The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
KAIVVQPKDTVDRVAKILSRNKAGSAVVMEGDEILGVVTERDILDKVVAKGKNPKEVKVEEIMTKNPVKI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of a cystathionine beta-synthase domain protein fused to a Zn-ribbon-like domain
rcsb |
molecule tags |
Nucleotide binding protein, metal binding protein
|
source organism |
Pyrococcus furiosus
|
molecule keywords |
a cystathionine beta-synthase domain protein fused to a Zn-r
|
total genus |
20
|
structure length |
70
|
sequence length |
70
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2009-03-03 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | CBS domain Like | CBS domain Like |
#chains in the Genus database with same CATH superfamily 3GHD A; 3JTF A; 2J9L A; 3LFR A; 3OI8 A; 1VR9 A; 2JA3 A; 3NQR A; #chains in the Genus database with same CATH topology 3GHD A; 1XJH A; 3JTF A; 2J9L A; 1VZY A; 3LFR A; 3OI8 A; 1VQ0 A; 1VR9 A; 2JA3 A; 3NQR A; #chains in the Genus database with same CATH homology 3GHD A; 3JTF A; 2J9L A; 3LFR A; 3OI8 A; 1VR9 A; 2JA3 A; 3NQR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...