The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
93
|
sequence length |
392
|
structure length |
379
|
Chain Sequence |
IDPFNIIREFRSAAGQLALDLANSGDESNVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIWIVMVWLKENTYVMERPPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIFFKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKHSLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIENYLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIHSSVEMLLDVVDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLLKLQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular architecture of the Nup84-Nup145C-Sec13 edge element in the nuclear pore complex lattice.
pubmed doi rcsb |
| molecule keywords |
Fusion Protein of Protein Transport Protein SEC13 and Nucleo
|
| molecule tags |
Transport protein, structural protein
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
93
|
| structure length |
379
|
| sequence length |
392
|
| ec nomenclature | |
| pdb deposition date | 2009-09-08 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Hyaluronidase domain-like | Hyaluronidase domain-like |
#chains in the Genus database with same CATH superfamily 3JRO C; 3IKO C; #chains in the Genus database with same CATH topology 4P3E C; 2GNX A; 4P3G A; 2IJQ A; 3JRO C; 4P3F A; 3IKO C; 5M73 C; #chains in the Genus database with same CATH homology 4P3E C; 2GNX A; 4P3G A; 4P3F A; 3JRO C; 3IKO C; 5M73 C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...