3OI8A

The crystal structure of functionally unknown conserved protein domain from neisseria meningitidis mc58
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
SNASAEDVLNLLRQAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKDEVLGILHAKDLLKYMFNPEQFHLKSILRPAVFVPEGKSLTALLKEFREQRNHMAIVIDEYGGTSGLVTFEDIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of functionally unknown conserved protein domain from Neisseria meningitidis MC58
rcsb
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Neisseria meningitidis serogroup b
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3oi8A01
3.90.1280.20 Alpha Beta Alpha-Beta Complex CBS domain Like CBS domain Like 3oi8A02
3HF7A 2D4ZA 3OI8A 4ESYB 3PC3A 5MMZA 4PCUA 3KH5A 5KS7A 2EF7A 1PBJA 4P1OA 4IY2A 2RIHA 2YVXA 5LXQA 3KPBA 3ORGA 4NOCA 5K23C 2UV4A 2QRDE 3PC2A 4GQYA 2NYCA 3FV6A 3K6EA 3DDJA 3PC4A 2QRCE 2YZQA 2ZY9A 3L31A 3FNAA 3KPCA 4L28A 1PVMA 3TDHC 4GQWA 3OCOA 4HG0A 4DQWA 2JA3A 1Y5HA 4L3VA 4FRYA 2RC3A 3OCMA 2OOXE 2YVYA 3LFZA 4GQVA 4L27A 3K2VA 4FXSA 4IY3A 3LQNA 3TE5C 1VR9A 2UV5A 2QH1A 2YZIA 1O50A 5K22B 4UUUA 4COOA 3LV9A 4IYSA 2J9LA 3GHDA 3LHHA 3GBYA 3I8NA 1XKFA 5K24C 2NYEA 2P9MA 2QREE 2RIFA 2UV6A 3FHMA 1YAVA 3KXRA 3KPDA 2QLVC 2UV7A 5IIPA 2OUXA 3NQRA 4L0DA 4IY4A 3FWRA 4P1GA 3T4NC 4IY0A 2QR1E 3L2BA 3FWSA 3SL7A 2EMQA 2OOYE 2PFIA 4O9KA 3JTFA 3LFRA 2O16A 2YVZA 5K25C 4ESYA
chains in the Genus database with same CATH superfamily
3HF7A 2D4ZA 3OI8A 1VQ0A 4ESYB 3PC3A 5MMZA 4PCUA 3KH5A 5KS7A 2EF7A 1PBJA 4P1OA 4IY2A 2RIHA 2YVXA 5LXQA 3KPBA 3ORGA 4NOCA 5K23C 2UV4A 2QRDE 3PC2A 4GQYA 2NYCA 3FV6A 3K6EA 3DDJA 3PC4A 2QRCE 2YZQA 2ZY9A 3L31A 3FNAA 3KPCA 4L28A 1PVMA 3TDHC 4GQWA 3OCOA 4HG0A 4DQWA 2JA3A 1Y5HA 4L3VA 4FRYA 2RC3A 3OCMA 2OOXE 2YVYA 3LFZA 4GQVA 4L27A 3K2VA 4FXSA 4IY3A 3LQNA 3TE5C 1VR9A 2UV5A 2QH1A 2YZIA 1O50A 5K22B 4UUUA 4COOA 3LV9A 4IYSA 2J9LA 3GHDA 3LHHA 3GBYA 3I8NA 1XKFA 5K24C 2NYEA 2P9MA 2QREE 2RIFA 2UV6A 3FHMA 1YAVA 3KXRA 3KPDA 2QLVC 2UV7A 5IIPA 2OUXA 3NQRA 4L0DA 1XJHA 4IY4A 3FWRA 4P1GA 3T4NC 4IY0A 2QR1E 3L2BA 3FWSA 3SL7A 1VZYA 2EMQA 2OOYE 2PFIA 4O9KA 3JTFA 3LFRA 2O16A 2YVZA 5K25C 4ESYA
chains in the Genus database with same CATH topology
3HF7A 2D4ZA 3OI8A 4ESYB 3PC3A 5MMZA 4PCUA 3KH5A 5KS7A 2EF7A 1PBJA 4P1OA 4IY2A 2RIHA 2YVXA 5LXQA 3KPBA 3ORGA 4NOCA 5K23C 2UV4A 2QRDE 3PC2A 4GQYA 2NYCA 3FV6A 3K6EA 3DDJA 3PC4A 2QRCE 2YZQA 2ZY9A 3L31A 3FNAA 3KPCA 4L28A 1PVMA 3TDHC 4GQWA 3OCOA 4HG0A 4DQWA 2JA3A 1Y5HA 4L3VA 4FRYA 2RC3A 3OCMA 2OOXE 2YVYA 3LFZA 4GQVA 4L27A 3K2VA 4FXSA 4IY3A 3LQNA 3TE5C 1VR9A 2UV5A 2QH1A 2YZIA 1O50A 5K22B 4UUUA 4COOA 3LV9A 4IYSA 2J9LA 3GHDA 3LHHA 3GBYA 3I8NA 1XKFA 5K24C 2NYEA 2P9MA 2QREE 2RIFA 2UV6A 3FHMA 1YAVA 3KXRA 3KPDA 2QLVC 2UV7A 5IIPA 2OUXA 3NQRA 4L0DA 4IY4A 3FWRA 4P1GA 3T4NC 4IY0A 2QR1E 3L2BA 3FWSA 3SL7A 2EMQA 2OOYE 2PFIA 4O9KA 3JTFA 3LFRA 2O16A 2YVZA 5K25C 4ESYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HF7 A;  2D4Z A;  3OI8 A;  4ESY B;  3PC3 A;  5MMZ A;  4PCU A;  3KH5 A;  5KS7 A;  2EF7 A;  1PBJ A;  4P1O A;  4IY2 A;  2RIH A;  2YVX A;  5LXQ A;  3KPB A;  3ORG A;  4NOC A;  5K23 C;  2UV4 A;  2QRD E;  3PC2 A;  4GQY A;  2NYC A;  3FV6 A;  3K6E A;  3DDJ A;  3PC4 A;  2QRC E;  2YZQ A;  2ZY9 A;  3L31 A;  3FNA A;  3KPC A;  4L28 A;  1PVM A;  3TDH C;  4GQW A;  3OCO A;  4HG0 A;  4DQW A;  2JA3 A;  1Y5H A;  4L3V A;  4FRY A;  2RC3 A;  3OCM A;  2OOX E;  2YVY A;  3LFZ A;  4GQV A;  4L27 A;  3K2V A;  4FXS A;  4IY3 A;  3LQN A;  3TE5 C;  1VR9 A;  2UV5 A;  2QH1 A;  2YZI A;  1O50 A;  5K22 B;  4UUU A;  4COO A;  3LV9 A;  4IYS A;  2J9L A;  3GHD A;  3LHH A;  3GBY A;  3I8N A;  1XKF A;  5K24 C;  2NYE A;  2P9M A;  2QRE E;  2RIF A;  2UV6 A;  3FHM A;  1YAV A;  3KXR A;  3KPD A;  2QLV C;  2UV7 A;  5IIP A;  2OUX A;  3NQR A;  4L0D A;  4IY4 A;  3FWR A;  4P1G A;  3T4N C;  4IY0 A;  2QR1 E;  3L2B A;  3FWS A;  3SL7 A;  2EMQ A;  2OOY E;  2PFI A;  4O9K A;  3JTF A;  3LFR A;  2O16 A;  2YVZ A;  5K25 C;  4ESY A; 
#chains in the Genus database with same CATH topology
 3HF7 A;  2D4Z A;  3OI8 A;  1VQ0 A;  4ESY B;  3PC3 A;  5MMZ A;  4PCU A;  3KH5 A;  5KS7 A;  2EF7 A;  1PBJ A;  4P1O A;  4IY2 A;  2RIH A;  2YVX A;  5LXQ A;  3KPB A;  3ORG A;  4NOC A;  5K23 C;  2UV4 A;  2QRD E;  3PC2 A;  4GQY A;  2NYC A;  3FV6 A;  3K6E A;  3DDJ A;  3PC4 A;  2QRC E;  2YZQ A;  2ZY9 A;  3L31 A;  3FNA A;  3KPC A;  4L28 A;  1PVM A;  3TDH C;  4GQW A;  3OCO A;  4HG0 A;  4DQW A;  2JA3 A;  1Y5H A;  4L3V A;  4FRY A;  2RC3 A;  3OCM A;  2OOX E;  2YVY A;  3LFZ A;  4GQV A;  4L27 A;  3K2V A;  4FXS A;  4IY3 A;  3LQN A;  3TE5 C;  1VR9 A;  2UV5 A;  2QH1 A;  2YZI A;  1O50 A;  5K22 B;  4UUU A;  4COO A;  3LV9 A;  4IYS A;  2J9L A;  3GHD A;  3LHH A;  3GBY A;  3I8N A;  1XKF A;  5K24 C;  2NYE A;  2P9M A;  2QRE E;  2RIF A;  2UV6 A;  3FHM A;  1YAV A;  3KXR A;  3KPD A;  2QLV C;  2UV7 A;  5IIP A;  2OUX A;  3NQR A;  4L0D A;  1XJH A;  4IY4 A;  3FWR A;  4P1G A;  3T4N C;  4IY0 A;  2QR1 E;  3L2B A;  3FWS A;  3SL7 A;  1VZY A;  2EMQ A;  2OOY E;  2PFI A;  4O9K A;  3JTF A;  3LFR A;  2O16 A;  2YVZ A;  5K25 C;  4ESY A; 
#chains in the Genus database with same CATH homology
 3HF7 A;  2D4Z A;  3OI8 A;  4ESY B;  3PC3 A;  5MMZ A;  4PCU A;  3KH5 A;  5KS7 A;  2EF7 A;  1PBJ A;  4P1O A;  4IY2 A;  2RIH A;  2YVX A;  5LXQ A;  3KPB A;  3ORG A;  4NOC A;  5K23 C;  2UV4 A;  2QRD E;  3PC2 A;  4GQY A;  2NYC A;  3FV6 A;  3K6E A;  3DDJ A;  3PC4 A;  2QRC E;  2YZQ A;  2ZY9 A;  3L31 A;  3FNA A;  3KPC A;  4L28 A;  1PVM A;  3TDH C;  4GQW A;  3OCO A;  4HG0 A;  4DQW A;  2JA3 A;  1Y5H A;  4L3V A;  4FRY A;  2RC3 A;  3OCM A;  2OOX E;  2YVY A;  3LFZ A;  4GQV A;  4L27 A;  3K2V A;  4FXS A;  4IY3 A;  3LQN A;  3TE5 C;  1VR9 A;  2UV5 A;  2QH1 A;  2YZI A;  1O50 A;  5K22 B;  4UUU A;  4COO A;  3LV9 A;  4IYS A;  2J9L A;  3GHD A;  3LHH A;  3GBY A;  3I8N A;  1XKF A;  5K24 C;  2NYE A;  2P9M A;  2QRE E;  2RIF A;  2UV6 A;  3FHM A;  1YAV A;  3KXR A;  3KPD A;  2QLV C;  2UV7 A;  5IIP A;  2OUX A;  3NQR A;  4L0D A;  4IY4 A;  3FWR A;  4P1G A;  3T4N C;  4IY0 A;  2QR1 E;  3L2B A;  3FWS A;  3SL7 A;  2EMQ A;  2OOY E;  2PFI A;  4O9K A;  3JTF A;  3LFR A;  2O16 A;  2YVZ A;  5K25 C;  4ESY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...