The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
GSFTVKKVLNNNVLIASHHKYSEVVLIGKGIGFGKKQDDVIEDKGYDKMFILKDEKEQKQFKKLLDYVDEKLVDISNDVIYHISNRTNHSLNEHIHIALTDHIAFAIKRQQQGFDMKNPFLMETQSLYPEEYQIAKEVIDMINEKAGLCLPEGEIGFIALHIHSALTN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription
|
| molecule keywords |
PtsGHI operon antiterminator
|
| publication title |
Structure of the RBD-PRDI fragment of the antiterminator protein GlcT.
pubmed doi rcsb |
| source organism |
Bacillus subtilis
|
| total genus |
60
|
| structure length |
168
|
| sequence length |
168
|
| ec nomenclature | |
| pdb deposition date | 2011-04-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00874 | PRD | PRD domain |
| A | PF03123 | CAT_RBD | CAT RNA binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | PTS-regulatory domain, PRD | PRD domain | ||
| Mainly Beta | Roll | Transcription Regulation, Sacy; Chain A | CAT RNA-binding domain |
#chains in the Genus database with same CATH superfamily 1L1C A; 3RIO A; 1TLV A; 1AUU A; 1H99 A; 3NUF A; #chains in the Genus database with same CATH topology 3SQN A; 1L1C A; 3RIO A; 1TLV A; 1AUU A; 1H99 A; 3NUF A; #chains in the Genus database with same CATH homology 1L1C A; 3RIO A; 1TLV A; 1AUU A; 1H99 A; 3NUF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
