The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
322
|
structure length |
322
|
Chain Sequence |
IPGQGLNSLRKNVVELPDSDYDLDKLVNVYPMTPGLIDQLRPEPVIARSNPQLDNLLKSYEYRIGVGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNSDGTIFYPYIGKVQVAGKTVSQVRQDITSRLTTYIESPQVDVSIAAFRSQKVYVTGEVANSGKQAITNIPLTVMDAINAAGGLAADADWRNVVLTHNGKDTKISLYALMQKGDLTQNHLLYHGDILFIPSNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGISQEMSDATGIFVVRQLKGDRTGKIADIYQLNAQDASAMVLGTEFQLQPYDIVYVTTA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Peldor Distance Fingerprinting of the Octameric Outer-Membrane Protein Wza from Escherichia Coli.
pubmed doi rcsb |
molecule tags |
Membrane protein
|
source organism |
Escherichia coli
|
molecule keywords |
PUTATIVE OUTER MEMBRANE LIPOPROTEIN WZA
|
total genus |
80
|
structure length |
322
|
sequence length |
322
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature | |
pdb deposition date | 2009-01-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02563 | Poly_export | Polysaccharide biosynthesis/export protein |
A | PF10531 | SLBB | SLBB domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Outer membrane lipoprotein wza fold like | Outer membrane lipoprotein wza domain like | ||
Alpha Beta | Roll | Outer membrane lipoprotein wza fold like | Outer membrane lipoprotein wza domain like | ||
Alpha Beta | 2-Layer Sandwich | wza like fold | wza like domain |
#chains in the Genus database with same CATH superfamily 2W8I A; 3P42 A; 2W8H A; 2J58 A; #chains in the Genus database with same CATH topology 2W8I A; 3P42 A; 2W8H A; 2J58 A; #chains in the Genus database with same CATH homology 2W8I A; 3P42 A; 2W8H A; 2J58 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...