The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
123
|
structure length |
123
|
Chain Sequence |
LQVRDIMVPRSQMISIKATQTPREFLPAVIDAAHSRYPVIGESHDDVLGVLLAKDLLPLILKADGDSDDVKKLLRPATFVPESKRLNVLLREFRANHNHMAIVIDEYGGVAGLVTIEDVLEQI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The Crystal Structure of a CBS Domain from a Putative Metal Ion Transporter Bound to AMP from Pseudomonas syringae to 1.55A
rcsb |
molecule tags |
Transport protein
|
source organism |
Pseudomonas syringae
|
molecule keywords |
putative Metal ion transporter
|
total genus |
30
|
structure length |
123
|
sequence length |
123
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-01-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00571 | CBS | CBS domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | CBS domain Like | CBS domain Like | ||
Alpha Beta | Alpha-Beta Complex | CBS domain Like | CBS domain Like |
#chains in the Genus database with same CATH superfamily 3JTF A; 2J9L A; 3GHD A; 3LFR A; 3NQR A; 2JA3 A; 1VR9 A; 3OI8 A; #chains in the Genus database with same CATH topology 3JTF A; 2J9L A; 1VQ0 A; 3GHD A; 1XJH A; 3LFR A; 3NQR A; 1VZY A; 2JA3 A; 1VR9 A; 3OI8 A; #chains in the Genus database with same CATH homology 3JTF A; 2J9L A; 3GHD A; 3LFR A; 3NQR A; 2JA3 A; 1VR9 A; 3OI8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...