B;  2ZW0 A;  2NTT A;  1D5X C;  2FUG 1;  2W8H A;  2N7J A;  4J3O D;  2SEB D;  2YEP B;  3W2D A;  3T3N A;  1P7F A;  3B2G A;  3B9J A;  4LK0 M;  1EM7 A;  1IBX A;  2QSD A;  1V8C A;  1DOX A;  3MP9 A;  1QOF A;  3LYY A;  2J4X A;  2BT6 A;  2D5G A;  3NVV A;  2V0G A;  4C7Z A;  1SB3 C;  1VZ8 A;  3N9Y C;  1RWS A;  1TJE A;  2AQ2 B;  2LUM A;  2WXM A;  1RM6 C;  3J9C A;  5H8Y E;  3KWL A;  1K52 A;  3MHZ A;  3AMZ A;  2MJE A;  1WWT A;  1XCT L;  2GB1 A;  3P42 A;  1FFU A;  1VZ6 A;  2IGG A;  3AEB B;  3BZD B;  4OZB A;  1QOA A;  2JSV X;  2DWQ A;  3NVZ A;  5HG2 A;  1T3Q A;  1A70 A;  1QOB A;  4IDI A;  3IAM 1;  1NEK B;  1KRH A;  1XF5 L;  2MJD A;  4HKZ E;  5I4D A;  3HRD D;  5C3J B;  5AUK A;  2AQ1 B;  4TMA B;  1T6B X;  2I38 A;  3MFG A;  2X38 A;  2W55 A;  2WLB A;  5FKA C;  1L4Z B;  4WWM A;  4YTM B;  1IUE A;  1BXT A;  2WQY B;  2PVO D;  3R8B A;  4YSX B;  1FNV A;  2WXJ A;  3DWM A;  1QT9 A;  2IPK D;  4OZA A;  2JX5 A;  3KQ4 A;  5BYS A;  1EWC A;  4ZOH C;  3BK2 A;  2J53 A;  1I4R A;  1SXT A;  2ON8 A;  1ZXH A;  1SF0 A;  1ROE A;  2GI9 A;  3AE7 B;  4MM3 B;  2G1E A;  3P1M A;  1XLP A;  2WNM A;  2LFI A;  5TSS A;  4YWG G;  2K22 A;  4A6Q A;  1F2R C;  2RPV A;  4YT0 B;  1GPX A;  3W1S A;  1UNS A;  4C7Y A;  1M4V A;  3NZ3 A;  2PKO A;  3P4R B;  4CQN A;  1TZO A;  4WIP A;  1FD6 A;  1HZ5 A;  1TYG B;  4YSY B;  5D7G A;  3GB1 A;  3UI3 A;  4ZHP A;  5EE9 A;  4KKI A;  3HVZ A;  4N6E B;  4JPS A;  1WXQ A;  2INP E;  1T5X D;  3Q8E A;  1N61 A;  1I4H A;  1FCL A;  2XNA C;  2N0S B;  4DQO C;  1FNW A;  2PW9 A;  4MT5 A;  4AS1 A;  4KX6 B;  2KDM A;  2BB6 A;  3TEX A;  1TKG A;  1YQ3 B;  1ACC A;  1WRI A;  4MAC A;  1JRP A;  4FXC A;  3KLS X;  4NAW B;  1KFY B;  2WXH A;  3ZYY X;  1NEN B;  1EU3 A;  3AV8 A;  4RGM A;  2HDE A;  2JYE A;  2L32 A;  4M0W A;  2NTS A;  5EE1 A;  1YN4 A;  3FAH A;  1NYQ A;  1FO4 A;  2WXR A;  1C4A A;  1GOZ A;  2IDY A;  2PVG C;  2WXK A;  2G9H D;  3TSS A;  1V1P B;  2K0P A;  2WXP A;  4RGO S;  1BUI C;  1ENF A;  4WH4 A;  3IAS 1;  1B9R A;  2QIE B;  1FXI A;  1GAQ B;  4N59 A;  2J58 A;  1B1Z A;  3IXS A;  1K50 A;  1KF6 B;  1V1P A;  2GRI A;  4US8 A;  1K53 A;  2ACZ B;  4KGR A;  1SSN A;  1KTK A;  4N58 A;  2HTM E;  3ETR A;  1PFD A;  1FRR A;  5D3D A;  1LO5 D;  3VR8 B;  3PO0 A;  1JCK B;  1D5M C;  3GP7 A;  3I57 A;  4C80 A;  2K9X A;  2V3N A;  2KAJ A;  3DWG C;  2Y5C A;  3W5V B;  4R3D A;  4TQ0 A;  2LJI A;  1D6E C;  3RFZ B;  1IGC A;  1XLO A;  4RNA A;  1NI3 A;  2PTL A;  4DXF A;  1JQ4 A;  2VZK B;  1HEZ E;  2WDQ B;  2QJL A;  4P6V F;  1TKY A;  4HRS A;  4XWW A;  4RCO A;  1PGA A;  5HHD G;  4B0M A;  2L83 A;  1BML C;  1FM0 D;  3BK1 A;  3NRZ A;  1TY0 A;  3P63 A;  3U52 E;  1TKE A;  4Q2J A;  1SJH D;  2KQ4 X;  2OHF A;  4JX1 C;  1C76 A;  2IGH A;  1AYF A;  2QEJ C;  5H92 C;  1ZE3 D;  4C56 C;  3E9S A;  1E0Z A;  5BMI A;  3ABV B;  3U4E G;  1L5P A;  4RFB A;  1UWX A;  1DOY A;  3W5U B;  1HA5 A;  1E7P B;  2JU6 X;  3BVZ A;  2WDR B;  3AH7 A;  1C78 A;  2MEK A;  2CJO A;  2MJ3 A;  2Q5W D;  1NYR A;  3EGR A;  3L4P A;  3U2S C;  4D2K A;  1QF6 A;  1FCC C;  2M56 B;  1VLB A;  3VRB B;  4US9 A;  4DXG A;  2BB5 A;  4NJC A;  4REZ A;  2KWD A;  1TS2 A;  4YTP B;  2J52 A;  1UUP A;  3AE8 B;  4A90 A;  3BYY B;  1YJI A;  5G5G A;  1JRO A;  1IBX B;  3W9C B;  2JWU A;  2Z8L A;  2N9L A;  5BYR A;  1YNT E;  4A9A A;  3LB8 C;  2Y3A A;  5EE3 A;  1ZDX A;  1V97 A;  2M0A A;  1FRD A;  1HXY D;  1MHH E;  2ICI A;  2FE8 A;  1ZPS A;  1P7E A;  3ZJT A;  1I4G A;  4ITK A;  2CU3 A;  5BMG A;  1XLN A;  3TEW A;  2IGD A;  2BW2 A;  2KAC A;  1JWM D;  4PT5 A;  1CQV A;  1F0Z A;  3E56 A;  4JWS C;  1N63 A;  1VJK A;  1MHX A;  4USA A;  1L0X B;  1SEB D;  2W82 A;  2PMV A;  2BS3 B;  3AED B;  2BTE A;  2WDV B;  2WXI A;  3B2F A;  5E6J A;  4A8X C;  1JW9 D;  3ZJV A;  2JYT A;  4NZL B;  4XE0 A;  4GDK B;  5D3I B;  1PGB A;  3BWU D;  3AEG B;  5T8I A;  1J7A A;  1XCQ L;  3URY A;  2AQ3 B;  1JWS D;  2Y5P A;  5BMH A;  2V4I B;  4HKQ A;  3VR9 B;  2WXG A;  2J42 A;  1TY2 A;  2PLP A;  4TSS A;  5G5H A;  3T3O A;  3AE3 B;  1ZDV A;  1STE A;  1SE4 A;  1MVK A;  2W8I A;  2OED A;  3I9V 1;  3BII D;  1FXA A;  1CJE A;  4XWT A;  4KGT A;  2W54 A;  1RFK A;  1WSP A;  1DGJ A;  5HFY A;  1C4C A;  1I4Q A;  2B76 B;  1WYG A;  2XN9 C;  3AM9 A;  2KMM A;  1AW7 A;  3AEA B;  1TS3 A;  2JQR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...