3P42A

Structure of gfcc (ymcb), protein encoded by the e. coli group 4 capsule operon
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
QGMVTIYLPGEQQTLSVGPVENVAQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWLAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia coli Group 4 Capsule Protein GfcC Reveals a Domain Organization Resembling That of Wza.
pubmed doi rcsb
source organism Escherichia coli o127:h6
molecule tags Unknown function
molecule keywords Predicted protein
total genus 56
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.700 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p42A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 3p42A03
2W8HA 2W8IA 3P42A 2J58A
chains in the Genus database with same CATH superfamily
5BYRA 4K1RB 2WXIA 2CKHB 4ICUA 2ZVNA 1N5WA 1E9MA 2G4SA 3NG0A 3K9PB 3FILA 3W5UB 2NVUI 4IKGA 5AZFA 1JWMD 3ETRA 4OVZA 2WDQB 4ZRJA 2WHIA 1EF5A 1GNUA 1MJDA 4BKGA 1MG8A 2CJOA 2L32A 3EFCA 3RMKC 3U30A 5AZHA 4DQOC 2JVCA 2JWUA 4RH6A 1AARA 4LK0M 2DZIA 2N1WA 3VTWA 5D6JB 4RM8A 3WAPA 5D3IB 4N59A 4YT0B 2BVCA 3X23A 1IUEA 4AP4C 2EKEC 1TKEA 4UDUC 4LCDE 5G55A 1F77A 3Q3JA 2YEPB 2DYOA 3AE7B 3C8YA 2NCNA 4RF0A 1CMXB 3VR8B 1YJIA 1E7UA 2KANA 4MACA 3W1YA 1TS2A 2R61A 3ALBA 2AX5A 4KDIC 1T6BX 1C77A 2PIAA 3GB1A 2CHWA 1A70A 1KJTA 4MM3A 3SR6A 4LNNA 4MGZE 2G4DB 2BB5A 4WWNA 3TBLD 1QLBB 2TSSA 2ZW0A 4MJSA 4OZBA 2D3CA 1VZ7A 4XX5A 2QEJC 3DVGY 1B1ZA 2MRPA 3EC8A 3W1SC 3LXFA 3DQVA 2NBUA 1TY2A 2KWDA 1XQQA 2IY0B 1QKZA 1UWXA 3JYUA 4JWSC 3PZ8A 3NS8A 2VRRB 4B0EA 4RF1A 1V2YA 4W9GA 4HDOA 4QAYA 3ZRFA 2WXLA 1HEZE 3Q3OC 1SBBB 1N62A 1ZXIA 3H7PB 2GI9A 3KW5B 3GS2A 2PW9A 3L10B 4ZDVA 4TKNA 4E74A 2Q5WD 3RNAC 2W82A 3PRZA 4H2AA 1D5ZC 1WFYA 3WCQA 1F9JA 1HXYD 3L0WB 4BFRA 3AEEB 2L00B 3H6NA 4OW0A 2K25A 4E3CA 1EM7A 1FRRA 2KDIA 3N32A 3VFKA 4JGHB 1ISNA 2LJ5A 1VZ6A 1RAXA 2GBKA 3PZ7A 1Z5SB 4WQOB 1TIFA 2WXQA 3KUZA 5IAAC 4KGRA 3HRDD 4FULA 5GXGB 1VRAB 4LLGM 4YTNB 4IM3A 4WJPA 3KWVA 3R7RA 1JALA 4IUMB 1J7BA 3DDCB 3R7QA 3ZQ4A 4IDIA 4GLSC 2KJRA 3NZUA 3N1ZC 1PFDA 3DBLI 3NOBA 3ZLZA 4FJVB 2KN4A 2BWFA 3QJZA 3PREA 1I4PA 1XO3A 2L05A 3PLVA 3ONSA 3GOEA 2VZKD 3W1SA 1VDVA 3HK0A 2MEKA 2HTHA 1ET6A 4I6LB 1ZDXA 1LQBA 2N9PC 2LI5A 4OVUA 4RMAA 3O65B 1WJ4A 3T9LA 3N1XC 3ZJTA 4KSKC 3ZXRA 2HDEA 2WXHA 1UUPA 2INCC 1WX9A 2EKIA 3A4RA 3ZTDA 5CX3A 4XDDA 1E8XA 1DYQA 2D5GA 1QT9A 1FXIA 2HJ1A 3ML9A 2AL3A 4ANVA 4KX6B 2KJ6A 3BK1A 3AH7A 2ZJDA 3NUHB 1V80A 1LXDA 1LGRA 3RUIB 5LXHA 4W9EA 2FE8A 4MGKE 1VCBA 2G9HD 2DENB 4GSWA 3RCZA 4DDGD 1V1OA 2DAJA 3HVDA 3IAM1 2LGSA 2MBQA 3AI5A 3P2BA 1UF0A 3LJ3A 2EELA 4GGQA 4HJKA 2C7MB 2RGFA 3DHIC 3DVNV 2L76A 4MEMA 4NNJB 2WX0A 3RN9C 1V8CA 2D3GA 4XE0A 1TZ1A 2MSED 1GC7A 1C4CA 2SEBD 2LGIA 1WGKA 2GOWA 1KLGD 4LNKA 5D7GA 4AWJA 4XC2A 4ZHPA 3M95A 4PYUA 1TKYA 5G2NA 2Z0EB 1OQRA 1FRDA 3I9V1 3TEXA 5HHDG 3EA6A 2IGHA 2KDFB 3JW0X 2WXPA 2R2OA 3MC8A 4E71A 1YQBA 4ICVA 3NJTA 4N58A 3A9JA 3QIJA 2D07B 2XK5B 1STEA 1L6UA 1WXVA 2K3UA 4XDCA 5FR3A 1TTNA 3L16A 3ZXVA 1F52A 5AUKA 4HPLB 2ZPYA 2WXGA 4WQMA 3OG5A 1SJED 3PTFC 3AEBB 2ON8A 4M02A 2G1EA 1RFKA 4WWOA 3CMMB 2J4XA 3I63C 2X8XX 3MJWA 1L7YA 4II3B 1KH0A 2JXTA 2Y5BB 1AYFA 3A1QA 2BKFA 3FILB 1YQ3B 1WGYA 3WANA 3TIXA 1C79A 2IPKD 4NAMA 5DCNA 2HTME 3E56A 2WLBA 2N9KA 1E8YA 2BS3B 2K6DB 2OJRA 4IWOA 2FNJB 4WJOA 2C7HA 2HD5B 2WXFA 2Y5PA 2WP9B 2OEDA 2V4LA 3VH3B 1FM0D 4HPMB 1JCKB 5BYSA 2V3PA 2SAKA 2L1AA 4ZHOA 1TY0A 5AEKB 4EZLA 1YN4A 3AEGB 4HK2A 1ROEA 4KIKA 4HWIB 3IVFA 1VJKA 5C23A 1T3QA 3J9CA 3MFGA 3R2TA 5L83A 4JE3B 1WR1A 2BTEA 2GLSA 3FKYA 2XNAC 1R4MB 1ZKHA 1FNWA 2D10A 4BZAA 2C60A 3CF6E 3V05A 1XF5L 2QJLA 3APCA 2WS3B 4M0WB 4DXAB 4M00A 3A33B 2BB6A 2R2QA 4OZCA 1F2RI 1AN8A 1I4XA 1XD3B 4EUTA 1V9JA 2FCNA 1T0QC 1MVKA 3AXCA 4W9DA 1GPXA 3VUWA 2JRIB 3B2GA 1K53A 2M0AA 2LFIA 2J0JA 3BYTB 2PJHA 2JY6A 3AB5A 4B6WA 4C7YA 1XCTL 2N1VA 2KTRA 4N6EB 3IXSA 1RLFA 2OJWA 3GE3C 2L0TA 2PEAA 1IBXA 2FCSA 1M94A 2WXJA 4I6NB 1NDDA 3TL5A 4J6IA 3DBHB 5JHAA 1NBFC 1JMLA 1LO5D 2WXNA 1I4HA 2DYMA 3OJ4B 3QC8B 4LJPB 5BMHA 5C1ZA 1ET9A 4HKQA 4A8XC 2ICIA 1Q5WB 4NJ7A 1J19A 2WU2B 4B9KA 3QA8A 2CR5A 1YOVB 5JHBA 1CK1A 3RNFC 1NI2A 4XWTA 3ZO5B 2BT6A 5MPOA 2RMMA 1WE6A 4ZRPA 3AEDB 1SJHD 2I2YA 2RR9A 3DCGA 5E6JA 4DWFA 3TUOA 1N5XA 5E6OA 4FN2A 1CZPA 4CYEA 3N30A 2PKOA 5CTRC 2QILA 1TZOA 4BKTA 2KYWA 3KUDB 3TMPB 1BMLC 1V5TA 1K50A 2QSDA 4YSXB 2J53A 4KGSA 3DWGC 2UYZB 3P4SB 3R3MA 4IM2A 1WY8A 2KVRA 2IJ0A 4JLCA 1JRPA 3RNEC 3KUCB 2O6VA 3BIID 3PS6A 4C80A 2IYDB 3DBLB 1JRUA 1WZ0A 4N9F4 1JWBD 1EO6A 4REZA 2LXAA 3B2FA 1S3SG 4KIKB 2DX5B 1V81A 3AEAB 3FAHA 3ZJVA 2LVPA 3DBRB 3AULA 4DHJB 2N4FA 1RFAA 3IFWB 3PZDA 1WXAA 3SDLC 4ZYNA 4R3DA 1NYRA 2N7DA 1WJNA 5FKAC 1EUVB 4LTUA 2REXA 2PPHA 3UF8A 1KOTA 1I7HA 1D6EC 5DPRA 4RFBA 1OQQA 2J52A 2MBBB 2I1JA 3Q3FA 1UBIA 4WAFA 2L52A 1K8RB 2QMTA 4ZRKA 2N7EA 1WJUA 2BQQA 3KWLA 1WE7A 3EECA 1QOAA 2O2VA 2KFKA 4BAXA 2MP2B 5HFYA 1KF6B 4MSQB 3UGBB 4IWQA 4CQNA 2KZRA 4HPPA 2M1MA 3VAWA 3FC4A 3PSEB 1V86A 3AE1B 3KH0A 3PRMB 4G11A 4NQKE 2D3AA 1BXTA 1M4VA 1UD7A 3B9JA 2NBVB 2M56B 3P63A 2IZVB 3Q3NC 1FFUA 2IO3B 4EKUA 2WXMA 4C4VA 3I57A 3ZNID 3PHWB 3AE2B 2W8IA 1MI0A 4WJQA 2IGGA 3ABVB 1B9RA 3NVZA 2K8HA 2MX2A 1XLPA 3QAQA 4LNFA 3UQAA 3R66C 3M3JA 3Q8EA 3V3XA 1WGHA 3QX1A 3A9KB 1YIWA 2WDTB 4GN1A 1C78A 1L4DB 3PO0A 3L4PA 4KV2A 1NVID 3NZ3A 2K1FA 2K8CA 1YD8U 2LUMA 4DHJD 2DBYA 1H4RA 2LJIA 3LYYA 4ITKA 3PGEA 4PS7A 2IO0B 4TQ1A 2M17A 2AQ3B 3IAS1 4ACFA 4FBJB 2ZCBA 2J58A 3ZUNA 3MHSD 5IKCM 2K5PA 3Q14C 1QZEA 3OWEB 5LXIB 4YWGG 1SSNA 1SIFA 4NQLB 2JYEA 2DNFA 1EF1A 2DLBA 1V49A 2UU7A 4A9AA 1L4ZB 2KK8A 3AU5A 5IOIA 2VH1A 1P7EA 3GP7A 1OFFA 2PVOD 1QF6A 3U7DA 5J2RA 4BKSA 4CO7A 3QCAA 2JT4B 2ZNVC 4USAA 3OJ3A 4DXGA 4G50A 4F7ZA 3HM6X 2NTSA 1GG3A 1P7FA 3NY5A 1D4BA 4W9HA 5D2MB 3W9CB 1P9DU 1ZDVA 4TMAB 5JXVA 5D94A 2MJEA 2LWPA 1XLQA 1PGBA 4JIOU 5E6NA 2J0MA 4HRSA 1TS5A 2WDRB 4TQ0A 2LRUA 1YJJA 1XLOA 4JX1C 4WURA 1F0ZA 5EE1A 2K8BA 2BYVE 1HQRD 4EOYA 1R7SA 3UI3A 1WF9A 1SB3C 1FEHA 1RRBA 1OGWA 3V62A 1SE3A 4OVVA 2H88B 2NMQA 1SIJA 4NZLB 1WXMA 4GDKB 3T3OA 3DVNU 2KNBA 2JXXA 3MC9A 1T5XD 4P1CC 5EE3A 3SFDB 3SD5A 2FIFA 4AUQC 3ZNHB 1JW9D 2JUOA 4G0NB 2N9XA 3H7PA 1ZE3D 2G45B 3EUB2 3A1QB 2GBNA 4HCNB 3TEZA 3HUIA 3M62B 1KM7A 5H8YE 4KKJA 3BWUD 4C00A 1J7AA 4MH0E 2GBRA 1GB4A 1WXQA 2JZ3B 2KVZA 2G3QB 4M8MA 1TT5B 4GXBA 2EMSA 5KHQA 1HZ6A 2BKRB 2DZMA 1GOZA 1GAQB 3VTVA 4KSLC 4KKIA 3BVZA 4LJOB 1UWMA 2QDFA 1G6JA 3QQ8B 5DPWA 3A4SC 2DZJA 4PYZA 2DHZA 4J3OD 2FCMA 3RI7C 3SEBA 4MELA 2YEPF 3KYCD 5KHOA 3U2SC 3GZNI 5LNK1 1L0YB 1X1MA 2XEWA 3VH4B 3ZGZA 3KYDD 4HXDA 1DGJA 2GRIA 3TJPA 4FXCA 2M8SA 4PS3A 2MJ3A 2B3AA 4FA6A 5JZEB 1XT9B 2C7NB 1RYJA 2ONQA 3S2AA 2ACZB 1WYGA 1QOFA 4MSMB 1I42A 4TUUA 4WAAA 2DAFA 4HJGE 3RNBC 3ZNZB 2KX3A 2J7QB 2KQ7A 2LGYA 2M4NA 3QWZB 4O1NA 3QARA 3B08A 2RD0A 4HCPB 2KMCA 2A5UA 3CWIA 3V60A 3PPAA 3Q6BA 3BY4B 4BVUC 1SEBD 2B76B 2JWZA 3AE3B 1HTQA 2BF8B 3CSFA 2WU5B 2KC1A 5H92C 2BGFA 5CHVC 3DHHC 1TYGB 1QILA 2X38A 1R4NB 3CIRB 3ECIA 2PTLA 2KLCA 3BZDB 3DBRI 3M63B 1PGAA 5AUIA 3ZRCA 3ML8A 4ASWC 3U8ZA 4C4VB 2ZW1A 1GC6A 5IA7A 1E7PB 4US9A 2GBJA 3WALA 5HI1A 3ZYYX 2WYQA 2YLMA 1UELA 4YTPB 1ZPSA 3MHZA 1WI0A 1RWSA 4FHJA 2BW2A 3AV8A 3AM9A 1OQYA 4P6VF 4BOSC 1FMAD 4YL8A 1HZ5A 1FD6A 2NR2A 2K39A 2LVQA 1WX8A 1L0VB 3UQBA 3QK0A 2A4ZA 4A3PA 4YSYB 4NJCA 5I4DA 3VUYA 1IP9A 5C2TB 1N61A 3TCAA 4K3CA 5GMVA 2Y5CA 1C1YB 2KDBA 2KKCA 1Q1OA 2WDVB 3JSVA 3L54A 2KDEB 4KVGB 2RDGA 2LVOA 4C7ZA 1V1PB 2Z8LA 2MCNB 4B95A 1WMHB 5G5GA 4EEWA 1NYQA 4MJSB 3RNCC 3U7ZA 1WR6E 2MA9B 3L08A 1UGMA 3E9SA 3HM3A 1MHHE 1T0YA 2FAZA 2Z0DB 2IBIB 2V9HA 1N63A 4MM3B 2CS4A 2L7RA 2VH2A 3WAMA 3N9YC 2WXOA 4RCOA 5G5HA 4L2YA 3UINB 1LFDA 2AYOB 3AMZA 2RPQA 4MGIE 4W9KA 4K81A 3KLSX 4WWMA 2ZCCA 4YTMB 4WH4A 5EE9A 3T8MA 3PT2B 5EDSA 1IGDA 5DPSA 1WIAA 1NENB 3HVZA 4FJZA 4ZOHC 2I1KA 1TBEA 1WGDA 2JU6X 1L6VA 4AJYB 3WIMA 1FO4A 3ZW3A 3ZTCA 2CHXA 3AE6B 4Q2JA 1YX5B 4X57B 4XYCA 1E6EB 3Q8CA 3X0WA 2W3RA 4I6PA 3PHXB 1WGRA 4K7SA 4NY0A 2INNE 2MBHA 5LLIA 1D3ZA 2GBMA 2QCZA 2LRWA 2L3ZA 1PQSA 3ZKJC 4CHKA 4HVBA 2KN5A 1U4AA 2PMVA 3U52E 1E7VA 1FFVA 2V3SA 1FXAA 3P4QB 2CHZA 2W8HA 3DVGX 5BMGA 2BYFA 2JF5A 3LB8C 2LHEA 3ZVVA 2NBWB 2MQJA 4LDTB 1UH6A 4HLEA 3AN1A 1DOIA 1WJ6A 2BPSA 3C0RB 2AQ1B 1SE4A 3DHGC 4PK1A 4A3OA 4G3XB 2RDHA 1D5XC 1P3QU 4W9JA 4M0WA 1WX7A 2WQYB 2WXRA 3ZJUA 4MT5A 1C3TA 1TS4A 1MG4A 3L17A 2O2VB 5BMIA 1UNSA 4IOIE 2XN9C 4AS1A 4P7IA 5IO9A 4EFOA 1FNVA 2K9XA 3A9KA 2KHWB 1CJEA 2PE9A 1KLVA 2RDBC 4LNOA 1E0ZA 1EWYC 2PVGC 1C76A 4OZAA 3DBHI 1SXTA 4FJYA 2ZNVB 3RZFA 1I35A 2W54A 1WGGA 2C5LC 1JWUD 2ZEQA 4FLHA 4IWPA 4MGYE 4RGNA 2O6VD 2WGSA 2D2QA 4ANUA 4EZJA 3T3NA 1VR9A 2IGDA 3BK2A 4JQWC 1PUTA 2GB1A 4OHJA 1NI3A 4K7UA 2KWCA 5IN7A 3IBEA 2K22A 1XEEA 3URYA 4RGMA 4GB9A 4FADA 2KO3A 2DZKA 4C56C 1HE8A 2LZ6A 3AE4B 2KC2A 4M01A 3Q69A 3ENEA 3HHMA 2NS5A 5HG2A 4A6QA 1LM8B 4NAWA 3RNGC 1L2NA 1WRIA 5TSSA 2MLBA 3SFEB 1V1PA 1UGJA 4LDTD 2KQSA 2KX0A 3Q3MC 2VZKB 1C4PA 4IC7B 3NVVA 3N3KB 1ENFA 1D5MC 2LD9A 2V1YA 1V6EA 2NPTB 3U4EG 1ESFA 2DYBA 3MJ5A 1Z2MA 2Z59B 4GDLB 1ZP0B 3WAOA 3AECB 2NTTA 3P4RB 2MW5A 1PGXA 2L0FA 4IW0A 2N9LA 3VXWA 2INDC 4MH8A 3A9JB 4W9LA 4DHZE 4L23A 3OLMD 1YN3A 4HDQA 4LNIA 1YMHE 2AEHA 1ACCA 3VRBB 1J7CA 3VHTC 4KZCA 1XCQL 1N60A 2KACA 5L95C 2JZPA 3JVZX 4NPNA 3UIOB 4KDLB 5FK9C 1VLBA 2LHDA 1IGCA 1P98A 2K6QA 3NVWA 2IY1B 3QHTA 2O6VB 3Q8FA 3C19A 1V5OA 1FNUA 3NS1A 2KFKB 2OHFA 2ZZPB 1EU3A 2LEKA 2KTFA 1R4NI 4S17A 3TEWA 1Q10A 4A55A 4B0MA 3VDZA 3Q2AC 3ZNGC 1ZOYB 2D11A 2AQ2B 2LGXA 1E5WA 2QC8A 4ZRIA 4W9FA 1H8CA 2EMTA 2AL6A 4GU2A 5C3JB 2I38A 2FBWB 2PLPA 4YSZB 1FPYA 1K51A 1XLNA 4ZYSA 3ZDTA 2KDMA 2KJHB 1JWSD 3DOWA 1ZGUB 4GDKA 2KQ4X 2W9NA 2L83A 1T0SC 2W55A 2J0KA 3VUXA 4PT5A 1QQRA 2JSVX 3I3TB 4US8A 3MP9A 3RFZB 1GJZA 4BKSD 2KD0A 1I4GA 3PLUA 2L8JA 1Y56A 2WWZA 3K9OB 3AU4A 1KLUD 4AOFA 5BYQA 4A20A 4DHZB 1IPGA 3VR9B 1WSPA 1BT0A 3NZSA 1CQVA 2XBBC 4AQ7A 3KVFB 1VZ8A 4A90A 1WMHA 2LXCA 4W9CA 2JZZA 3APDA 3V61A 2JYTA 3H8HA 1BUIC 4JL9A 1C9FA 3EFUA 2FCQA 3P4PB 1IYFA 4KGTA 4FHKA 2CU3A 3NHEB 2CU1A 1UBQA 3H1UA 2KAJA 4HROA 3RYTA 2N0SB 4GMVA 1YJ1A 5T8IA 2FUHB 1SGHA 3APFA 4ANWA 3MTNB 3AE9B 4XWWA 3BINA 4ARCA 2BS4B 3IT4B 1L0XB 1RM6C 4NJ6A 2CJNA 1IBXB 2WNMA 1Q0WB 4GOCA 4WIPA 2BS2B 3VVWB 1JQ4A 1S1QB 3AEFB 3PVLA 1J0GA 2GMIC 1HTOA 1R4MI 2ZVOA 4W9IA 1J8CA 1KRHA 1TGZB 2LGDA 3D32A 3BVMA 1E10A 1FXTB 5JH5C 3P1MA 2BBCA 2V3NA 2YVCA 2HE7A 2KOXA 1SE9A 5CHWA 5J17A 2HJ8A 3MC0B 1KTKA 2E3TA 4JWUC 2AWTA 1WH3A 5D3DA 5AZGA 1N6ZA 2MBOA 3RD2A 2D3BA 2KXJA 5TR5A 4XZ4A 1F2RC 1SE2A 1OEYA 1OEYJ 3VTUA 4D2KA 2JRHA 2J42A 4K7WA 3UIPB 2JPHA 1PYWD 2IDYA 1UZXB 3RPFC 1YX6B 1SF0A 4HKZE 2LUEA 2N7JA 3LDZE 5E6PA 3IHPC 3B1LX 2M19A 2XK5A 3IT6B 3ZIMA 4DK5A 3EHVA 3SHQA 4YXDB 2KMAA 4K3BA 2INPE 4JPSA 4ARIA 2QHOA 3NVYA 1P0RA 2PE6B 1QOGA 3TEYA 1EU4A 1I4RA 2KFJA 1QOBA 3HIZA 1FCLA 1TS3A 1E90A 3TSSA 4KZ0A 3WA0A 3IG3A 1ZXHA 2WXKA 1L5PA 1JROA 2WX1A 2JQRB 2MWSB 4BBNF 1HA5A 2KTRB 4ANXA 4IG7B 1A5RA 3CSTA 1FIQA 3L13A 3DBSA 2V0GA 5DPTA 3W5VB 2DWQA 3N1YC 3AE5B 1WXSA 1ZW7A 2MJDA 2IO2B 3R8BA 3JSVB 2NPTA 1EWCA 5CHFA 3KQ4A 1Y8RC 1E8WA 1WWTA 2W3SA 4GIVA 5IP4D 3GZNB 1TKGA 4DDID 2LMCA 1MPEA 2RSUA 4HEA1 3RT3B 5EE0A 4TV3A 3RULA 3R2IA 4RGOS 1WYWB 1NEKB 3PRPB 4RGTA 3EGRA 3H7SA 5HKHA 1WM3A 1JWAD 1YN5A 2RPVA 5FR6A 2ZPNA 2FIDA 4EE2A 2M0XA 4TSSA 1F1HA 1YQ4B 2MBEA 3PV1A 4XGAB 3BVGA 1XXGA 3P42A 1V97A 2C9WB 1TJEA 3RZWC 2BYEA 1K52A 4WWPA 1AWDA 1GB1A 4DBGA 1MFWA 4GDLA 3GE8C 4WJNA 3V6EB 4URKA 1WM2A 2K0PA 4RNAA 2MP2A 1OTRB 3O13A 2BYTA 3Q8BA 1AW7A 1E8ZA 1T0RC 2KWVB 4RM9A 4IM0A 4BBNC 1PDXA 1FCCC 1P1AA 3OAWA 3ZDMC 2UWQA 4M8NA 4L1BA 3V6CB 4F8CB 1VD2A 5J18A 3DWMA 3VRAB 4EZKA 2MH7A 4MDKE 2LASA 3I5JC 4II2B 2KWUB 1I4QA 3AE8B 2QIEB 1DOXA 4NAWB 1ZUD2 2Y3AA 2OOBB 4AJWA 3NRZA 2BWES 2KMMA 3N20C 2JX5A 4BOZB 3B0AA 2FUG1 3H9DA 1C4AA 2H89B 1WZ3A 2MHJA 3DPDA 4P1BC 4S0RA 2V4IB 2IO1B 3VQIA 2N9EB 3Q8AA 4DXFA 4P16A 1YNTE 2KLGA 4PS8A 1DOYA 3BYYB 1GUAB 1KFYB 3SU8X 2KT7A 1MHXA 2E6XA 4F1SA 2ASQA 1WRDB 4ZRQA 3W2DA 5BO4B
chains in the Genus database with same CATH topology
2XNAC 1XCQL 5BYRA 1N60A 2WXIA 4J3OD 2KACA 1N5WA 1FNWA 1E9MA 2JZPA 3V05A 1XF5L 2QJLA 3FILA 3SEBA 4IKGA 3W5UB 2WS3B 5FK9C 1JWMD 2YEPF 3ETRA 4OVZA 1VLBA 2WDQB 2LHDA 1IGCA 2BB6A 4OZCA 1F2RI 3NVWA 3U2SC 1AN8A 5LNK1 1I4XA 1L0YB 2CJOA 1MVKA 3Q8FA 2L32A 4DQOC 3ZGZA 1FNUA 3NS1A 2OHFA 1EU3A 1GPXA 1DGJA 2JWUA 1K53A 3B2GA 2GRIA 2LEKA 2M0AA 4RH6A 4FXCA 2LFIA 4LK0M 3TEWA 1Q10A 3BYTB 3AB5A 5D3IB 2MJ3A 4N59A 4YT0B 1XCTL 4A55A 4C7YA 1IUEA 4B0MA 4N6EB 1TKEA 3IXSA 1RYJA 2ONQA 2ACZB 1ZOYB 1WYGA 2AQ2B 1IBXA 4UDUC 1QOFA 1F77A 2WXJA 2YEPB 2DYOA 3AE7B 3C8YA 4RF0A 4HJGE 1JMLA 1LO5D 2WXNA 3VR8B 1I4HA 1YJIA 5C3JB 2DYMA 2I38A 4MACA 2FBWB 2PLPA 4O1NA 1TS2A 4YSZB 2R61A 1K51A 1XLNA 5BMHA 4ZYSA 1ET9A 2KDMA 3CWIA 1JWSD 2AX5A 4HKQA 4A8XC 2ICIA 1T6BX 1C77A 2PIAA 3GB1A 2KQ4X 2WU2B 1A70A 1SEBD 3SR6A 2L83A 2B76B 2W55A 3AE3B 2BB5A 4PT5A 1QQRA 2JSVX 4US8A 1CK1A 1QLBB 2WU5B 2TSSA 3MP9A 2ZW0A 3RFZB 4XWTA 5MPOA 1I4GA 2BT6A 2RMMA 4ZRPA 4OZBA 5H92C 3AEDB 1VZ7A 1Y56A 1SJHD 2I2YA 1KLUD 2QEJC 1TYGB 1QILA 2X38A 5BYQA 1B1ZA 3CIRB 5E6JA 3VR9B 1WSPA 3LXFA 3TUOA 1N5XA 2PTLA 1TY2A 2KWDA 3BZDB 1CQVA 1PGAA 4AQ7A 1CZPA 5AUIA 1QKZA 1UWXA 1VZ8A 2PKOA 4A90A 2QILA 4JWSC 3PZ8A 2ZW1A 4B0EA 4RF1A 1E7PB 1TZOA 4US9A 2JYTA 2WXLA 1HEZE 3H8HA 1BMLC 1SBBB 1BUIC 1N62A 5HI1A 3ZYYX 1C9FA 1K50A 4YTPB 2QSDA 1ZXIA 3P4PB 1ZPSA 3MHZA 4KGTA 4YSXB 2J53A 1RWSA 4KGSA 2CU3A 2BW2A 3DWGC 2GI9A 3AV8A 3GS2A 2PW9A 3AM9A 3P4SB 4P6VF 2KAJA 1FMAD 2Q5WD 4HROA 1HZ5A 2IJ0A 2W82A 1FD6A 2N0SB 1JRPA 3BIID 4C80A 5T8IA 1L0VB 4H2AA 1JWBD 4REZA 1D5ZC 3B2FA 4YSYB 3WCQA 4NJCA 5I4DA 3AE9B 1HXYD 4XWWA 5C2TB 4ARCA 1N61A 3AEAB 3AEEB 4OW0A 3FAHA 2BS4B 1EM7A 1FRRA 1L0XB 3IT4B 1RM6C 2Y5CA 3ZJVA 2CJNA 1VZ6A 1IBXB 2WNMA 2WDVB 3PZ7A 4R3DA 4WIPA 2BS2B 1JQ4A 1NYRA 2WXQA 3AEFB 2RDGA 5FKAC 4C7ZA 1V1PB 4KGRA 2Z8LA 4LTUA 3HRDD 1I7HA 1D6EC 5G5GA 5GXGB 1NYQA 1VRAB 1KRHA 4RFBA 3U7ZA 1OQQA 2J52A 4LLGM 3BVMA 1E10A 3E9SA 1MHHE 2BBCA 2V3NA 2L52A 2QMTA 3P1MA 4WAFA 4YTNB 1N63A 3KWLA 3KWVA 4MM3B 1JALA 1J7BA 1QOAA 3ZQ4A 3MC0B 4IDIA 4GLSC 1KTKA 3N9YC 2E3TA 4JWUC 2WXOA 1PFDA 4RCOA 5D3DA 5HFYA 1KF6B 5G5HA 4CQNA 4L2YA 3FC4A 2KN4A 3AMZA 1F2RC 3AE1B 1SE2A 1I4PA 4D2KA 1XO3A 3KLSX 2J42A 4WWMA 1PYWD 2VZKD 3W1SA 2IDYA 4WH4A 5EE9A 1BXTA 1M4VA 4YTMB 3B9JA 3RPFC 1VDVA 1IGDA 2M56B 1SF0A 4HKZE 2N7JA 2MEKA 3P63A 3HVZA 1ET6A 1NENB 1FFUA 2M19A 4ZOHC 3IT6B 1ZDXA 2WXMA 2JU6X 4YXDB 1L6VA 3I57A 2INPE 4JPSA 1FO4A 3AE2B 4ARIA 2W8IA 1MI0A 3AE6B 4Q2JA 3NVYA 2IGGA 3ABVB 1B9RA 1E6EB 3ZJTA 3NVZA 3Q8CA 1QOGA 1XLPA 2W3RA 2HDEA 2WXHA 3TEYA 1UUPA 2EKIA 1EU4A 1I4RA 4XDDA 2INNE 3Q8EA 1DYQA 3V3XA 1QOBA 1FCLA 2D5GA 1QT9A 1FXIA 1TS3A 1C78A 3TSSA 1L4DB 3PO0A 3L4PA 1ZXHA 2PMVA 2WXKA 1L5PA 1JROA 3BK1A 4KX6B 1NVID 1FFVA 2JQRB 3U52E 3AH7A 1HA5A 1FXAA 3NUHB 3NZ3A 3P4QB 1FIQA 2W8HA 2V0GA 3W5VB 5BMGA 3LB8C 2DWQA 2LHEA 2LUMA 2FE8A 2DBYA 2LJIA 3LYYA 4ITKA 3AE5B 3AN1A 4TQ1A 1DOIA 2AQ3B 3IAS1 2MJDA 2J58A 2G9HD 2AQ1B 3R8BA 1SE4A 1EWCA 1V1OA 3KQ4A 3HVDA 3IAM1 2K5PA 3OWEB 2RDHA 1D5XC 2EELA 1WWTA 4M0WA 4YWGG 2W3SA 1SSNA 2WQYB 2WXRA 3ZJUA 1TKGA 4MT5A 1TS4A 2JYEA 2DLBA 1V8CA 2LMCA 4A9AA 1L4ZB 4XE0A 1MPEA 1C4CA 2SEBD 2LGIA 4HEA1 1WGKA 5EE0A 1P7EA 1KLGD 3R2IA 5BMIA 3GP7A 1OFFA 1UNSA 4IOIE 4RGOS 2PVOD 1QF6A 2XN9C 4AS1A 5D7GA 1FNVA 1NEKB 2K9XA 4RGTA 3EGRA 1CJEA 4USAA 4DXGA 4ZHPA 1JWAD 2NTSA 1YN5A 1P7FA 1TKYA 2RPVA 1E0ZA 1EWYC 2PVGC 1C76A 4OZAA 1D4BA 4EE2A 1SXTA 1OQRA 4TSSA 1FRDA 1YQ4B 3W9CB 2W54A 3I9V1 5HHDG 3TEXA 3EA6A 2IGHA 1ZDVA 4TMAB 2WXPA 5JXVA 3BVGA 2MJEA 1JWUD 1XLQA 1XXGA 3P42A 1PGBA 1V97A 1TJEA 4RGNA 4N58A 4HRSA 1TS5A 2WDRB 4TQ0A 1K52A 1YJJA 1AWDA 1XLOA 1GB1A 3T3NA 1STEA 1VR9A 1L6UA 4JX1C 2IGDA 4WURA 1F0ZA 3BK2A 2K3UA 5EE1A 4XDCA 1PUTA 2GB1A 5FR3A 2K0PA 4OHJA 4RNAA 5AUKA 1HQRD 1NI3A 3O13A 2BYTA 2WXGA 3Q8BA 1R7SA 3UI3A 4WQMA 1AW7A 1XEEA 2K22A 3URYA 4RGMA 1SB3C 1FEHA 1SJED 3AEBB 2ON8A 2G1EA 1SE3A 1PDXA 2H88B 1FCCC 4C56C 1RFKA 2NMQA 1SIJA 4NZLB 3AE4B 4GDKB 3T3OA 2J4XA 4L1BA 1T5XD 1KH0A 3Q69A 2JXTA 1AYFA 5HG2A 5EE3A 4A6QA 3DWMA 3FILB 3SFDB 1YQ3B 3VRAB 1C79A 1JW9D 2MH7A 2IPKD 4NAMA 1WRIA 1ZE3D 5TSSA 3SFEB 1I4QA 3EUB2 1V1PA 2HTME 2WLBA 2N9KA 1UGJA 2BS3B 3AE8B 3E56A 2QIEB 1DOXA 4NAWB 3TEZA 2VZKB 1ZUD2 1C4PA 2Y3AA 2WXFA 3HUIA 2Y5PA 3NRZA 2WP9B 2OEDA 5H8YE 3NVVA 1FM0D 4KKJA 3BWUD 2KMMA 1J7AA 1JCKB 1D5MC 1ENFA 2V3PA 5BYSA 2JX5A 2SAKA 2L1AA 3U4EG 1ESFA 2FUG1 4ZHOA 1TY0A 3MJ5A 1GB4A 1WXQA 1C4AA 1YN4A 3AEGB 1ZP0B 2H89B 1ROEA 3AECB 4GDLB 2NTTA 1HZ6A 3P4RB 1PGXA 2V4IB 3VQIA 2N9LA 3Q8AA 4DXFA 1GOZA 4MH8A 4P16A 1GAQB 1VJKA 1YNTE 4L23A 1DOYA 3BYYB 1YN3A 1T3QA 1YMHE 3J9CA 1KFYB 3MFGA 4KKIA 3R2TA 1MHXA 2E6XA 1ACCA 3BVZA 4JE3B 3VRBB 1UWMA 4ZRQA 2BTEA 1J7CA 3W2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8H A;  2W8I A;  3P42 A;  2J58 A; 
#chains in the Genus database with same CATH topology
 5BYR A;  4K1R B;  2WXI A;  2CKH B;  4ICU A;  2ZVN A;  1N5W A;  1E9M A;  2G4S A;  3NG0 A;  3K9P B;  3FIL A;  3W5U B;  2NVU I;  4IKG A;  5AZF A;  1JWM D;  3ETR A;  4OVZ A;  2WDQ B;  4ZRJ A;  2WHI A;  1EF5 A;  1GNU A;  1MJD A;  4BKG A;  1MG8 A;  2CJO A;  2L32 A;  3EFC A;  3RMK C;  3U30 A;  5AZH A;  4DQO C;  2JVC A;  2JWU A;  4RH6 A;  1AAR A;  4LK0 M;  2DZI A;  2N1W A;  3VTW A;  5D6J B;  4RM8 A;  3WAP A;  5D3I B;  4N59 A;  4YT0 B;  2BVC A;  3X23 A;  1IUE A;  4AP4 C;  2EKE C;  1TKE A;  4UDU C;  4LCD E;  5G55 A;  1F77 A;  3Q3J A;  2YEP B;  2DYO A;  3AE7 B;  3C8Y A;  2NCN A;  4RF0 A;  1CMX B;  3VR8 B;  1YJI A;  1E7U A;  2KAN A;  4MAC A;  3W1Y A;  1TS2 A;  2R61 A;  3ALB A;  2AX5 A;  4KDI C;  1T6B X;  1C77 A;  2PIA A;  3GB1 A;  2CHW A;  1A70 A;  1KJT A;  4MM3 A;  3SR6 A;  4LNN A;  4MGZ E;  2G4D B;  2BB5 A;  4WWN A;  3TBL D;  1QLB B;  2TSS A;  2ZW0 A;  4MJS A;  4OZB A;  2D3C A;  1VZ7 A;  4XX5 A;  2QEJ C;  3DVG Y;  1B1Z A;  2MRP A;  3EC8 A;  3W1S C;  3LXF A;  3DQV A;  2NBU A;  1TY2 A;  2KWD A;  1XQQ A;  2IY0 B;  1QKZ A;  1UWX A;  3JYU A;  4JWS C;  3PZ8 A;  3NS8 A;  2VRR B;  4B0E A;  4RF1 A;  1V2Y A;  4W9G A;  4HDO A;  4QAY A;  3ZRF A;  2WXL A;  1HEZ E;  3Q3O C;  1SBB B;  1N62 A;  1ZXI A;  3H7P B;  2GI9 A;  3KW5 B;  3GS2 A;  2PW9 A;  3L10 B;  4ZDV A;  4TKN A;  4E74 A;  2Q5W D;  3RNA C;  2W82 A;  3PRZ A;  4H2A A;  1D5Z C;  1WFY A;  3WCQ A;  1F9J A;  1HXY D;  3L0W B;  4BFR A;  3AEE B;  2L00 B;  3H6N A;  4OW0 A;  2K25 A;  4E3C A;  1EM7 A;  1FRR A;  2KDI A;  3N32 A;  3VFK A;  4JGH B;  1ISN A;  2LJ5 A;  1VZ6 A;  1RAX A;  2GBK A;  3PZ7 A;  1Z5S B;  4WQO B;  1TIF A;  2WXQ A;  3KUZ A;  5IAA C;  4KGR A;  3HRD D;  4FUL A;  5GXG B;  1VRA B;  4LLG M;  4YTN B;  4IM3 A;  4WJP A;  3KWV A;  3R7R A;  1JAL A;  4IUM B;  1J7B A;  3DDC B;  3R7Q A;  3ZQ4 A;  4IDI A;  4GLS C;  2KJR A;  3NZU A;  3N1Z C;  1PFD A;  3DBL I;  3NOB A;  3ZLZ A;  4FJV B;  2KN4 A;  2BWF A;  3QJZ A;  3PRE A;  1I4P A;  1XO3 A;  2L05 A;  3PLV A;  3ONS A;  3GOE A;  2VZK D;  3W1S A;  1VDV A;  3HK0 A;  2MEK A;  2HTH A;  1ET6 A;  4I6L B;  1ZDX A;  1LQB A;  2N9P C;  2LI5 A;  4OVU A;  4RMA A;  3O65 B;  1WJ4 A;  3T9L A;  3N1X C;  3ZJT A;  4KSK C;  3ZXR A;  2HDE A;  2WXH A;  1UUP A;  2INC C;  1WX9 A;  2EKI A;  3A4R A;  3ZTD A;  5CX3 A;  4XDD A;  1E8X A;  1DYQ A;  2D5G A;  1QT9 A;  1FXI A;  2HJ1 A;  3ML9 A;  2AL3 A;  4ANV A;  4KX6 B;  2KJ6 A;  3BK1 A;  3AH7 A;  2ZJD A;  3NUH B;  1V80 A;  1LXD A;  1LGR A;  3RUI B;  5LXH A;  4W9E A;  2FE8 A;  4MGK E;  1VCB A;  2G9H D;  2DEN B;  4GSW A;  3RCZ A;  4DDG D;  1V1O A;  2DAJ A;  3HVD A;  3IAM 1;  2LGS A;  2MBQ A;  3AI5 A;  3P2B A;  1UF0 A;  3LJ3 A;  2EEL A;  4GGQ A;  4HJK A;  2C7M B;  2RGF A;  3DHI C;  3DVN V;  2L76 A;  4MEM A;  4NNJ B;  2WX0 A;  3RN9 C;  1V8C A;  2D3G A;  4XE0 A;  1TZ1 A;  2MSE D;  1GC7 A;  1C4C A;  2SEB D;  2LGI A;  1WGK A;  2GOW A;  1KLG D;  4LNK A;  5D7G A;  4AWJ A;  4XC2 A;  4ZHP A;  3M95 A;  4PYU A;  1TKY A;  5G2N A;  2Z0E B;  1OQR A;  1FRD A;  3I9V 1;  3TEX A;  5HHD G;  3EA6 A;  2IGH A;  2KDF B;  3JW0 X;  2WXP A;  2R2O A;  3MC8 A;  4E71 A;  1YQB A;  4ICV A;  3NJT A;  4N58 A;  3A9J A;  3QIJ A;  2D07 B;  2XK5 B;  1STE A;  1L6U A;  1WXV A;  2K3U A;  4XDC A;  5FR3 A;  1TTN A;  3L16 A;  3ZXV A;  1F52 A;  5AUK A;  4HPL B;  2ZPY A;  2WXG A;  4WQM A;  3OG5 A;  1SJE D;  3PTF C;  3AEB B;  2ON8 A;  4M02 A;  2G1E A;  1RFK A;  4WWO A;  3CMM B;  2J4X A;  3I63 C;  2X8X X;  3MJW A;  1L7Y A;  4II3 B;  1KH0 A;  2JXT A;  2Y5B B;  1AYF A;  3A1Q A;  2BKF A;  3FIL B;  1YQ3 B;  1WGY A;  3WAN A;  3TIX A;  1C79 A;  2IPK D;  4NAM A;  5DCN A;  2HTM E;  3E56 A;  2WLB A;  2N9K A;  1E8Y A;  2BS3 B;  2K6D B;  2OJR A;  4IWO A;  2FNJ B;  4WJO A;  2C7H A;  2HD5 B;  2WXF A;  2Y5P A;  2WP9 B;  2OED A;  2V4L A;  3VH3 B;  1FM0 D;  4HPM B;  1JCK B;  5BYS A;  2V3P A;  2SAK A;  2L1A A;  4ZHO A;  1TY0 A;  5AEK B;  4EZL A;  1YN4 A;  3AEG B;  4HK2 A;  1ROE A;  4KIK A;  4HWI B;  3IVF A;  1VJK A;  5C23 A;  1T3Q A;  3J9C A;  3MFG A;  3R2T A;  5L83 A;  4JE3 B;  1WR1 A;  2BTE A;  2GLS A;  3FKY A;  2XNA C;  1R4M B;  1ZKH A;  1FNW A;  2D10 A;  4BZA A;  2C60 A;  3CF6 E;  3V05 A;  1XF5 L;  2QJL A;  3APC A;  2WS3 B;  4M0W B;  4DXA B;  4M00 A;  3A33 B;  2BB6 A;  2R2Q A;  4OZC A;  1F2R I;  1AN8 A;  1I4X A;  1XD3 B;  4EUT A;  1V9J A;  2FCN A;  1T0Q C;  1MVK A;  3AXC A;  4W9D A;  1GPX A;  3VUW A;  2JRI B;  3B2G A;  1K53 A;  2M0A A;  2LFI A;  2J0J A;  3BYT B;  2PJH A;  2JY6 A;  3AB5 A;  4B6W A;  4C7Y A;  1XCT L;  2N1V A;  2KTR A;  4N6E B;  3IXS A;  1RLF A;  2OJW A;  3GE3 C;  2L0T A;  2PEA A;  1IBX A;  2FCS A;  1M94 A;  2WXJ A;  4I6N B;  1NDD A;  3TL5 A;  4J6I A;  3DBH B;  5JHA A;  1NBF C;  1JML A;  1LO5 D;  2WXN A;  1I4H A;  2DYM A;  3OJ4 B;  3QC8 B;  4LJP B;  5BMH A;  5C1Z A;  1ET9 A;  4HKQ A;  4A8X C;  2ICI A;  1Q5W B;  4NJ7 A;  1J19 A;  2WU2 B;  4B9K A;  3QA8 A;  2CR5 A;  1YOV B;  5JHB A;  1CK1 A;  3RNF C;  1NI2 A;  4XWT A;  3ZO5 B;  2BT6 A;  5MPO A;  2RMM A;  1WE6 A;  4ZRP A;  3AED B;  1SJH D;  2I2Y A;  2RR9 A;  3DCG A;  5E6J A;  4DWF A;  3TUO A;  1N5X A;  5E6O A;  4FN2 A;  1CZP A;  4CYE A;  3N30 A;  2PKO A;  5CTR C;  2QIL A;  1TZO A;  4BKT A;  2KYW A;  3KUD B;  3TMP B;  1BML C;  1V5T A;  1K50 A;  2QSD A;  4YSX B;  2J53 A;  4KGS A;  3DWG C;  2UYZ B;  3P4S B;  3R3M A;  4IM2 A;  1WY8 A;  2KVR A;  2IJ0 A;  4JLC A;  1JRP A;  3RNE C;  3KUC B;  2O6V A;  3BII D;  3PS6 A;  4C80 A;  2IYD B;  3DBL B;  1JRU A;  1WZ0 A;  4N9F 4;  1JWB D;  1EO6 A;  4REZ A;  2LXA A;  3B2F A;  1S3S G;  4KIK B;  2DX5 B;  1V81 A;  3AEA B;  3FAH A;  3ZJV A;  2LVP A;  3DBR B;  3AUL A;  4DHJ B;  2N4F A;  1RFA A;  3IFW B;  3PZD A;  1WXA A;  3SDL C;  4ZYN A;  4R3D A;  1NYR A;  2N7D A;  1WJN A;  5FKA C;  1EUV B;  4LTU A;  2REX A;  2PPH A;  3UF8 A;  1KOT A;  1I7H A;  1D6E C;  5DPR A;  4RFB A;  1OQQ A;  2J52 A;  2MBB B;  2I1J A;  3Q3F A;  1UBI A;  4WAF A;  2L52 A;  1K8R B;  2QMT A;  4ZRK A;  2N7E A;  1WJU A;  2BQQ A;  3KWL A;  1WE7 A;  3EEC A;  1QOA A;  2O2V A;  2KFK A;  4BAX A;  2MP2 B;  5HFY A;  1KF6 B;  4MSQ B;  3UGB B;  4IWQ A;  4CQN A;  2KZR A;  4HPP A;  2M1M A;  3VAW A;  3FC4 A;  3PSE B;  1V86 A;  3AE1 B;  3KH0 A;  3PRM B;  4G11 A;  4NQK E;  2D3A A;  1BXT A;  1M4V A;  1UD7 A;  3B9J A;  2NBV B;  2M56 B;  3P63 A;  2IZV B;  3Q3N C;  1FFU A;  2IO3 B;  4EKU A;  2WXM A;  4C4V A;  3I57 A;  3ZNI D;  3PHW B;  3AE2 B;  2W8I A;  1MI0 A;  4WJQ A;  2IGG A;  3ABV B;  1B9R A;  3NVZ A;  2K8H A;  2MX2 A;  1XLP A;  3QAQ A;  4LNF A;  3UQA A;  3R66 C;  3M3J A;  3Q8E A;  3V3X A;  1WGH A;  3QX1 A;  3A9K B;  1YIW A;  2WDT B;  4GN1 A;  1C78 A;  1L4D B;  3PO0 A;  3L4P A;  4KV2 A;  1NVI D;  3NZ3 A;  2K1F A;  2K8C A;  1YD8 U;  2LUM A;  4DHJ D;  2DBY A;  1H4R A;  2LJI A;  3LYY A;  4ITK A;  3PGE A;  4PS7 A;  2IO0 B;  4TQ1 A;  2M17 A;  2AQ3 B;  3IAS 1;  4ACF A;  4FBJ B;  2ZCB A;  2J58 A;  3ZUN A;  3MHS D;  5IKC M;  2K5P A;  3Q14 C;  1QZE A;  3OWE B;  5LXI B;  4YWG G;  1SSN A;  1SIF A;  4NQL B;  2JYE A;  2DNF A;  1EF1 A;  2DLB A;  1V49 A;  2UU7 A;  4A9A A;  1L4Z B;  2KK8 A;  3AU5 A;  5IOI A;  2VH1 A;  1P7E A;  3GP7 A;  1OFF A;  2PVO D;  1QF6 A;  3U7D A;  5J2R A;  4BKS A;  4CO7 A;  3QCA A;  2JT4 B;  2ZNV C;  4USA A;  3OJ3 A;  4DXG A;  4G50 A;  4F7Z A;  3HM6 X;  2NTS A;  1GG3 A;  1P7F A;  3NY5 A;  1D4B A;  4W9H A;  5D2M B;  3W9C B;  1P9D U;  1ZDV A;  4TMA B;  5JXV A;  5D94 A;  2MJE A;  2LWP A;  1XLQ A;  1PGB A;  4JIO U;  5E6N A;  2J0M A;  4HRS A;  1TS5 A;  2WDR B;  4TQ0 A;  2LRU A;  1YJJ A;  1XLO A;  4JX1 C;  4WUR A;  1F0Z A;  5EE1 A;  2K8B A;  2BYV E;  1HQR D;  4EOY A;  1R7S A;  3UI3 A;  1WF9 A;  1SB3 C;  1FEH A;  1RRB A;  1OGW A;  3V62 A;  1SE3 A;  4OVV A;  2H88 B;  2NMQ A;  1SIJ A;  4NZL B;  1WXM A;  4GDK B;  3T3O A;  3DVN U;  2KNB A;  2JXX A;  3MC9 A;  1T5X D;  4P1C C;  5EE3 A;  3SFD B;  3SD5 A;  2FIF A;  4AUQ C;  3ZNH B;  1JW9 D;  2JUO A;  4G0N B;  2N9X A;  3H7P A;  1ZE3 D;  2G45 B;  3EUB 2;  3A1Q B;  2GBN A;  4HCN B;  3TEZ A;  3HUI A;  3M62 B;  1KM7 A;  5H8Y E;  4KKJ A;  3BWU D;  4C00 A;  1J7A A;  4MH0 E;  2GBR A;  1GB4 A;  1WXQ A;  2JZ3 B;  2KVZ A;  2G3Q B;  4M8M A;  1TT5 B;  4GXB A;  2EMS A;  5KHQ A;  1HZ6 A;  2BKR B;  2DZM A;  1GOZ A;  1GAQ B;  3VTV A;  4KSL C;  4KKI A;  3BVZ A;  4LJO B;  1UWM A;  2QDF A;  1G6J A;  3QQ8 B;  5DPW A;  3A4S C;  2DZJ A;  4PYZ A;  2DHZ A;  4J3O D;  2FCM A;  3RI7 C;  3SEB A;  4MEL A;  2YEP F;  3KYC D;  5KHO A;  3U2S C;  3GZN I;  5LNK 1;  1L0Y B;  1X1M A;  2XEW A;  3VH4 B;  3ZGZ A;  3KYD D;  4HXD A;  1DGJ A;  2GRI A;  3TJP A;  4FXC A;  2M8S A;  4PS3 A;  2MJ3 A;  2B3A A;  4FA6 A;  5JZE B;  1XT9 B;  2C7N B;  1RYJ A;  2ONQ A;  3S2A A;  2ACZ B;  1WYG A;  1QOF A;  4MSM B;  1I42 A;  4TUU A;  4WAA A;  2DAF A;  4HJG E;  3RNB C;  3ZNZ B;  2KX3 A;  2J7Q B;  2KQ7 A;  2LGY A;  2M4N A;  3QWZ B;  4O1N A;  3QAR A;  3B08 A;  2RD0 A;  4HCP B;  2KMC A;  2A5U A;  3CWI A;  3V60 A;  3PPA A;  3Q6B A;  3BY4 B;  4BVU C;  1SEB D;  2B76 B;  2JWZ A;  3AE3 B;  1HTQ A;  2BF8 B;  3CSF A;  2WU5 B;  2KC1 A;  5H92 C;  2BGF A;  5CHV C;  3DHH C;  1TYG B;  1QIL A;  2X38 A;  1R4N B;  3CIR B;  3ECI A;  2PTL A;  2KLC A;  3BZD B;  3DBR I;  3M63 B;  1PGA A;  5AUI A;  3ZRC A;  3ML8 A;  4ASW C;  3U8Z A;  4C4V B;  2ZW1 A;  1GC6 A;  5IA7 A;  1E7P B;  4US9 A;  2GBJ A;  3WAL A;  5HI1 A;  3ZYY X;  2WYQ A;  2YLM A;  1UEL A;  4YTP B;  1ZPS A;  3MHZ A;  1WI0 A;  1RWS A;  4FHJ A;  2BW2 A;  3AV8 A;  3AM9 A;  1OQY A;  4P6V F;  4BOS C;  1FMA D;  4YL8 A;  1HZ5 A;  1FD6 A;  2NR2 A;  2K39 A;  2LVQ A;  1WX8 A;  1L0V B;  3UQB A;  3QK0 A;  2A4Z A;  4A3P A;  4YSY B;  4NJC A;  5I4D A;  3VUY A;  1IP9 A;  5C2T B;  1N61 A;  3TCA A;  4K3C A;  5GMV A;  2Y5C A;  1C1Y B;  2KDB A;  2KKC A;  1Q1O A;  2WDV B;  3JSV A;  3L54 A;  2KDE B;  4KVG B;  2RDG A;  2LVO A;  4C7Z A;  1V1P B;  2Z8L A;  2MCN B;  4B95 A;  1WMH B;  5G5G A;  4EEW A;  1NYQ A;  4MJS B;  3RNC C;  3U7Z A;  1WR6 E;  2MA9 B;  3L08 A;  1UGM A;  3E9S A;  3HM3 A;  1MHH E;  1T0Y A;  2FAZ A;  2Z0D B;  2IBI B;  2V9H A;  1N63 A;  4MM3 B;  2CS4 A;  2L7R A;  2VH2 A;  3WAM A;  3N9Y C;  2WXO A;  4RCO A;  5G5H A;  4L2Y A;  3UIN B;  1LFD A;  2AYO B;  3AMZ A;  2RPQ A;  4MGI E;  4W9K A;  4K81 A;  3KLS X;  4WWM A;  2ZCC A;  4YTM B;  4WH4 A;  5EE9 A;  3T8M A;  3PT2 B;  5EDS A;  1IGD A;  5DPS A;  1WIA A;  1NEN B;  3HVZ A;  4FJZ A;  4ZOH C;  2I1K A;  1TBE A;  1WGD A;  2JU6 X;  1L6V A;  4AJY B;  3WIM A;  1FO4 A;  3ZW3 A;  3ZTC A;  2CHX A;  3AE6 B;  4Q2J A;  1YX5 B;  4X57 B;  4XYC A;  1E6E B;  3Q8C A;  3X0W A;  2W3R A;  4I6P A;  3PHX B;  1WGR A;  4K7S A;  4NY0 A;  2INN E;  2MBH A;  5LLI A;  1D3Z A;  2GBM A;  2QCZ A;  2LRW A;  2L3Z A;  1PQS A;  3ZKJ C;  4CHK A;  4HVB A;  2KN5 A;  1U4A A;  2PMV A;  3U52 E;  1E7V A;  1FFV A;  2V3S A;  1FXA A;  3P4Q B;  2CHZ A;  2W8H A;  3DVG X;  5BMG A;  2BYF A;  2JF5 A;  3LB8 C;  2LHE A;  3ZVV A;  2NBW B;  2MQJ A;  4LDT B;  1UH6 A;  4HLE A;  3AN1 A;  1DOI A;  1WJ6 A;  2BPS A;  3C0R B;  2AQ1 B;  1SE4 A;  3DHG C;  4PK1 A;  4A3O A;  4G3X B;  2RDH A;  1D5X C;  1P3Q U;  4W9J A;  4M0W A;  1WX7 A;  2WQY B;  2WXR A;  3ZJU A;  4MT5 A;  1C3T A;  1TS4 A;  1MG4 A;  3L17 A;  2O2V B;  5BMI A;  1UNS A;  4IOI E;  2XN9 C;  4AS1 A;  4P7I A;  5IO9 A;  4EFO A;  1FNV A;  2K9X A;  3A9K A;  2KHW B;  1CJE A;  2PE9 A;  1KLV A;  2RDB C;  4LNO A;  1E0Z A;  1EWY C;  2PVG C;  1C76 A;  4OZA A;  3DBH I;  1SXT A;  4FJY A;  2ZNV B;  3RZF A;  1I35 A;  2W54 A;  1WGG A;  2C5L C;  1JWU D;  2ZEQ A;  4FLH A;  4IWP A;  4MGY E;  4RGN A;  2O6V D;  2WGS A;  2D2Q A;  4ANU A;  4EZJ A;  3T3N A;  1VR9 A;  2IGD A;  3BK2 A;  4JQW C;  1PUT A;  2GB1 A;  4OHJ A;  1NI3 A;  4K7U A;  2KWC A;  5IN7 A;  3IBE A;  2K22 A;  1XEE A;  3URY A;  4RGM A;  4GB9 A;  4FAD A;  2KO3 A;  2DZK A;  4C56 C;  1HE8 A;  2LZ6 A;  3AE4 B;  2KC2 A;  4M01 A;  3Q69 A;  3ENE A;  3HHM A;  2NS5 A;  5HG2 A;  4A6Q A;  1LM8 B;  4NAW A;  3RNG C;  1L2N A;  1WRI A;  5TSS A;  2MLB A;  3SFE B;  1V1P A;  1UGJ A;  4LDT D;  2KQS A;  2KX0 A;  3Q3M C;  2VZK B;  1C4P A;  4IC7 B;  3NVV A;  3N3K B;  1ENF A;  1D5M C;  2LD9 A;  2V1Y A;  1V6E A;  2NPT B;  3U4E G;  1ESF A;  2DYB A;  3MJ5 A;  1Z2M A;  2Z59 B;  4GDL B;  1ZP0 B;  3WAO A;  3AEC B;  2NTT A;  3P4R B;  2MW5 A;  1PGX A;  2L0F A;  4IW0 A;  2N9L A;  3VXW A;  2IND C;  4MH8 A;  3A9J B;  4W9L A;  4DHZ E;  4L23 A;  3OLM D;  1YN3 A;  4HDQ A;  4LNI A;  1YMH E;  2AEH A;  1ACC A;  3VRB B;  1J7C A;  3VHT C;  4KZC A;  1XCQ L;  1N60 A;  2KAC A;  5L95 C;  2JZP A;  3JVZ X;  4NPN A;  3UIO B;  4KDL B;  5FK9 C;  1VLB A;  2LHD A;  1IGC A;  1P98 A;  2K6Q A;  3NVW A;  2IY1 B;  3QHT A;  2O6V B;  3Q8F A;  3C19 A;  1V5O A;  1FNU A;  3NS1 A;  2KFK B;  2OHF A;  2ZZP B;  1EU3 A;  2LEK A;  2KTF A;  1R4N I;  4S17 A;  3TEW A;  1Q10 A;  4A55 A;  4B0M A;  3VDZ A;  3Q2A C;  3ZNG C;  1ZOY B;  2D11 A;  2AQ2 B;  2LGX A;  1E5W A;  2QC8 A;  4ZRI A;  4W9F A;  1H8C A;  2EMT A;  2AL6 A;  4GU2 A;  5C3J B;  2I38 A;  2FBW B;  2PLP A;  4YSZ B;  1FPY A;  1K51 A;  1XLN A;  4ZYS A;  3ZDT A;  2KDM A;  2KJH B;  1JWS D;  3DOW A;  1ZGU B;  4GDK A;  2KQ4 X;  2W9N A;  2L83 A;  1T0S C;  2W55 A;  2J0K A;  3VUX A;  4PT5 A;  1QQR A;  2JSV X;  3I3T B;  4US8 A;  3MP9 A;  3RFZ B;  1GJZ A;  4BKS D;  2KD0 A;  1I4G A;  3PLU A;  2L8J A;  1Y56 A;  2WWZ A;  3K9O B;  3AU4 A;  1KLU D;  4AOF A;  5BYQ A;  4A20 A;  4DHZ B;  1IPG A;  3VR9 B;  1WSP A;  1BT0 A;  3NZS A;  1CQV A;  2XBB C;  4AQ7 A;  3KVF B;  1VZ8 A;  4A90 A;  1WMH A;  2LXC A;  4W9C A;  2JZZ A;  3APD A;  3V61 A;  2JYT A;  3H8H A;  1BUI C;  4JL9 A;  1C9F A;  3EFU A;  2FCQ A;  3P4P B;  1IYF A;  4KGT A;  4FHK A;  2CU3 A;  3NHE B;  2CU1 A;  1UBQ A;  3H1U A;  2KAJ A;  4HRO A;  3RYT A;  2N0S B;  4GMV A;  1YJ1 A;  5T8I A;  2FUH B;  1SGH A;  3APF A;  4ANW A;  3MTN B;  3AE9 B;  4XWW A;  3BIN A;  4ARC A;  2BS4 B;  3IT4 B;  1L0X B;  1RM6 C;  4NJ6 A;  2CJN A;  1IBX B;  2WNM A;  1Q0W B;  4GOC A;  4WIP A;  2BS2 B;  3VVW B;  1JQ4 A;  1S1Q B;  3AEF B;  3PVL A;  1J0G A;  2GMI C;  1HTO A;  1R4M I;  2ZVO A;  4W9I A;  1J8C A;  1KRH A;  1TGZ B;  2LGD A;  3D32 A;  3BVM A;  1E10 A;  1FXT B;  5JH5 C;  3P1M A;  2BBC A;  2V3N A;  2YVC A;  2HE7 A;  2KOX A;  1SE9 A;  5CHW A;  5J17 A;  2HJ8 A;  3MC0 B;  1KTK A;  2E3T A;  4JWU C;  2AWT A;  1WH3 A;  5D3D A;  5AZG A;  1N6Z A;  2MBO A;  3RD2 A;  2D3B A;  2KXJ A;  5TR5 A;  4XZ4 A;  1F2R C;  1SE2 A;  1OEY A;  1OEY J;  3VTU A;  4D2K A;  2JRH A;  2J42 A;  4K7W A;  3UIP B;  2JPH A;  1PYW D;  2IDY A;  1UZX B;  3RPF C;  1YX6 B;  1SF0 A;  4HKZ E;  2LUE A;  2N7J A;  3LDZ E;  5E6P A;  3IHP C;  3B1L X;  2M19 A;  2XK5 A;  3IT6 B;  3ZIM A;  4DK5 A;  3EHV A;  3SHQ A;  4YXD B;  2KMA A;  4K3B A;  2INP E;  4JPS A;  4ARI A;  2QHO A;  3NVY A;  1P0R A;  2PE6 B;  1QOG A;  3TEY A;  1EU4 A;  1I4R A;  2KFJ A;  1QOB A;  3HIZ A;  1FCL A;  1TS3 A;  1E90 A;  3TSS A;  4KZ0 A;  3WA0 A;  3IG3 A;  1ZXH A;  2WXK A;  1L5P A;  1JRO A;  2WX1 A;  2JQR B;  2MWS B;  4BBN F;  1HA5 A;  2KTR B;  4ANX A;  4IG7 B;  1A5R A;  3CST A;  1FIQ A;  3L13 A;  3DBS A;  2V0G A;  5DPT A;  3W5V B;  2DWQ A;  3N1Y C;  3AE5 B;  1WXS A;  1ZW7 A;  2MJD A;  2IO2 B;  3R8B A;  3JSV B;  2NPT A;  1EWC A;  5CHF A;  3KQ4 A;  1Y8R C;  1E8W A;  1WWT A;  2W3S A;  4GIV A;  5IP4 D;  3GZN B;  1TKG A;  4DDI D;  2LMC A;  1MPE A;  2RSU A;  4HEA 1;  3RT3 B;  5EE0 A;  4TV3 A;  3RUL A;  3R2I A;  4RGO S;  1WYW B;  1NEK B;  3PRP B;  4RGT A;  3EGR A;  3H7S A;  5HKH A;  1WM3 A;  1JWA D;  1YN5 A;  2RPV A;  5FR6 A;  2ZPN A;  2FID A;  4EE2 A;  2M0X A;  4TSS A;  1F1H A;  1YQ4 B;  2MBE A;  3PV1 A;  4XGA B;  3BVG A;  1XXG A;  3P42 A;  1V97 A;  2C9W B;  1TJE A;  3RZW C;  2BYE A;  1K52 A;  4WWP A;  1AWD A;  1GB1 A;  4DBG A;  1MFW A;  4GDL A;  3GE8 C;  4WJN A;  3V6E B;  4URK A;  1WM2 A;  2K0P A;  4RNA A;  2MP2 A;  1OTR B;  3O13 A;  2BYT A;  3Q8B A;  1AW7 A;  1E8Z A;  1T0R C;  2KWV B;  4RM9 A;  4IM0 A;  4BBN C;  1PDX A;  1FCC C;  1P1A A;  3OAW A;  3ZDM C;  2UWQ A;  4M8N A;  4L1B A;  3V6C B;  4F8C B;  1VD2 A;  5J18 A;  3DWM A;  3VRA B;  4EZK A;  2MH7 A;  4MDK E;  2LAS A;  3I5J C;  4II2 B;  2KWU B;  1I4Q A;  3AE8 B;  2QIE B;  1DOX A;  4NAW B;  1ZUD 2;  2Y3A A;  2OOB B;  4AJW A;  3NRZ A;  2BWE S;  2KMM A;  3N20 C;  2JX5 A;  4BOZ B;  3B0A A;  2FUG 1;  3H9D A;  1C4A A;  2H89 B;  1WZ3 A;  2MHJ A;  3DPD A;  4P1B C;  4S0R A;  2V4I B;  2IO1 B;  3VQI A;  2N9E B;  3Q8A A;  4DXF A;  4P16 A;  1YNT E;  2KLG A;  4PS8 A;  1DOY A;  3BYY B;  1GUA B;  1KFY B;  3SU8 X;  2KT7 A;  1MHX A;  2E6X A;  4F1S A;  2ASQ A;  1WRD B;  4ZRQ A;  3W2D A;  5BO4 B; 
#chains in the Genus database with same CATH homology
 2XNA C;  1XCQ L;  5BYR A;  1N60 A;  2WXI A;  4J3O D;  2KAC A;  1N5W A;  1FNW A;  1E9M A;  2JZP A;  3V05 A;  1XF5 L;  2QJL A;  3FIL A;  3SEB A;  4IKG A;  3W5U B;  2WS3 B;  5FK9 C;  1JWM D;  2YEP F;  3ETR A;  4OVZ A;  1VLB A;  2WDQ B;  2LHD A;  1IGC A;  2BB6 A;  4OZC A;  1F2R I;  3NVW A;  3U2S C;  1AN8 A;  5LNK 1;  1I4X A;  1L0Y B;  2CJO A;  1MVK A;  3Q8F A;  2L32 A;  4DQO C;  3ZGZ A;  1FNU A;  3NS1 A;  2OHF A;  1EU3 A;  1GPX A;  1DGJ A;  2JWU A;  1K53 A;  3B2G A;  2GRI A;  2LEK A;  2M0A A;  4RH6 A;  4FXC A;  2LFI A;  4LK0 M;  3TEW A;  1Q10 A;  3BYT B;  3AB5 A;  5D3I B;  2MJ3 A;  4N59 A;  4YT0 B;  1XCT L;  4A55 A;  4C7Y A;  1IUE A;  4B0M A;  4N6E B;  1TKE A;  3IXS A;  1RYJ A;  2ONQ A;  2ACZ B;  1ZOY B;  1WYG A;  2AQ2 B;  1IBX A;  4UDU C;  1QOF A;  1F77 A;  2WXJ A;  2YEP B;  2DYO A;  3AE7 B;  3C8Y A;  4RF0 A;  4HJG E;  1JML A;  1LO5 D;  2WXN A;  3VR8 B;  1I4H A;  1YJI A;  5C3J B;  2DYM A;  2I38 A;  4MAC A;  2FBW B;  2PLP A;  4O1N A;  1TS2 A;  4YSZ B;  2R61 A;  1K51 A;  1XLN A;  5BMH A;  4ZYS A;  1ET9 A;  2KDM A;  3CWI A;  1JWS D;  2AX5 A;  4HKQ A;  4A8X C;  2ICI A;  1T6B X;  1C77 A;  2PIA A;  3GB1 A;  2KQ4 X;  2WU2 B;  1A70 A;  1SEB D;  3SR6 A;  2L83 A;  2B76 B;  2W55 A;  3AE3 B;  2BB5 A;  4PT5 A;  1QQR A;  2JSV X;  4US8 A;  1CK1 A;  1QLB B;  2WU5 B;  2TSS A;  3MP9 A;  2ZW0 A;  3RFZ B;  4XWT A;  5MPO A;  1I4G A;  2BT6 A;  2RMM A;  4ZRP A;  4OZB A;  5H92 C;  3AED B;  1VZ7 A;  1Y56 A;  1SJH D;  2I2Y A;  1KLU D;  2QEJ C;  1TYG B;  1QIL A;  2X38 A;  5BYQ A;  1B1Z A;  3CIR B;  5E6J A;  3VR9 B;  1WSP A;  3LXF A;  3TUO A;  1N5X A;  2PTL A;  1TY2 A;  2KWD A;  3BZD B;  1CQV A;  1PGA A;  4AQ7 A;  1CZP A;  5AUI A;  1QKZ A;  1UWX A;  1VZ8 A;  2PKO A;  4A90 A;  2QIL A;  4JWS C;  3PZ8 A;  2ZW1 A;  4B0E A;  4RF1 A;  1E7P B;  1TZO A;  4US9 A;  2JYT A;  2WXL A;  1HEZ E;  3H8H A;  1BML C;  1SBB B;  1BUI C;  1N62 A;  5HI1 A;  3ZYY X;  1C9F A;  1K50 A;  4YTP B;  2QSD A;  1ZXI A;  3P4P B;  1ZPS A;  3MHZ A;  4KGT A;  4YSX B;  2J53 A;  1RWS A;  4KGS A;  2CU3 A;  2BW2 A;  3DWG C;  2GI9 A;  3AV8 A;  3GS2 A;  2PW9 A;  3AM9 A;  3P4S B;  4P6V F;  2KAJ A;  1FMA D;  2Q5W D;  4HRO A;  1HZ5 A;  2IJ0 A;  2W82 A;  1FD6 A;  2N0S B;  1JRP A;  3BII D;  4C80 A;  5T8I A;  1L0V B;  4H2A A;  1JWB D;  4REZ A;  1D5Z C;  3B2F A;  4YSY B;  3WCQ A;  4NJC A;  5I4D A;  3AE9 B;  1HXY D;  4XWW A;  5C2T B;  4ARC A;  1N61 A;  3AEA B;  3AEE B;  4OW0 A;  3FAH A;  2BS4 B;  1EM7 A;  1FRR A;  1L0X B;  3IT4 B;  1RM6 C;  2Y5C A;  3ZJV A;  2CJN A;  1VZ6 A;  1IBX B;  2WNM A;  2WDV B;  3PZ7 A;  4R3D A;  4WIP A;  2BS2 B;  1JQ4 A;  1NYR A;  2WXQ A;  3AEF B;  2RDG A;  5FKA C;  4C7Z A;  1V1P B;  4KGR A;  2Z8L A;  4LTU A;  3HRD D;  1I7H A;  1D6E C;  5G5G A;  5GXG B;  1NYQ A;  1VRA B;  1KRH A;  4RFB A;  3U7Z A;  1OQQ A;  2J52 A;  4LLG M;  3BVM A;  1E10 A;  3E9S A;  1MHH E;  2BBC A;  2V3N A;  2L52 A;  2QMT A;  3P1M A;  4WAF A;  4YTN B;  1N63 A;  3KWL A;  3KWV A;  4MM3 B;  1JAL A;  1J7B A;  1QOA A;  3ZQ4 A;  3MC0 B;  4IDI A;  4GLS C;  1KTK A;  3N9Y C;  2E3T A;  4JWU C;  2WXO A;  1PFD A;  4RCO A;  5D3D A;  5HFY A;  1KF6 B;  5G5H A;  4CQN A;  4L2Y A;  3FC4 A;  2KN4 A;  3AMZ A;  1F2R C;  3AE1 B;  1SE2 A;  1I4P A;  4D2K A;  1XO3 A;  3KLS X;  2J42 A;  4WWM A;  1PYW D;  2VZK D;  3W1S A;  2IDY A;  4WH4 A;  5EE9 A;  1BXT A;  1M4V A;  4YTM B;  3B9J A;  3RPF C;  1VDV A;  1IGD A;  2M56 B;  1SF0 A;  4HKZ E;  2N7J A;  2MEK A;  3P63 A;  3HVZ A;  1ET6 A;  1NEN B;  1FFU A;  2M19 A;  4ZOH C;  3IT6 B;  1ZDX A;  2WXM A;  2JU6 X;  4YXD B;  1L6V A;  3I57 A;  2INP E;  4JPS A;  1FO4 A;  3AE2 B;  4ARI A;  2W8I A;  1MI0 A;  3AE6 B;  4Q2J A;  3NVY A;  2IGG A;  3ABV B;  1B9R A;  1E6E B;  3ZJT A;  3NVZ A;  3Q8C A;  1QOG A;  1XLP A;  2W3R A;  2HDE A;  2WXH A;  3TEY A;  1UUP A;  2EKI A;  1EU4 A;  1I4R A;  4XDD A;  2INN E;  3Q8E A;  1DYQ A;  3V3X A;  1QOB A;  1FCL A;  2D5G A;  1QT9 A;  1FXI A;  1TS3 A;  1C78 A;  3TSS A;  1L4D B;  3PO0 A;  3L4P A;  1ZXH A;  2PMV A;  2WXK A;  1L5P A;  1JRO A;  3BK1 A;  4KX6 B;  1NVI D;  1FFV A;  2JQR B;  3U52 E;  3AH7 A;  1HA5 A;  1FXA A;  3NUH B;  3NZ3 A;  3P4Q B;  1FIQ A;  2W8H A;  2V0G A;  3W5V B;  5BMG A;  3LB8 C;  2DWQ A;  2LHE A;  2LUM A;  2FE8 A;  2DBY A;  2LJI A;  3LYY A;  4ITK A;  3AE5 B;  3AN1 A;  4TQ1 A;  1DOI A;  2AQ3 B;  3IAS 1;  2MJD A;  2J58 A;  2G9H D;  2AQ1 B;  3R8B A;  1SE4 A;  1EWC A;  1V1O A;  3KQ4 A;  3HVD A;  3IAM 1;  2K5P A;  3OWE B;  2RDH A;  1D5X C;  2EEL A;  1WWT A;  4M0W A;  4YWG G;  2W3S A;  1SSN A;  2WQY B;  2WXR A;  3ZJU A;  1TKG A;  4MT5 A;  1TS4 A;  2JYE A;  2DLB A;  1V8C A;  2LMC A;  4A9A A;  1L4Z B;  4XE0 A;  1MPE A;  1C4C A;  2SEB D;  2LGI A;  4HEA 1;  1WGK A;  5EE0 A;  1P7E A;  1KLG D;  3R2I A;  5BMI A;  3GP7 A;  1OFF A;  1UNS A;  4IOI E;  4RGO S;  2PVO D;  1QF6 A;  2XN9 C;  4AS1 A;  5D7G A;  1FNV A;  1NEK B;  2K9X A;  4RGT A;  3EGR A;  1CJE A;  4USA A;  4DXG A;  4ZHP A;  1JWA D;  2NTS A;  1YN5 A;  1P7F A;  1TKY A;  2RPV A;  1E0Z A;  1EWY C;  2PVG C;  1C76 A;  4OZA A;  1D4B A;  4EE2 A;  1SXT A;  1OQR A;  4TSS A;  1FRD A;  1YQ4 B;  3W9C B;  2W54 A;  3I9V 1;  5HHD G;  3TEX A;  3EA6 A;  2IGH A;  1ZDV A;  4TMA B;  2WXP A;  5JXV A;  3BVG A;  2MJE A;  1JWU D;  1XLQ A;  1XXG A;  3P42 A;  1PGB A;  1V97 A;  1TJE A;  4RGN A;  4N58 A;  4HRS A;  1TS5 A;  2WDR B;  4TQ0 A;  1K52 A;  1YJJ A;  1AWD A;  1XLO A;  1GB1 A;  3T3N A;  1STE A;  1VR9 A;  1L6U A;  4JX1 C;  2IGD A;  4WUR A;  1F0Z A;  3BK2 A;  2K3U A;  5EE1 A;  4XDC A;  1PUT A;  2GB1 A;  5FR3 A;  2K0P A;  4OHJ A;  4RNA A;  5AUK A;  1HQR D;  1NI3 A;  3O13 A;  2BYT A;  2WXG A;  3Q8B A;  1R7S A;  3UI3 A;  4WQM A;  1AW7 A;  1XEE A;  2K22 A;  3URY A;  4RGM A;  1SB3 C;  1FEH A;  1SJE D;  3AEB B;  2ON8 A;  2G1E A;  1SE3 A;  1PDX A;  2H88 B;  1FCC C;  4C56 C;  1RFK A;  2NMQ A;  1SIJ A;  4NZL B;  3AE4 B;  4GDK B;  3T3O A;  2J4X A;  4L1B A;  1T5X D;  1KH0 A;  3Q69 A;  2JXT A;  1AYF A;  5HG2 A;  5EE3 A;  4A6Q A;  3DWM A;  3FIL B;  3SFD B;  1YQ3 B;  3VRA B;  1C79 A;  1JW9 D;  2MH7 A;  2IPK D;  4NAM A;  1WRI A;  1ZE3 D;  5TSS A;  3SFE B;  1I4Q A;  3EUB 2;  1V1P A;  2HTM E;  2WLB A;  2N9K A;  1UGJ A;  2BS3 B;  3AE8 B;  3E56 A;  2QIE B;  1DOX A;  4NAW B;  3TEZ A;  2VZK B;  1ZUD 2;  1C4P A;  2Y3A A;  2WXF A;  3HUI A;  2Y5P A;  3NRZ A;  2WP9 B;  2OED A;  5H8Y E;  3NVV A;  1FM0 D;  4KKJ A;  3BWU D;  2KMM A;  1J7A A;  1JCK B;  1D5M C;  1ENF A;  2V3P A;  5BYS A;  2JX5 A;  2SAK A;  2L1A A;  3U4E G;  1ESF A;  2FUG 1;  4ZHO A;  1TY0 A;  3MJ5 A;  1GB4 A;  1WXQ A;  1C4A A;  1YN4 A;  3AEG B;  1ZP0 B;  2H89 B;  1ROE A;  3AEC B;  4GDL B;  2NTT A;  1HZ6 A;  3P4R B;  1PGX A;  2V4I B;  3VQI A;  2N9L A;  3Q8A A;  4DXF A;  1GOZ A;  4MH8 A;  4P16 A;  1GAQ B;  1VJK A;  1YNT E;  4L23 A;  1DOY A;  3BYY B;  1YN3 A;  1T3Q A;  1YMH E;  3J9C A;  1KFY B;  3MFG A;  4KKI A;  3R2T A;  1MHX A;  2E6X A;  1ACC A;  3BVZ A;  4JE3 B;  3VRB B;  1UWM A;  4ZRQ A;  2BTE A;  1J7C A;  3W2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...