4E29A

Periplasmic domain of the chimeric wzzb chain length regulator protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
233
Chain Sequence
KWTSTAIITQPDVGQIAGYNNAMNVIYGQAAPKVSDLQETLIGRFSSAFSALAETLDNQEEPEKLTIEPSVKPLTVSYVGQTAEGAQMKLAQYIQQVDDKVNQELERDLKDNIALGRKNLQDSLRTQEVVAQEQKDLRIRQIEEALRYADEAKITQPQIQQTQDVTQDTMFLLGSDALKSMIQNEATRPLAFSPAYYQTKQTLLDIKNLKVTADTVHVYRYVMKPTLPVRRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
source organism Shigella flexneri
publication title Structural Characterization of Closely Related O-antigen Lipopolysaccharide (LPS) Chain Length Regulators.
pubmed doi rcsb
molecule keywords Chimeric WzzB chain length determinant protein
total genus 75
structure length 233
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 4e29A00
4E2HA 4ZM5A 4E2CA 4ZM1A 4E29A 3B8PA 3B8NA 4E2LA 3B8MA 3B8OA
chains in the Genus database with same CATH superfamily
4E2HA 4ZM5A 4E2CA 4ZM1A 4E29A 3B8PA 3B8NA 4E2LA 3B8MA 3B8OA
chains in the Genus database with same CATH topology
4E2HA 4ZM5A 4E2CA 4ZM1A 4E29A 3B8PA 3B8NA 4E2LA 3B8MA 3B8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2H A;  4ZM5 A;  4E2C A;  4ZM1 A;  4E29 A;  3B8P A;  3B8N A;  4E2L A;  3B8M A;  3B8O A; 
#chains in the Genus database with same CATH topology
 4E2H A;  4ZM5 A;  4E2C A;  4ZM1 A;  4E29 A;  3B8P A;  3B8N A;  4E2L A;  3B8M A;  3B8O A; 
#chains in the Genus database with same CATH homology
 4E2H A;  4ZM5 A;  4E2C A;  4ZM1 A;  4E29 A;  3B8P A;  3B8N A;  4E2L A;  3B8M A;  3B8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...