3P42A

Structure of gfcc (ymcb), protein encoded by the e. coli group 4 capsule operon
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
QGMVTIYLPGEQQTLSVGPVENVAQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWLAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted protein
publication title The Crystal Structure of Escherichia coli Group 4 Capsule Protein GfcC Reveals a Domain Organization Resembling That of Wza.
pubmed doi rcsb
source organism Escherichia coli o127:h6
molecule tags Unknown function
total genus 56
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.700 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p42A01
3.10.560.10 Alpha Beta Roll Outer membrane lipoprotein wza fold like Outer membrane lipoprotein wza domain like 3p42A03
3P42A 2W8IA 2W8HA 2J58A
chains in the Genus database with same CATH superfamily
3DWMA 3SR6A 1GPXA 3R7QA 4JPSA 2JUOA 4JWSC 4US8A 1ZDXA 2BYVE 2AQ2B 5C3JB 2KJHB 4LTUA 4GB9A 4MDKE 2LGDA 2L8JA 3Q3OC 2KLCA 3RNBC 2WXNA 1E8YA 4K7UA 2MEKA 3ZUNA 1HZ5A 5J18A 3MP9A 1PYWD 1FEHA 1TZOA 3D32A 3IG3A 4PYZA 2HD5B 3HUIA 1R4NB 2IO2B 5AZFA 1AWDA 3FILB 3Q8EA 2MHJA 1HQRD 3VUYA 2NR2A 1D5MC 3MC8A 3ZRCA 2Z59B 2INDC 4F8CB 3NZ3A 4WWNA 2FUHB 3W5UB 1QLBB 3M62B 4FLHA 4IM0A 2H89B 2HTHA 1MVKA 3I9V1 1RFAA 3NVZA 5KHQA 1C1YB 2I2YA 4LNOA 5AUIA 1F2RI 2K0PA 1NI2A 3CMMB 2Z0DB 2K25A 4KIKA 4O1NA 5LXIB 3IT6B 4MGZE 1U4AA 4BVUC 3SFDB 2KANA 4MACA 5E6OA 2CU3A 1TT5B 4IDIA 1SIJA 1E8WA 3NG0A 3NVYA 3Q8FA 1FNUA 1UUPA 4ZRJA 3V3XA 2V3NA 2FCSA 2BKRB 1YJJA 3B08A 3ZDTA 4A6QA 2VZKB 2KAJA 4A55A 3WAMA 2C7HA 1X1MA 3U4EG 1LO5D 1XLQA 4XE0A 4EZLA 1C79A 2LFIA 3P4RB 5GXGB 4HDOA 2NPTA 5HKHA 2LHEA 3PPAA 3DHHC 2EELA 4JGHB 3VVWB 3V61A 4M8NA 1MJDA 3H7PB 2MRPA 1K50A 2LGIA 2NVUI 1V1PB 2D10A 2W8HA 3L4PA 3TEXA 4QAYA 3SD5A 2G45B 3A9JA 1WGDA 2DX5B 2YVCA 1IP9A 3ZO5B 1VJKA 2NTSA 4HRSA 2XK5A 3VTUA 3IXSA 3FKYA 1QOFA 2ZEQA 5IOIA 4IW0A 1P9DU 4NAMA 4LCDE 2BB6A 4N59A 4RGOS 1NEKB 3TEYA 1IBXB 2BVCA 4P7IA 4W9HA 4YL8A 2O6VA 2MCNB 5HFYA 4NJ7A 1K8RB 3N32A 4RF0A 1JWBD 2Y5PA 2LRWA 3SDLC 2XEWA 1PDXA 2RR9A 1BXTA 1QOGA 5TR5A 2J52A 1L5PA 1TS2A 3T3OA 1K53A 2QDFA 2K6QA 2VZKD 2N7EA 1FNVA 4ARCA 2G4SA 2SAKA 1C4AA 1KLGD 3EFCA 1IGDA 4DXFA 3LJ3A 4ZHPA 4EE2A 4GDLA 1R4MI 1T6BX 4M00A 4G0NB 3ZIMA 2WYQA 2PTLA 3GZNB 2WNMA 3ML9A 1D5XC 4IUMB 4J3OD 1MG8A 1WXMA 4HWIB 3AU4A 1V2YA 2WXIA 1R4MB 1LXDA 2LGYA 1UD7A 3RNFC 4OZCA 2WDQB 2REXA 1WXQA 3U8ZA 4ZRIA 1GB1A 3SU8X 5G2NA 3PV1A 1C4CA 3DPDA 3QWZB 4HEA1 5JXVA 1WFYA 2M17A 2I38A 3AM9A 2CJOA 5D2MB 2EKEC 4MGIE 4BZAA 1L6VA 4P6VF 4KGSA 1WSPA 5HHDG 1Y56A 2LWPA 4FJYA 1LGRA 1JRPA 3OG5A 4XGAB 2DNFA 2KYWA 2UU7A 1P7EA 4BKGA 3T3NA 3HIZA 1FXTB 1SEBD 1EWCA 1E10A 3PTFC 2BW2A 1S1QB 3TBLD 1JCKB 4ZHOA 2B3AA 2KN5A 3NRZA 3MJ5A 2WXFA 1H4RA 2WX1A 4TMAB 2X8XX 4A3OA 4JLCA 2Z8LA 3KUDB 4IM2A 1RM6C 2N4FA 1VD2A 1OEYJ 5EE9A 4DDGD 1EO6A 3HVZA 3KUCB 4GU2A 1SE2A 3MFGA 3NZUA 1VLBA 4A8XC 5DPWA 2Y5BB 1QOAA 5BO4B 5LNK1 1Q5WB 4FA6A 5EE0A 3LDZE 1ET9A 1KRHA 1NVID 1XQQA 3TSSA 4KSLC 5L83A 1SE9A 3A1QB 2MBEA 2FIFA 2SEBD 2KMCA 4W9LA 4NY0A 1H8CA 4FN2A 1L6UA 2KKCA 4NAWA 4GIVA 5E6PA 3U2SC 3UQAA 2R2OA 2N0SB 2RGFA 4JL9A 3RN9C 3DBRI 1XXGA 3ZTCA 4BAXA 1ZUD2 2WX0A 4X57B 2J0JA 1WJNA 2OJWA 2BBCA 1RFKA 2EMTA 4WWOA 3VXWA 4MGYE 1QT9A 2WDVB 2JQRB 5G55A 3AU5A 2DHZA 2L52A 3DBRB 2X38A 2NS5A 1E90A 2ZPNA 2VH1A 4ITKA 3RD2A 2EKIA 1E7PB 5AZGA 1OGWA 4HVBA 1CJEA 2BKFA 4RCOA 4AQ7A 4HDQA 2IJ0A 3DHGC 3PRMB 2FCMA 2E3TA 2MH7A 2JSVX 5EE1A 2V3PA 3MHSD 1MI0A 5J2RA 3H1UA 5AZHA 4FHKA 4USAA 1NI3A 4OHJA 4K81A 3B2FA 1N6ZA 1KH0A 3JSVA 3NY5A 4IOIE 5FKAC 2MLBA 3CF6E 2BTEA 3ZVVA 1SB3C 1L0XB 4ZYSA 1WWTA 2LRUA 1IPGA 1JWMD 4YSXB 1CMXB 1V49A 2KTRB 1VDVA 1WGGA 2KX3A 3Q8CA 1UGJA 2V3SA 4OW0A 4HJKA 3RPFC 3CWIA 1CK1A 2AL3A 2KC2A 2QIEB 1TY0A 4B0MA 2CHXA 3DDCB 3AE6B 2MBHA 4RM9A 3CSFA 1A70A 1WE6A 2PPHA 4JWUC 1WMHB 2INCC 3TJPA 1WM3A 2FIDA 1TGZB 3L08A 4KZCA 2M56B 2KQ7A 1PGXA 4IKGA 2KMAA 2JXTA 2IGGA 1OTRB 2BB5A 3RNGC 1SE3A 3C8YA 3Q8AA 1YMHE 2XN9C 3BVGA 3HVDA 1R7SA 1K51A 1RRBA 1WZ3A 2RDHA 4MM3B 2ZPYA 4FBJB 4CQNA 3PRPB 1N5WA 1VZ6A 1OQQA 1P7FA 2LJ5A 2WXKA 4REZA 2GBNA 1EM7A 5D3DA 1HTQA 2PVOD 3PZDA 2LVOA 3UINB 3OWEB 3P2BA 3AEAB 4I6LB 4BKSA 4HCPB 1WX9A 1TS3A 3PHWB 2W54A 2QEJC 3AI5A 2I1JA 1FXIA 1I4GA 4KGTA 3WA0A 2J0KA 2LEKA 2ASQA 1FO4A 5DPRA 1F1HA 2K5PA 3ZRFA 4NQLB 1ZDVA 1YN4A 4XZ4A 1KTKA 4EEWA 1YQ4B 4AP4C 4LLGM 2AYOB 3QIJA 4J6IA 3B2GA 1L2NA 3AE3B 3QA8A 3TMPB 3U30A 1RWSA 3IT4B 4DBGA 4W9IA 3R7RA 1OFFA 3BINA 3QX1A 4LJOB 2H88B 5BYQA 2KFKA 2ONQA 2KC1A 1C77A 4IG7B 4AJYB 1TJEA 4GDKB 4H2AA 1WGYA 3RZFA 3SFEB 2N9KA 1VRAB 1T0QC 1XCQL 2UWQA 4MJSA 3P4QB 5JH5C 1FCLA 3BIID 2WXJA 1N63A 5FR3A 4WWMA 2MJDA 2PEAA 2NBUA 2LVPA 1P98A 2L05A 1WXSA 4C7ZA 3JYUA 2ZNVC 2KZRA 3MTNB 3SEBA 4HXDA 1WE7A 1G6JA 2G3QB 5IP4D 4RF1A 3PLUA 1N5XA 3VH4B 3W2DA 4P1BC 4YTNB 4S0RA 2DYMA 4LJPB 1E0ZA 3AE9B 4NJ6A 3UIOB 2BS4B 3X0WA 1EU4A 3R8BA 1SBBB 4XX5A 1ZOYB 1JWAD 3FC4A 3APDA 4HPMB 3RNCC 2DBYA 4HLEA 2GRIA 2NBVB 3IAM1 1ZXIA 1PGBA 1SE4A 2OHFA 1FIQA 1ACCA 3DWGC 1P1AA 4GXBA 2D3BA 2JF5A 3RI7C 3ZJTA 1GNUA 4LNIA 3MC0B 1SIFA 2IYDB 3DOWA 5IO9A 3GS2A 1VCBA 2J0MA 1UF0A 2JWUA 3DVNU 2IO0B 2L32A 1TKYA 2K39A 2LGXA 3KQ4A 2VH2A 2RPVA 1AARA 4LNKA 3A4RA 5BYRA 5LXHA 1YJIA 4PYUA 3VRAB 3DVGX 4M0WA 1ZPSA 5G5GA 2KJ6A 2KXJA 3MC9A 2JPHA 3BYYB 2O2VB 4ANVA 5LLIA 1ZXHA 1TKEA 2KT7A 3QAQA 1UH6A 4MSMB 5FK9C 1HTOA 1T3QA 3VUWA 3OAWA 1AYFA 1WIAA 2NCNA 4NPNA 2LVQA 2N1VA 1QF6A 4ICVA 4ZRQA 1TIFA 2KDEB 1B9RA 3ZKJC 3PGEA 1J0GA 5FR6A 2HJ1A 1D5ZC 2KNBA 5CX3A 2DZIA 2KMMA 1PFDA 3EECA 4N58A 3SHQA 2QMTA 1FPYA 2GB1A 2KVZA 2MQJA 2FE8A 4ASWC 3DBSA 2MP2B 2JWZA 1YX6B 3IVFA 3KUZA 1ROEA 2C5LC 4TSSA 1KLUD 5TSSA 4KKJA 1N62A 2DZMA 2YLMA 4US9A 1TS5A 2KACA 4WAFA 3C19A 2CHWA 2JT4B 4HPLB 5CHFA 4KX6B 2GOWA 1C78A 3Q3NC 3TL5A 2I1KA 1V8CA 2GBRA 1QILA 4JQWC 2D5GA 5HI1A 4EFOA 3CSTA 2DYBA 3R66C 3P4SB 3AH7A 3ZJUA 2KN4A 2KWVB 2W3RA 1FRRA 2BPSA 2C60A 2Y5CA 4WJPA 2J4XA 1L0YB 1ZGUB 2WDTB 3UF8A 2LD9A 2WP9B 4RMAA 3PT2B 2CU1A 3H8HA 1FD6A 3KH0A 4BKTA 4IC7B 2DWQA 3NZSA 2WXRA 3EFUA 2KFJA 3RFZB 1XLOA 1MG4A 3TIXA 5BMGA 4W9EA 3AE1B 2M1MA 2RMMA 2CHZA 4YSZB 1C76A 4R3DA 3ZQ4A 2JYEA 3ZGZA 2QJLA 4K7WA 1SSNA 3B0AA 2BQQA 4LDTB 2GMIC 2JXXA 1FRDA 3ZXVA 3AULA 1UBIA 4II3B 4C4VA 2ZCBA 2FBWB 2V4LA 4HJGE 2AQ1B 5H8YE 5D7GA 3ZNHB 1XT9B 2HTME 2MJEA 3AEEB 1WJUA 3VDZA 5JHAA 1KLVA 2RSUA 3B1LX 2MJ3A 3Q6BA 2PVGC 2L76A 1EF5A 1Z5SB 4HROA 1I42A 2LASA 3C0RB 3QARA 3J9CA 1F9JA 1JROA 2IGHA 1MPEA 1UBQA 2R61A 5AEKB 1FXAA 2PW9A 1D6EC 2N9PC 1JQ4A 1V1OA 4ARIA 3QK0A 2LUEA 4RNAA 4K3BA 2RD0A 3PZ8A 4OZBA 3AE7B 3BVMA 4KIKB 1PGAA 3O65B 3VR9B 2K8CA 4MGKE 3ZYYX 2ZJDA 1DOXA 1XCTL 2DZJA 2BT6A 2KDFB 2WS3B 2W8IA 4JE3B 3W1YA 2R2QA 1FNWA 3HK0A 3TEWA 4YTMB 1TYGB 3NS8A 2WXLA 4IWQA 4A90A 2Q5WD 5IKCM 4MELA 3ZW3A 2L7RA 1ZP0B 2WXMA 1FFUA 1E6EB 1F52A 1JRUA 3RNAC 4PS8A 2MBOA 1ISNA 5MPOA 1D3ZA 3KW5B 2NPTB 1UGMA 3RNEC 2FCNA 4AJWA 3AEBB 5IN7A 2DENB 4CYEA 4DHJB 2JRHA 3IHPC 1V6EA 3M3JA 3UI3A 4LNFA 3A9JB 1TZ1A 4WURA 2WU2B 3FILA 1AN8A 1MHXA 1V9JA 3WANA 2B76B 3PO0A 1EF1A 4OZAA 2XK5B 1E8XA 5BMIA 3L13A 4PS7A 4PS3A 2LZ6A 4FULA 1ZW7A 1DOIA 1GC7A 2IZVB 4WWPA 3QCAA 3ONSA 3ABVB 3WALA 5D6JB 1B1ZA 1QOBA 3RUIB 2ON8A 1JWUD 1J19A 4A9AA 2K8HA 3A33B 2O6VB 3ZNZB 4ACFA 1C9FA 3MJWA 1ZE3D 2KQSA 5C23A 1WYWB 2KD0A 5KHOA 2QCZA 1F0ZA 4FHJA 4WAAA 3CIRB 2AX5A 1WF9A 4P16A 3NUHB 4ZRPA 2GBKA 3A4SC 1J7BA 5CTRC 1EWYC 2JVCA 4FXCA 1UZXB 1KOTA 2AEHA 3BZDB 4GDLB 3O13A 1JMLA 3ZTDA 3ZDMC 2KDIA 1WXAA 4NNJB 2WXGA 1T0YA 2N1WA 3VQIA 3VUXA 1WR6E 1GG3A 1WZ0A 3H7PA 2ZW0A 1E8ZA 1F77A 1V1PA 3TUOA 4DHJD 3GE3C 1T5XD 2LXCA 2WU5B 3EC8A 3URYA 4NQKE 3H7SA 1N61A 2BWFA 1YIWA 3VTVA 4WJOA 2CR5A 2A4ZA 1RAXA 1UWXA 4W9JA 2C7MB 2BWES 4RM8A 2WGSA 4CHKA 4FJVB 2WXHA 4WQOB 2M19A 3L10B 4KGRA 1CQVA 1ESFA 4UDUC 4EZJA 1P3QU 4K3CA 2QC8A 4CO7A 3OLMD 2D3GA 2Y3AA 3N1ZC 1IBXA 2WHIA 3PSEB 4BOSC 4NZLB 4ZDVA 4MH8A 1P0RA 2O6VD 3X23A 1WX7A 4GOCA 2VRRB 2W3SA 5CHVC 2KWCA 3P63A 4YTPB 3KYDD 1IUEA 3AEGB 4HKZE 1JW9D 4XC2A 1FMAD 1XEEA 1YN5A 3ECIA 1ENFA 4G3XB 4F7ZA 1QQRA 4C56C 1YJ1A 2ICIA 3IAS1 2IBIB 1I4HA 4LNNA 1NENB 5DPTA 3AEFB 2QHOA 3RYTA 2KHWB 2WQYB 2AQ3B 4ANXA 4EOYA 1Q0WB 3RULA 4BBNC 1LM8B 3KLSX 4AS1A 1WM2A 3S2AA 3DBHI 3AXCA 2N9XA 2GBMA 3WAOA 4AUQC 2N9LA 2LI5A 4WIPA 4BBNF 2IO3B 1TTNA 5AUKA 2MBBB 2JZPA 4OVVA 4NAWB 4LK0M 5H92C 3N20C 2L0TA 2WXQA 4E74A 3DBHB 3I5JC 4YSYB 3VRBB 1NBFC 2GBJA 1V5TA 2ZVOA 3T9LA 3RMKC 3VFKA 1R4NI 1WGKA 1A5RA 2RPQA 2FAZA 2V4IB 2LXAA 3RCZA 1KF6B 3L0WB 3NJTA 1YD8U 4KKIA 4ANWA 3AECB 1I4RA 4BFRA 1YN3A 3ENEA 4DDID 3H9DA 1MHHE 2OJRA 5J17A 2V9HA 2TSSA 1GJZA 2OEDA 1SXTA 3P1MA 2UYZB 4AWJA 2IPKD 3BWUD 2KVRA 3PREA 2HDEA 1PQSA 3BY4B 2JZZA 2Z0EB 4MEMA 1NDDA 1IYFA 4TKNA 2M0AA 2HJ8A 1STEA 1E7VA 1N60A 2KK8A 4DXGA 3E9SA 4I6NB 3I3TB 1NYRA 3JSVB 4M8MA 2INNE 1TKGA 2ZZPB 2FCQA 2KDMA 4KSKC 3DBLI 3UQBA 3A1QA 3KWLA 3W9CB 2JX5A 2XNAC 1XF5L 4XDDA 1UNSA 2PE6B 3Q3JA 4HKQA 5BMHA 1VZ7A 4KDIC 1S3SG 1YQBA 3P4PB 4HPPA 5IA7A 4BOZB 4K1RB 2KDBA 2DZKA 4GGQA 3DBLB 4L2YA 4II2B 2CS4A 3EA6A 5E6NA 1DOYA 3N9YC 1KM7A 1WXVA 5JZEB 1FCCC 3L17A 5EDSA 2LJIA 3KWVA 4PT5A 2AWTA 2LUMA 4L1BA 2BYFA 4XDCA 4F1SA 3HHMA 4IWOA 2J58A 4FJZA 3AE8B 4RH6A 2J53A 2KJRA 1EUVB 2MW5A 5C2TB 4MT5A 2ZVNA 1TY2A 3DQVA 5BYSA 4YXDB 3DVGY 3M63B 1WJ6A 3PZ7A 2W55A 2K8BA 2K6DB 1CZPA 4TV3A 2KOXA 1UELA 2C7NB 1WH3A 3Q14C 4N9F4 4ANUA 3QQ8B 4C00A 3ZJVA 4GN1A 3R2IA 2YEPB 2J7QB 4B95A 3APFA 2JY6A 3I57A 4S17A 3VHTC 2BGFA 3A9KA 4B0EA 4RGTA 3N1YC 1QKZA 3NVVA 1SJED 4XYCA 4ZRKA 2LHDA 2FUG1 4DHZE 3Q3MC 3DVNV 4E71A 4WH4A 2KTRA 4W9FA 1WYGA 2BYTA 3U52E 4RFBA 1Q1OA 3KYCD 3K9PB 1OEYA 1I35A 3GZNI 3LB8C 4M02A 1BT0A 3V60A 4C7YA 1XLPA 3AV8A 1M4VA 4TUUA 3U7ZA 2C9WB 1Q10A 2QILA 1DGJA 3UGBB 2ZNVB 1WMHA 2IY0B 4ZOHC 1WY8A 1BMLC 1HEZE 4G50A 3ZXRA 3BYTB 2M4NA 3EUB2 2KFKB 4D2KA 1WJ4A 1XO3A 2BYEA 2DAFA 2A5UA 4KDLB 4YT0B 5C1ZA 3QJZA 4ICUA 1GAQB 3NVWA 5D3IB 3PS6A 2L0FA 2KX0A 4MJSB 4MM3A 5I4DA 3PHXB 1JWSD 4Q2JA 2IDYA 1WGHA 2KLGA 4A3PA 4W9CA 2LGSA 4C80A 3R3MA 3VTWA 1E7UA 4JIOU 1V81A 1GB4A 4AOFA 2WXPA 3HM6X 3RT3B 2RDGA 1WRIA 3W5VB 1FFVA 4BKSD 4GMVA 5EE3A 2D3CA 4IM3A 2WLBA 3Q3FA 3V6CB 2M0XA 3QHTA 4B9KA 2OOBB 3PRZA 1XLNA 4WQMA 5CHWA 5DCNA 1SGHA 3FAHA 1RYJA 2KTFA 3GB1A 1DYQA 2ACZB 3Q69A 3BK1A 5GMVA 4KV2A 4PK1A 2KWUB 2D2QA 4RGMA 2JU6X 2JYTA 1YNTE 5JHBA 1TS4A 4WJQA 2PLPA 1WX8A 2FNJB 3VAWA 4I6PA 3WCQA 5E6JA 2W9NA 4EUTA 3TEZA 4M0WB 2IO1B 2RDBC 4G11A 1OQYA 4IWPA 2K9XA 2D3AA 3OJ4B 3L16A 4GDKA 3NS1A 2MWSB 3ML8A 1KJTA 4LDTD 1T0RC 1QZEA 4NJCA 1RLFA 1L4ZB 3GE8C 2PJHA 3GP7A 4JX1C 3N3KB 3Q2AC 2NTTA 2PE9A 1VR9A 3AE4B 2DAJA 2V1YA 2N7JA 3K9OB 4E3CA 4URKA 2L1AA 1E5WA 1GC6A 3KVFB 5DPSA 1MFWA 2W82A 1VZ8A 1L4DB 1I4QA 1V86A 1C4PA 2WXOA 3JW0X 1ET6A 3EHVA 3N30A 4FADA 3ZNGC 1LQBA 3DCGA 1XD3B 2PIAA 4DWFA 3AE5B 3JVZX 3WAPA 3AMZA 1I4XA 1HXYD 1GUAB 1KFYB 2KWDA 2JZ3B 4KVGB 3V62A 1K52A 5L95C 2MA9B 2G4DB 1WRDB 1UWMA 1Y8RC 2DLBA 4B6WA 4DXAB 2IGDA 1NYQA 3MHZA 3A9KB 2ZW1A 1J7CA 3H6NA 2NBWB 4ZYNA 4XWWA 2MSED 2WDRB 4W9GA 3ETRA 2BS2B 2EMSA 3E56A 4TQ0A 1FM0D 3I63C 4GLSC 1I4PA 2K1FA 2GLSA 2LMCA 2O2VA 1EU3A 3NHEB 2L3ZA 3N1XC 3LXFA 2D11A 2E6XA 2INPE 4HCNB 3AEDB 4OVZA 4L23A 4OVUA 1V5OA 2XBBC 3RZWC 2D07B 3WIMA 4TQ1A 1AW7A 4EKUA 2K3UA 4MH0E 3B9JA 2V0GA 3PVLA 2K22A 2JRIB 3VH3B 1TBEA 2L83A 3L54A 1YX5B 4HK2A 2M8SA 3P42A 3VR8B 1M94A 5HG2A 3W1SA 2MBQA 1Z2MA 1IGCA 5G5HA 3HRDD 1F2RC 2AL6A 1L7YA 3ZLZA 1SJHD 2N9EB 3DHIC 4P1CC 4XWTA 2QSDA 2BS3B 3V05A 1WI0A 1BUIC 3GOEA 3EGRA 1HZ6A 3UIPB 1PUTA 3HM3A 2CJNA 1YOVB 3OJ3A 4DHZB 4KZ0A 2MP2A 3BK2A 2KO3A 1WGRA 1LFDA 3ZNID 4C4VB 1L0VB 1V80A 1OQRA 3IFWB 3Q8BA 1YQ3B 3AN1A 2ZCCA 3TCAA 1HA5A 4DQOC 4W9KA 3V6EB 2PMVA 4WJNA 4MSQB 3W1SC 3U7DA 2KQ4X 1I7HA 3APCA 4N6EB 1J8CA 1SF0A 2J42A 1C3TA 3AB5A 1J7AA 3R2TA 1JALA 3ALBA 2BF8B 1WR1A 3AE2B 4YWGG 2NMQA 3T8MA 2MX2A 3M95A 3IBEA 2GI9A 4GSWA 3LYYA 4W9DA 2G1EA 5D94A 1GOZA 4RGNA 1HE8A 4K7SA 1ZKHA 2DYOA 4M01A 4A20A 4EZKA 1V97A 2WWZA 2HE7A 2IY1B 3BVZA 3PLVA 3NOBA 5T8IA 2L00B 1E9MA 2N7DA 2CKHB 1D4BA 2PKOA 5IAAC 3QC8B 4DK5A 1T0SC 2G9HD 2YEPF
chains in the Genus database with same CATH topology
3DWMA 1VDVA 3SR6A 5C2TB 4MT5A 1GPXA 3Q8CA 1UGJA 4JPSA 4JWSC 4US8A 1ZDXA 2AQ2B 4OW0A 3J9CA 1TY2A 5BYSA 4YXDB 5C3JB 1JROA 2IGHA 1MPEA 2R61A 3PZ7A 2W55A 4LTUA 3CWIA 1CK1A 3RPFC 1FXAA 2QIEB 2PW9A 1TY0A 1D6EC 1JQ4A 4B0MA 1CZPA 1V1OA 2WXNA 4ARIA 3AE6B 1A70A 4RNAA 2MEKA 3PZ8A 3ZJVA 1HZ5A 3R2IA 4JWUC 4OZBA 2YEPB 3AE7B 3MP9A 3BVMA 1PYWD 1PGAA 1FEHA 1TZOA 3VR9B 3I57A 3HUIA 4B0EA 4RGTA 3ZYYX 1DOXA 1XCTL 2BT6A 2M56B 1AWDA 1PGXA 1QKZA 2WS3B 3NVVA 4IKGA 1SJED 3FILB 2W8IA 2LHDA 4JE3B 2JXTA 3Q8EA 2IGGA 2FUG1 1FNWA 1HQRD 3TEWA 4YTMB 2BB5A 1TYGB 4WH4A 1D5MC 1SE3A 2WXLA 1WYGA 3C8YA 3Q8AA 2BYTA 3U52E 4A90A 1YMHE 2XN9C 4RFBA 3BVGA 3HVDA 2Q5WD 3NZ3A 1R7SA 1K51A 3W5UB 1QLBB 2H89B 2RDHA 4MM3B 3LB8C 1MVKA 1ZP0B 2WXMA 4CQNA 1FFUA 1E6EB 1N5WA 1VZ6A 3I9V1 1OQQA 1P7FA 3NVZA 2WXKA 4C7YA 1XLPA 4REZA 3AV8A 5MPOA 1M4VA 3U7ZA 2I2YA 1EM7A 5D3DA 1Q10A 5AUIA 2QILA 1DGJA 1F2RI 2K0PA 2PVOD 3AEBB 3OWEB 4O1NA 3IT6B 3SFDB 3AEAB 4MACA 2CU3A 4ZOHC 1TS3A 3UI3A 1BMLC 1HEZE 1SIJA 4IDIA 4WURA 3NVYA 3Q8FA 2WU2B 1FNUA 1UUPA 3BYTB 2W54A 3EUB2 3FILA 1AN8A 2QEJC 1MHXA 3V3XA 2V3NA 4A6QA 4D2KA 1YJJA 1XO3A 1FXIA 1I4GA 4KGTA 2VZKB 2LEKA 4YT0B 2B76B 2KAJA 4A55A 1GAQB 3NVWA 5D3IB 1FO4A 3PO0A 4OZAA 5BMIA 3U4EG 1LO5D 2K5PA 1XLQA 5I4DA 1ZDVA 1DOIA 4XE0A 1YN4A 1C79A 1JWSD 4Q2JA 2IDYA 2LFIA 1KTKA 3P4RB 1YQ4B 3ABVB 4C80A 5GXGB 4LLGM 1B1ZA 1QOBA 2LHEA 2ON8A 1JWUD 4A9AA 2EELA 1GB4A 2WXPA 1K50A 1C9FA 2LGIA 1V1PB 3B2GA 3AE3B 1ZE3D 2RDGA 1WRIA 3W5VB 1FFVA 2W8HA 1RWSA 3L4PA 3TEXA 3IT4B 1OFFA 1F0ZA 5EE3A 2H88B 5BYQA 2WLBA 3CIRB 2ONQA 2AX5A 1C77A 1TJEA 4GDKB 4P16A 4H2AA 3NUHB 1VJKA 1XLNA 4ZRPA 4WQMA 2NTSA 4HRSA 3SFEB 1J7BA 3FAHA 1EWYC 1RYJA 2N9KA 1VRAB 3IXSA 4FXCA 1XCQL 3GB1A 1QOFA 3P4QB 3BZDB 4GDLB 1FCLA 1DYQA 3BIID 2ACZB 2WXJA 3O13A 1N63A 3Q69A 4NAMA 5FR3A 4WWMA 2MJDA 3BK1A 2BB6A 4N59A 1JMLA 4RGOS 1NEKB 4RGMA 3TEYA 2JU6X 2JYTA 1YNTE 4C7ZA 1TS4A 1IBXB 2WXGA 2PLPA 3SEBA 3VQIA 2ZW0A 5HFYA 1F77A 1V1PA 3TUOA 4RF1A 3WCQA 1N5XA 4RF0A 1JWBD 5E6JA 3W2DA 1T5XD 2Y5PA 3URYA 2WU5B 1PDXA 1BXTA 1QOGA 4YTNB 1N61A 3TEZA 2J52A 1L5PA 1TS2A 2DYMA 3T3OA 1E0ZA 1K53A 3AE9B 2VZKD 1FNVA 2K9XA 2BS4B 1EU4A 3R8BA 4ARCA 1UWXA 2SAKA 1SBBB 3NS1A 1C4AA 1KLGD 1ZOYB 1JWAD 2WXHA 3FC4A 2DBYA 1IGDA 4DXFA 4NJCA 2GRIA 2M19A 1L4ZB 3IAM1 1ZXIA 1PGBA 1SE4A 4ZHPA 2OHFA 4KGRA 4EE2A 1CQVA 1FIQA 1ESFA 1ACCA 3GP7A 4JX1C 3DWGC 4UDUC 1T6BX 2NTTA 3ZJTA 3MC0B 1VR9A 3AE4B 3GS2A 2Y3AA 2PTLA 2N7JA 1IBXA 2JWUA 2WNMA 4NZLB 4MH8A 2L32A 1D5XC 1TKYA 2L1AA 4J3OD 3KQ4A 2W3SA 3P63A 2RPVA 2W82A 5BYRA 2WXIA 1VZ8A 4YTPB 1YJIA 1L4DB 1IUEA 1I4QA 2WXOA 1C4PA 3AEGB 4OZCA 2WDQB 3VRAB 4M0WA 4HKZE 1ET6A 1ZPSA 5G5GA 1JW9D 1FMAD 1XEEA 1WXQA 1YN5A 1GB1A 1ENFA 3BYYB 1QQRA 2PIAA 1C4CA 4C56C 4HEA1 5JXVA 3AE5B 2ICIA 3IAS1 2I38A 1I4HA 2CJOA 3AM9A 1NENB 1ZXHA 1TKEA 3AEFB 3AMZA 5FK9C 2WQYB 1I4XA 1HXYD 1KFYB 1T3QA 2AQ3B 2KWDA 1L6VA 4P6VF 4KGSA 1AYFA 1WSPA 5HHDG 1Y56A 1K52A 1JRPA 3KLSX 4AS1A 1UWMA 2DLBA 1P7EA 1QF6A 2IGDA 4ZRQA 1B9RA 3T3NA 2N9LA 4WIPA 1NYQA 3MHZA 5AUKA 1SEBD 1J7CA 1EWCA 2ZW1A 2JZPA 4XWWA 1E10A 1D5ZC 2BW2A 2WDRB 3ETRA 2BS2B 1JCKB 3E56A 4TQ0A 4ZHOA 1FM0D 2KMMA 1PFDA 3NRZA 4LK0M 4GLSC 4NAWB 1I4PA 3MJ5A 5H92C 2WXFA 4N58A 4TMAB 2LMCA 2WXQA 2QMTA 1EU3A 4YSYB 3VRBB 2GB1A 3LXFA 2Z8LA 1RM6C 2E6XA 2INPE 3AEDB 2FE8A 4OVZA 1WGKA 4L23A 5EE9A 3HVZA 2V4IB 1ROEA 1SE2A 3MFGA 4TQ1A 1AW7A 1VLBA 4TSSA 1KF6B 2K3UA 4A8XC 1KLUD 5TSSA 4KKJA 1N62A 3B9JA 2V0GA 2K22A 1QOAA 4KKIA 4US9A 2L83A 5LNK1 1TS5A 2KACA 4WAFA 3AECB 5EE0A 1I4RA 1YN3A 3P42A 3VR8B 1ET9A 1KRHA 5HG2A 3W1SA 1NVID 1MHHE 4KX6B 3TSSA 1C78A 1IGCA 5G5HA 3HRDD 1V8CA 1F2RC 2SEBD 1QILA 2TSSA 2OEDA 1SXTA 3P1MA 2D5GA 1SJHD 5HI1A 1L6UA 2IPKD 4XWTA 3U2SC 2QSDA 2BS3B 3BWUD 3V05A 3P4SB 2N0SB 2HDEA 1BUIC 3AH7A 3EGRA 3ZJUA 2KN4A 2W3RA 1FRRA 1HZ6A 1XXGA 1ZUD2 1PUTA 2Y5CA 2CJNA 3BK2A 2J4XA 2M0AA 1L0YB 1L0VB 1STEA 1OQRA 1N60A 2BBCA 1RFKA 4DXGA 3Q8BA 1YQ3B 1QT9A 2WDVB 3E9SA 2WP9B 2JQRB 1NYRA 3AN1A 2INNE 1HA5A 4DQOC 2L52A 3H8HA 2PMVA 1FD6A 1TKGA 2X38A 2KQ4X 2DWQA 2KDMA 4N6EB 1SF0A 2J42A 2WXRA 3AB5A 4ITKA 2EKIA 1E7PB 1J7AA 3R2TA 3KWLA 1CJEA 1JALA 4YWGG 3W9CB 3RFZB 3AE2B 2JX5A 2NMQA 2XNAC 1XLOA 1XF5L 4RCOA 4AQ7A 5BMGA 2IJ0A 4XDDA 1UNSA 2GI9A 3AE1B 3LYYA 2RMMA 4HKQA 4YSZB 1C76A 2G1EA 5BMHA 2E3TA 4R3DA 1VZ7A 1GOZA 2MH7A 3P4PB 2JYEA 3ZQ4A 3ZGZA 2JSVX 5EE1A 2V3PA 1MI0A 4RGNA 2QJLA 1SSNA 2DYOA 4L2YA 3EA6A 1FRDA 1DOYA 3N9YC 1V97A 2FBWB 4USAA 1NI3A 1FCCC 4HJGE 4OHJA 2AQ1B 3B2FA 5H8YE 5D7GA 1KH0A 2LJIA 3BVZA 2HTME 2MJEA 3KWVA 3AEEB 4IOIE 5T8IA 4PT5A 5FKAC 2LUMA 4L1BA 2BTEA 2MJ3A 4XDCA 1E9MA 2J58A 1SB3C 1L0XB 4ZYSA 2PVGC 1D4BA 2PKOA 1WWTA 3AE8B 4RH6A 2J53A 1JWMD 4YSXB 4HROA 1I7HA 2G9HD 2YEPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P42 A;  2W8I A;  2W8H A;  2J58 A; 
#chains in the Genus database with same CATH topology
 3DWM A;  3SR6 A;  1GPX A;  3R7Q A;  4JPS A;  2JUO A;  4JWS C;  4US8 A;  1ZDX A;  2BYV E;  2AQ2 B;  5C3J B;  2KJH B;  4LTU A;  4GB9 A;  4MDK E;  2LGD A;  2L8J A;  3Q3O C;  2KLC A;  3RNB C;  2WXN A;  1E8Y A;  4K7U A;  2MEK A;  3ZUN A;  1HZ5 A;  5J18 A;  3MP9 A;  1PYW D;  1FEH A;  1TZO A;  3D32 A;  3IG3 A;  4PYZ A;  2HD5 B;  3HUI A;  1R4N B;  2IO2 B;  5AZF A;  1AWD A;  3FIL B;  3Q8E A;  2MHJ A;  1HQR D;  3VUY A;  2NR2 A;  1D5M C;  3MC8 A;  3ZRC A;  2Z59 B;  2IND C;  4F8C B;  3NZ3 A;  4WWN A;  2FUH B;  3W5U B;  1QLB B;  3M62 B;  4FLH A;  4IM0 A;  2H89 B;  2HTH A;  1MVK A;  3I9V 1;  1RFA A;  3NVZ A;  5KHQ A;  1C1Y B;  2I2Y A;  4LNO A;  5AUI A;  1F2R I;  2K0P A;  1NI2 A;  3CMM B;  2Z0D B;  2K25 A;  4KIK A;  4O1N A;  5LXI B;  3IT6 B;  4MGZ E;  1U4A A;  4BVU C;  3SFD B;  2KAN A;  4MAC A;  5E6O A;  2CU3 A;  1TT5 B;  4IDI A;  1SIJ A;  1E8W A;  3NG0 A;  3NVY A;  3Q8F A;  1FNU A;  1UUP A;  4ZRJ A;  3V3X A;  2V3N A;  2FCS A;  2BKR B;  1YJJ A;  3B08 A;  3ZDT A;  4A6Q A;  2VZK B;  2KAJ A;  4A55 A;  3WAM A;  2C7H A;  1X1M A;  3U4E G;  1LO5 D;  1XLQ A;  4XE0 A;  4EZL A;  1C79 A;  2LFI A;  3P4R B;  5GXG B;  4HDO A;  2NPT A;  5HKH A;  2LHE A;  3PPA A;  3DHH C;  2EEL A;  4JGH B;  3VVW B;  3V61 A;  4M8N A;  1MJD A;  3H7P B;  2MRP A;  1K50 A;  2LGI A;  2NVU I;  1V1P B;  2D10 A;  2W8H A;  3L4P A;  3TEX A;  4QAY A;  3SD5 A;  2G45 B;  3A9J A;  1WGD A;  2DX5 B;  2YVC A;  1IP9 A;  3ZO5 B;  1VJK A;  2NTS A;  4HRS A;  2XK5 A;  3VTU A;  3IXS A;  3FKY A;  1QOF A;  2ZEQ A;  5IOI A;  4IW0 A;  1P9D U;  4NAM A;  4LCD E;  2BB6 A;  4N59 A;  4RGO S;  1NEK B;  3TEY A;  1IBX B;  2BVC A;  4P7I A;  4W9H A;  4YL8 A;  2O6V A;  2MCN B;  5HFY A;  4NJ7 A;  1K8R B;  3N32 A;  4RF0 A;  1JWB D;  2Y5P A;  2LRW A;  3SDL C;  2XEW A;  1PDX A;  2RR9 A;  1BXT A;  1QOG A;  5TR5 A;  2J52 A;  1L5P A;  1TS2 A;  3T3O A;  1K53 A;  2QDF A;  2K6Q A;  2VZK D;  2N7E A;  1FNV A;  4ARC A;  2G4S A;  2SAK A;  1C4A A;  1KLG D;  3EFC A;  1IGD A;  4DXF A;  3LJ3 A;  4ZHP A;  4EE2 A;  4GDL A;  1R4M I;  1T6B X;  4M00 A;  4G0N B;  3ZIM A;  2WYQ A;  2PTL A;  3GZN B;  2WNM A;  3ML9 A;  1D5X C;  4IUM B;  4J3O D;  1MG8 A;  1WXM A;  4HWI B;  3AU4 A;  1V2Y A;  2WXI A;  1R4M B;  1LXD A;  2LGY A;  1UD7 A;  3RNF C;  4OZC A;  2WDQ B;  2REX A;  1WXQ A;  3U8Z A;  4ZRI A;  1GB1 A;  3SU8 X;  5G2N A;  3PV1 A;  1C4C A;  3DPD A;  3QWZ B;  4HEA 1;  5JXV A;  1WFY A;  2M17 A;  2I38 A;  3AM9 A;  2CJO A;  5D2M B;  2EKE C;  4MGI E;  4BZA A;  1L6V A;  4P6V F;  4KGS A;  1WSP A;  5HHD G;  1Y56 A;  2LWP A;  4FJY A;  1LGR A;  1JRP A;  3OG5 A;  4XGA B;  2DNF A;  2KYW A;  2UU7 A;  1P7E A;  4BKG A;  3T3N A;  3HIZ A;  1FXT B;  1SEB D;  1EWC A;  1E10 A;  3PTF C;  2BW2 A;  1S1Q B;  3TBL D;  1JCK B;  4ZHO A;  2B3A A;  2KN5 A;  3NRZ A;  3MJ5 A;  2WXF A;  1H4R A;  2WX1 A;  4TMA B;  2X8X X;  4A3O A;  4JLC A;  2Z8L A;  3KUD B;  4IM2 A;  1RM6 C;  2N4F A;  1VD2 A;  1OEY J;  5EE9 A;  4DDG D;  1EO6 A;  3HVZ A;  3KUC B;  4GU2 A;  1SE2 A;  3MFG A;  3NZU A;  1VLB A;  4A8X C;  5DPW A;  2Y5B B;  1QOA A;  5BO4 B;  5LNK 1;  1Q5W B;  4FA6 A;  5EE0 A;  3LDZ E;  1ET9 A;  1KRH A;  1NVI D;  1XQQ A;  3TSS A;  4KSL C;  5L83 A;  1SE9 A;  3A1Q B;  2MBE A;  2FIF A;  2SEB D;  2KMC A;  4W9L A;  4NY0 A;  1H8C A;  4FN2 A;  1L6U A;  2KKC A;  4NAW A;  4GIV A;  5E6P A;  3U2S C;  3UQA A;  2R2O A;  2N0S B;  2RGF A;  4JL9 A;  3RN9 C;  3DBR I;  1XXG A;  3ZTC A;  4BAX A;  1ZUD 2;  2WX0 A;  4X57 B;  2J0J A;  1WJN A;  2OJW A;  2BBC A;  1RFK A;  2EMT A;  4WWO A;  3VXW A;  4MGY E;  1QT9 A;  2WDV B;  2JQR B;  5G55 A;  3AU5 A;  2DHZ A;  2L52 A;  3DBR B;  2X38 A;  2NS5 A;  1E90 A;  2ZPN A;  2VH1 A;  4ITK A;  3RD2 A;  2EKI A;  1E7P B;  5AZG A;  1OGW A;  4HVB A;  1CJE A;  2BKF A;  4RCO A;  4AQ7 A;  4HDQ A;  2IJ0 A;  3DHG C;  3PRM B;  2FCM A;  2E3T A;  2MH7 A;  2JSV X;  5EE1 A;  2V3P A;  3MHS D;  1MI0 A;  5J2R A;  3H1U A;  5AZH A;  4FHK A;  4USA A;  1NI3 A;  4OHJ A;  4K81 A;  3B2F A;  1N6Z A;  1KH0 A;  3JSV A;  3NY5 A;  4IOI E;  5FKA C;  2MLB A;  3CF6 E;  2BTE A;  3ZVV A;  1SB3 C;  1L0X B;  4ZYS A;  1WWT A;  2LRU A;  1IPG A;  1JWM D;  4YSX B;  1CMX B;  1V49 A;  2KTR B;  1VDV A;  1WGG A;  2KX3 A;  3Q8C A;  1UGJ A;  2V3S A;  4OW0 A;  4HJK A;  3RPF C;  3CWI A;  1CK1 A;  2AL3 A;  2KC2 A;  2QIE B;  1TY0 A;  4B0M A;  2CHX A;  3DDC B;  3AE6 B;  2MBH A;  4RM9 A;  3CSF A;  1A70 A;  1WE6 A;  2PPH A;  4JWU C;  1WMH B;  2INC C;  3TJP A;  1WM3 A;  2FID A;  1TGZ B;  3L08 A;  4KZC A;  2M56 B;  2KQ7 A;  1PGX A;  4IKG A;  2KMA A;  2JXT A;  2IGG A;  1OTR B;  2BB5 A;  3RNG C;  1SE3 A;  3C8Y A;  3Q8A A;  1YMH E;  2XN9 C;  3BVG A;  3HVD A;  1R7S A;  1K51 A;  1RRB A;  1WZ3 A;  2RDH A;  4MM3 B;  2ZPY A;  4FBJ B;  4CQN A;  3PRP B;  1N5W A;  1VZ6 A;  1OQQ A;  1P7F A;  2LJ5 A;  2WXK A;  4REZ A;  2GBN A;  1EM7 A;  5D3D A;  1HTQ A;  2PVO D;  3PZD A;  2LVO A;  3UIN B;  3OWE B;  3P2B A;  3AEA B;  4I6L B;  4BKS A;  4HCP B;  1WX9 A;  1TS3 A;  3PHW B;  2W54 A;  2QEJ C;  3AI5 A;  2I1J A;  1FXI A;  1I4G A;  4KGT A;  3WA0 A;  2J0K A;  2LEK A;  2ASQ A;  1FO4 A;  5DPR A;  1F1H A;  2K5P A;  3ZRF A;  4NQL B;  1ZDV A;  1YN4 A;  4XZ4 A;  1KTK A;  4EEW A;  1YQ4 B;  4AP4 C;  4LLG M;  2AYO B;  3QIJ A;  4J6I A;  3B2G A;  1L2N A;  3AE3 B;  3QA8 A;  3TMP B;  3U30 A;  1RWS A;  3IT4 B;  4DBG A;  4W9I A;  3R7R A;  1OFF A;  3BIN A;  3QX1 A;  4LJO B;  2H88 B;  5BYQ A;  2KFK A;  2ONQ A;  2KC1 A;  1C77 A;  4IG7 B;  4AJY B;  1TJE A;  4GDK B;  4H2A A;  1WGY A;  3RZF A;  3SFE B;  2N9K A;  1VRA B;  1T0Q C;  1XCQ L;  2UWQ A;  4MJS A;  3P4Q B;  5JH5 C;  1FCL A;  3BII D;  2WXJ A;  1N63 A;  5FR3 A;  4WWM A;  2MJD A;  2PEA A;  2NBU A;  2LVP A;  1P98 A;  2L05 A;  1WXS A;  4C7Z A;  3JYU A;  2ZNV C;  2KZR A;  3MTN B;  3SEB A;  4HXD A;  1WE7 A;  1G6J A;  2G3Q B;  5IP4 D;  4RF1 A;  3PLU A;  1N5X A;  3VH4 B;  3W2D A;  4P1B C;  4YTN B;  4S0R A;  2DYM A;  4LJP B;  1E0Z A;  3AE9 B;  4NJ6 A;  3UIO B;  2BS4 B;  3X0W A;  1EU4 A;  3R8B A;  1SBB B;  4XX5 A;  1ZOY B;  1JWA D;  3FC4 A;  3APD A;  4HPM B;  3RNC C;  2DBY A;  4HLE A;  2GRI A;  2NBV B;  3IAM 1;  1ZXI A;  1PGB A;  1SE4 A;  2OHF A;  1FIQ A;  1ACC A;  3DWG C;  1P1A A;  4GXB A;  2D3B A;  2JF5 A;  3RI7 C;  3ZJT A;  1GNU A;  4LNI A;  3MC0 B;  1SIF A;  2IYD B;  3DOW A;  5IO9 A;  3GS2 A;  1VCB A;  2J0M A;  1UF0 A;  2JWU A;  3DVN U;  2IO0 B;  2L32 A;  1TKY A;  2K39 A;  2LGX A;  3KQ4 A;  2VH2 A;  2RPV A;  1AAR A;  4LNK A;  3A4R A;  5BYR A;  5LXH A;  1YJI A;  4PYU A;  3VRA B;  3DVG X;  4M0W A;  1ZPS A;  5G5G A;  2KJ6 A;  2KXJ A;  3MC9 A;  2JPH A;  3BYY B;  2O2V B;  4ANV A;  5LLI A;  1ZXH A;  1TKE A;  2KT7 A;  3QAQ A;  1UH6 A;  4MSM B;  5FK9 C;  1HTO A;  1T3Q A;  3VUW A;  3OAW A;  1AYF A;  1WIA A;  2NCN A;  4NPN A;  2LVQ A;  2N1V A;  1QF6 A;  4ICV A;  4ZRQ A;  1TIF A;  2KDE B;  1B9R A;  3ZKJ C;  3PGE A;  1J0G A;  5FR6 A;  2HJ1 A;  1D5Z C;  2KNB A;  5CX3 A;  2DZI A;  2KMM A;  1PFD A;  3EEC A;  4N58 A;  3SHQ A;  2QMT A;  1FPY A;  2GB1 A;  2KVZ A;  2MQJ A;  2FE8 A;  4ASW C;  3DBS A;  2MP2 B;  2JWZ A;  1YX6 B;  3IVF A;  3KUZ A;  1ROE A;  2C5L C;  4TSS A;  1KLU D;  5TSS A;  4KKJ A;  1N62 A;  2DZM A;  2YLM A;  4US9 A;  1TS5 A;  2KAC A;  4WAF A;  3C19 A;  2CHW A;  2JT4 B;  4HPL B;  5CHF A;  4KX6 B;  2GOW A;  1C78 A;  3Q3N C;  3TL5 A;  2I1K A;  1V8C A;  2GBR A;  1QIL A;  4JQW C;  2D5G A;  5HI1 A;  4EFO A;  3CST A;  2DYB A;  3R66 C;  3P4S B;  3AH7 A;  3ZJU A;  2KN4 A;  2KWV B;  2W3R A;  1FRR A;  2BPS A;  2C60 A;  2Y5C A;  4WJP A;  2J4X A;  1L0Y B;  1ZGU B;  2WDT B;  3UF8 A;  2LD9 A;  2WP9 B;  4RMA A;  3PT2 B;  2CU1 A;  3H8H A;  1FD6 A;  3KH0 A;  4BKT A;  4IC7 B;  2DWQ A;  3NZS A;  2WXR A;  3EFU A;  2KFJ A;  3RFZ B;  1XLO A;  1MG4 A;  3TIX A;  5BMG A;  4W9E A;  3AE1 B;  2M1M A;  2RMM A;  2CHZ A;  4YSZ B;  1C76 A;  4R3D A;  3ZQ4 A;  2JYE A;  3ZGZ A;  2QJL A;  4K7W A;  1SSN A;  3B0A A;  2BQQ A;  4LDT B;  2GMI C;  2JXX A;  1FRD A;  3ZXV A;  3AUL A;  1UBI A;  4II3 B;  4C4V A;  2ZCB A;  2FBW B;  2V4L A;  4HJG E;  2AQ1 B;  5H8Y E;  5D7G A;  3ZNH B;  1XT9 B;  2HTM E;  2MJE A;  3AEE B;  1WJU A;  3VDZ A;  5JHA A;  1KLV A;  2RSU A;  3B1L X;  2MJ3 A;  3Q6B A;  2PVG C;  2L76 A;  1EF5 A;  1Z5S B;  4HRO A;  1I42 A;  2LAS A;  3C0R B;  3QAR A;  3J9C A;  1F9J A;  1JRO A;  2IGH A;  1MPE A;  1UBQ A;  2R61 A;  5AEK B;  1FXA A;  2PW9 A;  1D6E C;  2N9P C;  1JQ4 A;  1V1O A;  4ARI A;  3QK0 A;  2LUE A;  4RNA A;  4K3B A;  2RD0 A;  3PZ8 A;  4OZB A;  3AE7 B;  3BVM A;  4KIK B;  1PGA A;  3O65 B;  3VR9 B;  2K8C A;  4MGK E;  3ZYY X;  2ZJD A;  1DOX A;  1XCT L;  2DZJ A;  2BT6 A;  2KDF B;  2WS3 B;  2W8I A;  4JE3 B;  3W1Y A;  2R2Q A;  1FNW A;  3HK0 A;  3TEW A;  4YTM B;  1TYG B;  3NS8 A;  2WXL A;  4IWQ A;  4A90 A;  2Q5W D;  5IKC M;  4MEL A;  3ZW3 A;  2L7R A;  1ZP0 B;  2WXM A;  1FFU A;  1E6E B;  1F52 A;  1JRU A;  3RNA C;  4PS8 A;  2MBO A;  1ISN A;  5MPO A;  1D3Z A;  3KW5 B;  2NPT B;  1UGM A;  3RNE C;  2FCN A;  4AJW A;  3AEB B;  5IN7 A;  2DEN B;  4CYE A;  4DHJ B;  2JRH A;  3IHP C;  1V6E A;  3M3J A;  3UI3 A;  4LNF A;  3A9J B;  1TZ1 A;  4WUR A;  2WU2 B;  3FIL A;  1AN8 A;  1MHX A;  1V9J A;  3WAN A;  2B76 B;  3PO0 A;  1EF1 A;  4OZA A;  2XK5 B;  1E8X A;  5BMI A;  3L13 A;  4PS7 A;  4PS3 A;  2LZ6 A;  4FUL A;  1ZW7 A;  1DOI A;  1GC7 A;  2IZV B;  4WWP A;  3QCA A;  3ONS A;  3ABV B;  3WAL A;  5D6J B;  1B1Z A;  1QOB A;  3RUI B;  2ON8 A;  1JWU D;  1J19 A;  4A9A A;  2K8H A;  3A33 B;  2O6V B;  3ZNZ B;  4ACF A;  1C9F A;  3MJW A;  1ZE3 D;  2KQS A;  5C23 A;  1WYW B;  2KD0 A;  5KHO A;  2QCZ A;  1F0Z A;  4FHJ A;  4WAA A;  3CIR B;  2AX5 A;  1WF9 A;  4P16 A;  3NUH B;  4ZRP A;  2GBK A;  3A4S C;  1J7B A;  5CTR C;  1EWY C;  2JVC A;  4FXC A;  1UZX B;  1KOT A;  2AEH A;  3BZD B;  4GDL B;  3O13 A;  1JML A;  3ZTD A;  3ZDM C;  2KDI A;  1WXA A;  4NNJ B;  2WXG A;  1T0Y A;  2N1W A;  3VQI A;  3VUX A;  1WR6 E;  1GG3 A;  1WZ0 A;  3H7P A;  2ZW0 A;  1E8Z A;  1F77 A;  1V1P A;  3TUO A;  4DHJ D;  3GE3 C;  1T5X D;  2LXC A;  2WU5 B;  3EC8 A;  3URY A;  4NQK E;  3H7S A;  1N61 A;  2BWF A;  1YIW A;  3VTV A;  4WJO A;  2CR5 A;  2A4Z A;  1RAX A;  1UWX A;  4W9J A;  2C7M B;  2BWE S;  4RM8 A;  2WGS A;  4CHK A;  4FJV B;  2WXH A;  4WQO B;  2M19 A;  3L10 B;  4KGR A;  1CQV A;  1ESF A;  4UDU C;  4EZJ A;  1P3Q U;  4K3C A;  2QC8 A;  4CO7 A;  3OLM D;  2D3G A;  2Y3A A;  3N1Z C;  1IBX A;  2WHI A;  3PSE B;  4BOS C;  4NZL B;  4ZDV A;  4MH8 A;  1P0R A;  2O6V D;  3X23 A;  1WX7 A;  4GOC A;  2VRR B;  2W3S A;  5CHV C;  2KWC A;  3P63 A;  4YTP B;  3KYD D;  1IUE A;  3AEG B;  4HKZ E;  1JW9 D;  4XC2 A;  1FMA D;  1XEE A;  1YN5 A;  3ECI A;  1ENF A;  4G3X B;  4F7Z A;  1QQR A;  4C56 C;  1YJ1 A;  2ICI A;  3IAS 1;  2IBI B;  1I4H A;  4LNN A;  1NEN B;  5DPT A;  3AEF B;  2QHO A;  3RYT A;  2KHW B;  2WQY B;  2AQ3 B;  4ANX A;  4EOY A;  1Q0W B;  3RUL A;  4BBN C;  1LM8 B;  3KLS X;  4AS1 A;  1WM2 A;  3S2A A;  3DBH I;  3AXC A;  2N9X A;  2GBM A;  3WAO A;  4AUQ C;  2N9L A;  2LI5 A;  4WIP A;  4BBN F;  2IO3 B;  1TTN A;  5AUK A;  2MBB B;  2JZP A;  4OVV A;  4NAW B;  4LK0 M;  5H92 C;  3N20 C;  2L0T A;  2WXQ A;  4E74 A;  3DBH B;  3I5J C;  4YSY B;  3VRB B;  1NBF C;  2GBJ A;  1V5T A;  2ZVO A;  3T9L A;  3RMK C;  3VFK A;  1R4N I;  1WGK A;  1A5R A;  2RPQ A;  2FAZ A;  2V4I B;  2LXA A;  3RCZ A;  1KF6 B;  3L0W B;  3NJT A;  1YD8 U;  4KKI A;  4ANW A;  3AEC B;  1I4R A;  4BFR A;  1YN3 A;  3ENE A;  4DDI D;  3H9D A;  1MHH E;  2OJR A;  5J17 A;  2V9H A;  2TSS A;  1GJZ A;  2OED A;  1SXT A;  3P1M A;  2UYZ B;  4AWJ A;  2IPK D;  3BWU D;  2KVR A;  3PRE A;  2HDE A;  1PQS A;  3BY4 B;  2JZZ A;  2Z0E B;  4MEM A;  1NDD A;  1IYF A;  4TKN A;  2M0A A;  2HJ8 A;  1STE A;  1E7V A;  1N60 A;  2KK8 A;  4DXG A;  3E9S A;  4I6N B;  3I3T B;  1NYR A;  3JSV B;  4M8M A;  2INN E;  1TKG A;  2ZZP B;  2FCQ A;  2KDM A;  4KSK C;  3DBL I;  3UQB A;  3A1Q A;  3KWL A;  3W9C B;  2JX5 A;  2XNA C;  1XF5 L;  4XDD A;  1UNS A;  2PE6 B;  3Q3J A;  4HKQ A;  5BMH A;  1VZ7 A;  4KDI C;  1S3S G;  1YQB A;  3P4P B;  4HPP A;  5IA7 A;  4BOZ B;  4K1R B;  2KDB A;  2DZK A;  4GGQ A;  3DBL B;  4L2Y A;  4II2 B;  2CS4 A;  3EA6 A;  5E6N A;  1DOY A;  3N9Y C;  1KM7 A;  1WXV A;  5JZE B;  1FCC C;  3L17 A;  5EDS A;  2LJI A;  3KWV A;  4PT5 A;  2AWT A;  2LUM A;  4L1B A;  2BYF A;  4XDC A;  4F1S A;  3HHM A;  4IWO A;  2J58 A;  4FJZ A;  3AE8 B;  4RH6 A;  2J53 A;  2KJR A;  1EUV B;  2MW5 A;  5C2T B;  4MT5 A;  2ZVN A;  1TY2 A;  3DQV A;  5BYS A;  4YXD B;  3DVG Y;  3M63 B;  1WJ6 A;  3PZ7 A;  2W55 A;  2K8B A;  2K6D B;  1CZP A;  4TV3 A;  2KOX A;  1UEL A;  2C7N B;  1WH3 A;  3Q14 C;  4N9F 4;  4ANU A;  3QQ8 B;  4C00 A;  3ZJV A;  4GN1 A;  3R2I A;  2YEP B;  2J7Q B;  4B95 A;  3APF A;  2JY6 A;  3I57 A;  4S17 A;  3VHT C;  2BGF A;  3A9K A;  4B0E A;  4RGT A;  3N1Y C;  1QKZ A;  3NVV A;  1SJE D;  4XYC A;  4ZRK A;  2LHD A;  2FUG 1;  4DHZ E;  3Q3M C;  3DVN V;  4E71 A;  4WH4 A;  2KTR A;  4W9F A;  1WYG A;  2BYT A;  3U52 E;  4RFB A;  1Q1O A;  3KYC D;  3K9P B;  1OEY A;  1I35 A;  3GZN I;  3LB8 C;  4M02 A;  1BT0 A;  3V60 A;  4C7Y A;  1XLP A;  3AV8 A;  1M4V A;  4TUU A;  3U7Z A;  2C9W B;  1Q10 A;  2QIL A;  1DGJ A;  3UGB B;  2ZNV B;  1WMH A;  2IY0 B;  4ZOH C;  1WY8 A;  1BML C;  1HEZ E;  4G50 A;  3ZXR A;  3BYT B;  2M4N A;  3EUB 2;  2KFK B;  4D2K A;  1WJ4 A;  1XO3 A;  2BYE A;  2DAF A;  2A5U A;  4KDL B;  4YT0 B;  5C1Z A;  3QJZ A;  4ICU A;  1GAQ B;  3NVW A;  5D3I B;  3PS6 A;  2L0F A;  2KX0 A;  4MJS B;  4MM3 A;  5I4D A;  3PHX B;  1JWS D;  4Q2J A;  2IDY A;  1WGH A;  2KLG A;  4A3P A;  4W9C A;  2LGS A;  4C80 A;  3R3M A;  3VTW A;  1E7U A;  4JIO U;  1V81 A;  1GB4 A;  4AOF A;  2WXP A;  3HM6 X;  3RT3 B;  2RDG A;  1WRI A;  3W5V B;  1FFV A;  4BKS D;  4GMV A;  5EE3 A;  2D3C A;  4IM3 A;  2WLB A;  3Q3F A;  3V6C B;  2M0X A;  3QHT A;  4B9K A;  2OOB B;  3PRZ A;  1XLN A;  4WQM A;  5CHW A;  5DCN A;  1SGH A;  3FAH A;  1RYJ A;  2KTF A;  3GB1 A;  1DYQ A;  2ACZ B;  3Q69 A;  3BK1 A;  5GMV A;  4KV2 A;  4PK1 A;  2KWU B;  2D2Q A;  4RGM A;  2JU6 X;  2JYT A;  1YNT E;  5JHB A;  1TS4 A;  4WJQ A;  2PLP A;  1WX8 A;  2FNJ B;  3VAW A;  4I6P A;  3WCQ A;  5E6J A;  2W9N A;  4EUT A;  3TEZ A;  4M0W B;  2IO1 B;  2RDB C;  4G11 A;  1OQY A;  4IWP A;  2K9X A;  2D3A A;  3OJ4 B;  3L16 A;  4GDK A;  3NS1 A;  2MWS B;  3ML8 A;  1KJT A;  4LDT D;  1T0R C;  1QZE A;  4NJC A;  1RLF A;  1L4Z B;  3GE8 C;  2PJH A;  3GP7 A;  4JX1 C;  3N3K B;  3Q2A C;  2NTT A;  2PE9 A;  1VR9 A;  3AE4 B;  2DAJ A;  2V1Y A;  2N7J A;  3K9O B;  4E3C A;  4URK A;  2L1A A;  1E5W A;  1GC6 A;  3KVF B;  5DPS A;  1MFW A;  2W82 A;  1VZ8 A;  1L4D B;  1I4Q A;  1V86 A;  1C4P A;  2WXO A;  3JW0 X;  1ET6 A;  3EHV A;  3N30 A;  4FAD A;  3ZNG C;  1LQB A;  3DCG A;  1XD3 B;  2PIA A;  4DWF A;  3AE5 B;  3JVZ X;  3WAP A;  3AMZ A;  1I4X A;  1HXY D;  1GUA B;  1KFY B;  2KWD A;  2JZ3 B;  4KVG B;  3V62 A;  1K52 A;  5L95 C;  2MA9 B;  2G4D B;  1WRD B;  1UWM A;  1Y8R C;  2DLB A;  4B6W A;  4DXA B;  2IGD A;  1NYQ A;  3MHZ A;  3A9K B;  2ZW1 A;  1J7C A;  3H6N A;  2NBW B;  4ZYN A;  4XWW A;  2MSE D;  2WDR B;  4W9G A;  3ETR A;  2BS2 B;  2EMS A;  3E56 A;  4TQ0 A;  1FM0 D;  3I63 C;  4GLS C;  1I4P A;  2K1F A;  2GLS A;  2LMC A;  2O2V A;  1EU3 A;  3NHE B;  2L3Z A;  3N1X C;  3LXF A;  2D11 A;  2E6X A;  2INP E;  4HCN B;  3AED B;  4OVZ A;  4L23 A;  4OVU A;  1V5O A;  2XBB C;  3RZW C;  2D07 B;  3WIM A;  4TQ1 A;  1AW7 A;  4EKU A;  2K3U A;  4MH0 E;  3B9J A;  2V0G A;  3PVL A;  2K22 A;  2JRI B;  3VH3 B;  1TBE A;  2L83 A;  3L54 A;  1YX5 B;  4HK2 A;  2M8S A;  3P42 A;  3VR8 B;  1M94 A;  5HG2 A;  3W1S A;  2MBQ A;  1Z2M A;  1IGC A;  5G5H A;  3HRD D;  1F2R C;  2AL6 A;  1L7Y A;  3ZLZ A;  1SJH D;  2N9E B;  3DHI C;  4P1C C;  4XWT A;  2QSD A;  2BS3 B;  3V05 A;  1WI0 A;  1BUI C;  3GOE A;  3EGR A;  1HZ6 A;  3UIP B;  1PUT A;  3HM3 A;  2CJN A;  1YOV B;  3OJ3 A;  4DHZ B;  4KZ0 A;  2MP2 A;  3BK2 A;  2KO3 A;  1WGR A;  1LFD A;  3ZNI D;  4C4V B;  1L0V B;  1V80 A;  1OQR A;  3IFW B;  3Q8B A;  1YQ3 B;  3AN1 A;  2ZCC A;  3TCA A;  1HA5 A;  4DQO C;  4W9K A;  3V6E B;  2PMV A;  4WJN A;  4MSQ B;  3W1S C;  3U7D A;  2KQ4 X;  1I7H A;  3APC A;  4N6E B;  1J8C A;  1SF0 A;  2J42 A;  1C3T A;  3AB5 A;  1J7A A;  3R2T A;  1JAL A;  3ALB A;  2BF8 B;  1WR1 A;  3AE2 B;  4YWG G;  2NMQ A;  3T8M A;  2MX2 A;  3M95 A;  3IBE A;  2GI9 A;  4GSW A;  3LYY A;  4W9D A;  2G1E A;  5D94 A;  1GOZ A;  4RGN A;  1HE8 A;  4K7S A;  1ZKH A;  2DYO A;  4M01 A;  4A20 A;  4EZK A;  1V97 A;  2WWZ A;  2HE7 A;  2IY1 B;  3BVZ A;  3PLV A;  3NOB A;  5T8I A;  2L00 B;  1E9M A;  2N7D A;  2CKH B;  1D4B A;  2PKO A;  5IAA C;  3QC8 B;  4DK5 A;  1T0S C;  2G9H D;  2YEP F; 
#chains in the Genus database with same CATH homology
 3DWM A;  1VDV A;  3SR6 A;  5C2T B;  4MT5 A;  1GPX A;  3Q8C A;  1UGJ A;  4JPS A;  4JWS C;  4US8 A;  1ZDX A;  2AQ2 B;  4OW0 A;  3J9C A;  1TY2 A;  5BYS A;  4YXD B;  5C3J B;  1JRO A;  2IGH A;  1MPE A;  2R61 A;  3PZ7 A;  2W55 A;  4LTU A;  3CWI A;  1CK1 A;  3RPF C;  1FXA A;  2QIE B;  2PW9 A;  1TY0 A;  1D6E C;  1JQ4 A;  4B0M A;  1CZP A;  1V1O A;  2WXN A;  4ARI A;  3AE6 B;  1A70 A;  4RNA A;  2MEK A;  3PZ8 A;  3ZJV A;  1HZ5 A;  3R2I A;  4JWU C;  4OZB A;  2YEP B;  3AE7 B;  3MP9 A;  3BVM A;  1PYW D;  1PGA A;  1FEH A;  1TZO A;  3VR9 B;  3I57 A;  3HUI A;  4B0E A;  4RGT A;  3ZYY X;  1DOX A;  1XCT L;  2BT6 A;  2M56 B;  1AWD A;  1PGX A;  1QKZ A;  2WS3 B;  3NVV A;  4IKG A;  1SJE D;  3FIL B;  2W8I A;  2LHD A;  4JE3 B;  2JXT A;  3Q8E A;  2IGG A;  2FUG 1;  1FNW A;  1HQR D;  3TEW A;  4YTM B;  2BB5 A;  1TYG B;  4WH4 A;  1D5M C;  1SE3 A;  2WXL A;  1WYG A;  3C8Y A;  3Q8A A;  2BYT A;  3U52 E;  4A90 A;  1YMH E;  2XN9 C;  4RFB A;  3BVG A;  3HVD A;  2Q5W D;  3NZ3 A;  1R7S A;  1K51 A;  3W5U B;  1QLB B;  2H89 B;  2RDH A;  4MM3 B;  3LB8 C;  1MVK A;  1ZP0 B;  2WXM A;  4CQN A;  1FFU A;  1E6E B;  1N5W A;  1VZ6 A;  3I9V 1;  1OQQ A;  1P7F A;  3NVZ A;  2WXK A;  4C7Y A;  1XLP A;  4REZ A;  3AV8 A;  5MPO A;  1M4V A;  3U7Z A;  2I2Y A;  1EM7 A;  5D3D A;  1Q10 A;  5AUI A;  2QIL A;  1DGJ A;  1F2R I;  2K0P A;  2PVO D;  3AEB B;  3OWE B;  4O1N A;  3IT6 B;  3SFD B;  3AEA B;  4MAC A;  2CU3 A;  4ZOH C;  1TS3 A;  3UI3 A;  1BML C;  1HEZ E;  1SIJ A;  4IDI A;  4WUR A;  3NVY A;  3Q8F A;  2WU2 B;  1FNU A;  1UUP A;  3BYT B;  2W54 A;  3EUB 2;  3FIL A;  1AN8 A;  2QEJ C;  1MHX A;  3V3X A;  2V3N A;  4A6Q A;  4D2K A;  1YJJ A;  1XO3 A;  1FXI A;  1I4G A;  4KGT A;  2VZK B;  2LEK A;  4YT0 B;  2B76 B;  2KAJ A;  4A55 A;  1GAQ B;  3NVW A;  5D3I B;  1FO4 A;  3PO0 A;  4OZA A;  5BMI A;  3U4E G;  1LO5 D;  2K5P A;  1XLQ A;  5I4D A;  1ZDV A;  1DOI A;  4XE0 A;  1YN4 A;  1C79 A;  1JWS D;  4Q2J A;  2IDY A;  2LFI A;  1KTK A;  3P4R B;  1YQ4 B;  3ABV B;  4C80 A;  5GXG B;  4LLG M;  1B1Z A;  1QOB A;  2LHE A;  2ON8 A;  1JWU D;  4A9A A;  2EEL A;  1GB4 A;  2WXP A;  1K50 A;  1C9F A;  2LGI A;  1V1P B;  3B2G A;  3AE3 B;  1ZE3 D;  2RDG A;  1WRI A;  3W5V B;  1FFV A;  2W8H A;  1RWS A;  3L4P A;  3TEX A;  3IT4 B;  1OFF A;  1F0Z A;  5EE3 A;  2H88 B;  5BYQ A;  2WLB A;  3CIR B;  2ONQ A;  2AX5 A;  1C77 A;  1TJE A;  4GDK B;  4P16 A;  4H2A A;  3NUH B;  1VJK A;  1XLN A;  4ZRP A;  4WQM A;  2NTS A;  4HRS A;  3SFE B;  1J7B A;  3FAH A;  1EWY C;  1RYJ A;  2N9K A;  1VRA B;  3IXS A;  4FXC A;  1XCQ L;  3GB1 A;  1QOF A;  3P4Q B;  3BZD B;  4GDL B;  1FCL A;  1DYQ A;  3BII D;  2ACZ B;  2WXJ A;  3O13 A;  1N63 A;  3Q69 A;  4NAM A;  5FR3 A;  4WWM A;  2MJD A;  3BK1 A;  2BB6 A;  4N59 A;  1JML A;  4RGO S;  1NEK B;  4RGM A;  3TEY A;  2JU6 X;  2JYT A;  1YNT E;  4C7Z A;  1TS4 A;  1IBX B;  2WXG A;  2PLP A;  3SEB A;  3VQI A;  2ZW0 A;  5HFY A;  1F77 A;  1V1P A;  3TUO A;  4RF1 A;  3WCQ A;  1N5X A;  4RF0 A;  1JWB D;  5E6J A;  3W2D A;  1T5X D;  2Y5P A;  3URY A;  2WU5 B;  1PDX A;  1BXT A;  1QOG A;  4YTN B;  1N61 A;  3TEZ A;  2J52 A;  1L5P A;  1TS2 A;  2DYM A;  3T3O A;  1E0Z A;  1K53 A;  3AE9 B;  2VZK D;  1FNV A;  2K9X A;  2BS4 B;  1EU4 A;  3R8B A;  4ARC A;  1UWX A;  2SAK A;  1SBB B;  3NS1 A;  1C4A A;  1KLG D;  1ZOY B;  1JWA D;  2WXH A;  3FC4 A;  2DBY A;  1IGD A;  4DXF A;  4NJC A;  2GRI A;  2M19 A;  1L4Z B;  3IAM 1;  1ZXI A;  1PGB A;  1SE4 A;  4ZHP A;  2OHF A;  4KGR A;  4EE2 A;  1CQV A;  1FIQ A;  1ESF A;  1ACC A;  3GP7 A;  4JX1 C;  3DWG C;  4UDU C;  1T6B X;  2NTT A;  3ZJT A;  3MC0 B;  1VR9 A;  3AE4 B;  3GS2 A;  2Y3A A;  2PTL A;  2N7J A;  1IBX A;  2JWU A;  2WNM A;  4NZL B;  4MH8 A;  2L32 A;  1D5X C;  1TKY A;  2L1A A;  4J3O D;  3KQ4 A;  2W3S A;  3P63 A;  2RPV A;  2W82 A;  5BYR A;  2WXI A;  1VZ8 A;  4YTP B;  1YJI A;  1L4D B;  1IUE A;  1I4Q A;  2WXO A;  1C4P A;  3AEG B;  4OZC A;  2WDQ B;  3VRA B;  4M0W A;  4HKZ E;  1ET6 A;  1ZPS A;  5G5G A;  1JW9 D;  1FMA D;  1XEE A;  1WXQ A;  1YN5 A;  1GB1 A;  1ENF A;  3BYY B;  1QQR A;  2PIA A;  1C4C A;  4C56 C;  4HEA 1;  5JXV A;  3AE5 B;  2ICI A;  3IAS 1;  2I38 A;  1I4H A;  2CJO A;  3AM9 A;  1NEN B;  1ZXH A;  1TKE A;  3AEF B;  3AMZ A;  5FK9 C;  2WQY B;  1I4X A;  1HXY D;  1KFY B;  1T3Q A;  2AQ3 B;  2KWD A;  1L6V A;  4P6V F;  4KGS A;  1AYF A;  1WSP A;  5HHD G;  1Y56 A;  1K52 A;  1JRP A;  3KLS X;  4AS1 A;  1UWM A;  2DLB A;  1P7E A;  1QF6 A;  2IGD A;  4ZRQ A;  1B9R A;  3T3N A;  2N9L A;  4WIP A;  1NYQ A;  3MHZ A;  5AUK A;  1SEB D;  1J7C A;  1EWC A;  2ZW1 A;  2JZP A;  4XWW A;  1E10 A;  1D5Z C;  2BW2 A;  2WDR B;  3ETR A;  2BS2 B;  1JCK B;  3E56 A;  4TQ0 A;  4ZHO A;  1FM0 D;  2KMM A;  1PFD A;  3NRZ A;  4LK0 M;  4GLS C;  4NAW B;  1I4P A;  3MJ5 A;  5H92 C;  2WXF A;  4N58 A;  4TMA B;  2LMC A;  2WXQ A;  2QMT A;  1EU3 A;  4YSY B;  3VRB B;  2GB1 A;  3LXF A;  2Z8L A;  1RM6 C;  2E6X A;  2INP E;  3AED B;  2FE8 A;  4OVZ A;  1WGK A;  4L23 A;  5EE9 A;  3HVZ A;  2V4I B;  1ROE A;  1SE2 A;  3MFG A;  4TQ1 A;  1AW7 A;  1VLB A;  4TSS A;  1KF6 B;  2K3U A;  4A8X C;  1KLU D;  5TSS A;  4KKJ A;  1N62 A;  3B9J A;  2V0G A;  2K22 A;  1QOA A;  4KKI A;  4US9 A;  2L83 A;  5LNK 1;  1TS5 A;  2KAC A;  4WAF A;  3AEC B;  5EE0 A;  1I4R A;  1YN3 A;  3P42 A;  3VR8 B;  1ET9 A;  1KRH A;  5HG2 A;  3W1S A;  1NVI D;  1MHH E;  4KX6 B;  3TSS A;  1C78 A;  1IGC A;  5G5H A;  3HRD D;  1V8C A;  1F2R C;  2SEB D;  1QIL A;  2TSS A;  2OED A;  1SXT A;  3P1M A;  2D5G A;  1SJH D;  5HI1 A;  1L6U A;  2IPK D;  4XWT A;  3U2S C;  2QSD A;  2BS3 B;  3BWU D;  3V05 A;  3P4S B;  2N0S B;  2HDE A;  1BUI C;  3AH7 A;  3EGR A;  3ZJU A;  2KN4 A;  2W3R A;  1FRR A;  1HZ6 A;  1XXG A;  1ZUD 2;  1PUT A;  2Y5C A;  2CJN A;  3BK2 A;  2J4X A;  2M0A A;  1L0Y B;  1L0V B;  1STE A;  1OQR A;  1N60 A;  2BBC A;  1RFK A;  4DXG A;  3Q8B A;  1YQ3 B;  1QT9 A;  2WDV B;  3E9S A;  2WP9 B;  2JQR B;  1NYR A;  3AN1 A;  2INN E;  1HA5 A;  4DQO C;  2L52 A;  3H8H A;  2PMV A;  1FD6 A;  1TKG A;  2X38 A;  2KQ4 X;  2DWQ A;  2KDM A;  4N6E B;  1SF0 A;  2J42 A;  2WXR A;  3AB5 A;  4ITK A;  2EKI A;  1E7P B;  1J7A A;  3R2T A;  3KWL A;  1CJE A;  1JAL A;  4YWG G;  3W9C B;  3RFZ B;  3AE2 B;  2JX5 A;  2NMQ A;  2XNA C;  1XLO A;  1XF5 L;  4RCO A;  4AQ7 A;  5BMG A;  2IJ0 A;  4XDD A;  1UNS A;  2GI9 A;  3AE1 B;  3LYY A;  2RMM A;  4HKQ A;  4YSZ B;  1C76 A;  2G1E A;  5BMH A;  2E3T A;  4R3D A;  1VZ7 A;  1GOZ A;  2MH7 A;  3P4P B;  2JYE A;  3ZQ4 A;  3ZGZ A;  2JSV X;  5EE1 A;  2V3P A;  1MI0 A;  4RGN A;  2QJL A;  1SSN A;  2DYO A;  4L2Y A;  3EA6 A;  1FRD A;  1DOY A;  3N9Y C;  1V97 A;  2FBW B;  4USA A;  1NI3 A;  1FCC C;  4HJG E;  4OHJ A;  2AQ1 B;  3B2F A;  5H8Y E;  5D7G A;  1KH0 A;  2LJI A;  3BVZ A;  2HTM E;  2MJE A;  3KWV A;  3AEE B;  4IOI E;  5T8I A;  4PT5 A;  5FKA C;  2LUM A;  4L1B A;  2BTE A;  2MJ3 A;  4XDC A;  1E9M A;  2J58 A;  1SB3 C;  1L0X B;  4ZYS A;  2PVG C;  1D4B A;  2PKO A;  1WWT A;  3AE8 B;  4RH6 A;  2J53 A;  1JWM D;  4YSX B;  4HRO A;  1I7H A;  2G9H D;  2YEP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...