3B8MA

Structure of fepe- bacterial polysaccharide co-polymerase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
255
Chain Sequence
b'KWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric enterobactin (Enterochelin) transport
publication title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 88
structure length 255
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b8mA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 3b8mA01
1ENVA 3CP1A 2MK3A 5CN0A 4JGSA 2P6JA 2X7RB 1Y4MA 4E29A 1I5XA 1I5YA 1DLBA 2EZOA 3B77A 1SZTA 4JPRA 4N21A 4E2LA 4E2CA 3H01A 4FJCC 3B8PA 5KA5A 3M99B 1QCEA 2OT5A 1Y66A 1F23A 3B8OA 4ZM5A 4E2HA 3MHSC 4ZM1A 5H9CA 3B8MA 1JPXA 3WFVA 3P30A 1EBOA 5HFMA 4JF3A 3MHHC 3K9AA 1DF5A 1QR8A 1MG1A 3CYOA 3B8NA 2M7WA 4FIPC 1MOFA 2EZPA 2LP7A 1QBZA 1DF4A 1K34A 4FK5C 1JQ0A 2EBOA 5HFLA 4G2KA 5KA6A 1K33A 4N23A 3GWOA 1QR9A 5CMUA
chains in the Genus database with same CATH superfamily
1CP9A 3EXAA 4DR6O 4H37A 4E2CA 5KX5A 1Y66A 1XHXA 4OXSA 1SQGA 1F4MA 5IE9A 3SJBC 5LHHA 1N8RW 4DV5B 4O4LB 4MS2A 4LF6O 3AG2C 3H1IH 3ETEA 1M5IA 4O2AA 1GK9A 2EIJB 1RM1B 4JYAB 3E8FA 1M56C 1PNLA 4MSWC 2ZR3A 3SJCC 2WPDG 4KL1A 1S5LZ 5CA1A 3OMIB 1RP3B 2CE4A 2BOCC 1DF4A 3MD0A 5KAIZ 2YUAA 1JFFA 3K06A 2ZKOA 4G2KA 5B66Z 4JTCB 4CH6A 1Y67A 5C93A 4OX9B 2DMXA 3AG4B 1AR4A 3ZS8C 2A7WA 4G27B 4PA9A 1RPRA 4TV9B 1XNQO 2XASA 1VF6C 4FM1A 3ABTA 3JASB 3ZRWA 3SYOA 2CH7B 2YEVB 3CXCU 1YI2V 4DUYO 5FNVA 3E22B 3G4SV 4BIOA 1NR7A 4LNUB 3RVZA 2QE7G 1IBKB 1SA0B 2M6YA 4F6EA 4JI3O 3ZHSA 3CYOA 3N2GB 4B7KA 3AG1B 2JRIA 1VQ5V 4B3MB 4DV6O 1SESA 2D3OW 2UUCO 1QLEB 2EILC 4GX1A 3OEEG 4TV8B 2H94A 2F43G 1MZEA 2ZT9B 4DUZB 1K5SA 4LBEC 4PELA 3I55V 4P2ZA 4YY3O 4WFFA 4F6RA 3ZHQA 5CBFA 5EC2C 3JD2A 4L8JA 2R9AA 2PI4A 1BSMA 2KSDA 1KC8W 1YDXA 1FD9A 2IW5A 2AHZA 4JI1O 5K1XA 3KCYA 1IX9A 1IBLB 1B06A 3CCMV 4I50B 4JI8O 1F4NA 1AJNA 1JVMA 3IAYA 3RYIB 2HFEC 4OPHA 4NTWA 1BMFG 3JAKA 4QPJA 2CDYA 3ZMZA 3RYCB 5IT9N 1A32A 3UT5A 2WLKA 3IC7A 4WF9V 3BFRA 1PV0A 4FK5C 3FFQA 1UPGA 5LYJB 1NVPB 4E4EA 3RYFA 3ICXA 2P7TC 2WLIA 3L74H 4FLTA 3VQXA 4QJFB 3SJAC 1M1KW 4GKJO 4MTGA 2QA4V 5KUMA 2V4DA 1QR8A 3FYEB 3VOUA 2DW4A 3ZMTA 2HJFC 2QSAA 4UUJC 3APQA 2F4VO 2JEUA 1FAFA 3R65A 3A2FA 3LDCA 2JK5C 4KXRA 4DRXA 5EZYA 3K0DA 1OCOC 4QPKA 1XQ8A 4P9PA 1YTFD 2UXNA 4BIUA 3M99B 1ZX3A 1XILA 2HG5C 3ETQA 2NNUA 3QO7A 3KG2A 4O2BA 2JVDA 2ATKC 3JARA 3G67A 5IJ9B 1ZTEA 5LMNB 2RQ6A 4OGQB 1WA8A 2ADQB 4CS2A 1K5QA 5LA6A 1GN2A 1YHQV 4AQYB 1NS1A 4K3AA 1WB8A 1I94O 1MZFA 1J5EB 2XAFA 5CA0A 5K1PA 2ITDC 1GTOA 4Z2WA 4IGGA 2UUBO 1FJGO 1AR5A 2DWDC 2QTOA 2QM7A 4U3JB 1HNXO 1KU9A 2WLMA 3OTOO 2A3QA 5H6QA 3AG2B 2RCVA 4WFHA 1SZXA 4XDKA 1M56B 3HKBA 3S3WA 1BS3A 3K59A 2OCCC 1G6UA 3SJQC 3WB1A 1YXBA 2F66C 4I5SA 2GSMB 2DWEC 1MMMA 3TETA 1QR9A 3CRCA 2E76B 3H9VA 1VQLV 4J7KA 3IFXA 4I4TB 2Y4TA 4NTYA 1GM7A 4MVMA 5J2UA 4FLXA 2E75B 4DR3B 3QF7A 3K9SA 1CPYA 2FMLA 1PP9H 1G8MA 3OD4A 3GB7C 4DR2B 2ETNA 4EB6B 1L8DA 4JI0O 4B3RO 1AVMA 3T1YO 4DK0A 4YJ3A 4MW8A 4NXMB 1Y76A 4KHPB 3T1HO 1G1XB 4NXNB 4GUNA 3B8MA 1M57C 2HVKC 4TQDA 2LP7A 4PJ0Z 2F1MA 5FPRA 4DV0O 4DV2O 1KYOF 4RUEA 2YI8A 3RYHA 4DV7B 1PNKA 1FXKC 2HEPA 2RJZA 2FYUH 4N21A 4QIWF 2ITCC 3CJHA 2OT5A 3AG7A 3G71V 3BEHA 1WJZA 2BTQA 1VQ4V 2EILB 2VRZA 2GUZB 1JA8A 5IYDO 1QBZA 1GN3A 5J2TA 5IY5C 3ZCCA 4DYLA 1VP7A 1JR9A 1SF9A 5A9GA 1NVPD 4DR4B 5EBLC 5EBWC 4X1KB 3G6BA 4BW9A 4EFEA 4UVBA 1WP7A 5GONA 4BR6A 4HZ3A 1ZSPA 3K03A 5DN6G 3ZJZA 2Q7EA 2WLNA 4LF9O 1B3QA 4EFBA 4DV1B 3QTCA 3L73H 2Y4UA 2IJJA 4C7UA 2EBOA 4Q20A 4GYCB 5TISZ 3W7UA 1V55C 2KB1A 1IBMO 4MTOA 3PN1A 4UVCA 3FAVB 4ZIBA 3ZRVA 1L1FA 4J7JA 2UU9B 1AJQA 3UO3A 1WB7A 2PGGA 1P49A 2K9PA 2C2AA 2ZM6B 4JI4B 1E1RG 1GN4A 3BCCH 4DR5O 4B3SO 5BMVA 1YITV 3L71H 1YJNV 5CBHA 3W7TA 2UXDO 1HR0O 5GW7A 1N33O 3H1KH 2DOSA 2P06A 4YJ2A 1W59A 4J10A 4NTXA 5LP6A 2L35A 3SYAA 1JQ0A 2YDEA 3N2KB 4DV3B 1S5JA 4PA7A 4LP8A 1NTZH 2OIEA 2FTKA 1EN4A 1M4UA 1QQCA 1XOUA 2JGDB 5IYBO 5JCOA 4XBFA 1SZTA 3A0BZ 4E2LA 4YHHB 3G6EV 5FPOA 3RWRD 4NVPA 1N34O 2BSKA 2Q67A 4GX2A 5JH7B 1OCOB 2PTMA 1XNRO 4CBCA 2ZXWC 3HKEA 3EFFK 5ITZA 3DTUB 1YJ9V 4DR6B 2WSSG 2V1DA 3OR7C 1HNWO 2YXHA 1AJPA 3QG5A 1IXBA 4JI2O 1O9GA 2ZDIC 4LF6B 4O4IA 4I55B 5EBMC 3LDDA 1EN6A 1K92A 4LFBO 4MVUA 3RN4A 5EC1C 3EVKA 4WBNA 3ETGA 5KA6A 3WB2A 1Z5VA 3STLC 2DE0X 3STZC 1WAZA 5B1OA 5B1AC 5CBGA 1AI7A 3CCRV 3B8OA 2X6BA 3K57A 3BRCA 5E1AC 1Q6UA 3OAAG 1ORQC 1XBLA 4GKKO 2OCCB 2DQ3A 4MVQA 5L3BA 4X20A 4WFEA 3THOA 1XNQB 1IDSA 1KP3A 4OPAA 4U3FH 4JI7O 3FB7C 3J80N 4KUMA 2CTQA 3BPZA 5H6RA 4IYHA 3OE7G 3SGIA 1KKCA 5D5PA 4YIOA 2VQEO 5JQGA 1XHZA 4DUYB 4TQFA 2PY5A 1TVKB 3ZMSA 4P9OA 2LO1A 1Q90D 5BZBA 2VWKA 4ZOLB 4FLYA 4JI3B 1R3KC 3M7MX 4IIJA 5L3DA 4TT3G 2GTSA 2UXCO 1LUWA 1JPXA 1NZ6A 4DV6B 3K58A 5KX5B 2NLJC 1XMQO 1K34A 1NH2B 2UUCB 1QNMA 1M57B 3DC6A 2P90A 1Y74B 3JCZA 3ABMC 1I08A 4J9ZB 2PI5A 4DXWA 1VQOV 3ZMVA 4O2AB 3HPLC 1FXKB 5B1NA 3NR7A 1Q86W 3K04A 4YY3B 3AK1A 5BR8B 2YI9A 3F5TA 1GKFA 4JYYA 2OTLV 3JYCA 2CGOA 3IJ4A 2IJIA 1R73A 4LF5B 4TWKA 3HKDA 3SYCA 5IY5B 1VQMV 1JFFB 4K35A 4LWSA 2LW7A 3B8PA 2YXLA 3E89A 2QKAA 2RDCA 2W0XA 1JJ2U 4PD4F 4IL6Z 3Q4HB 2YIBD 4CC6A 4LFAB 1AI6A 1FFXA 3HR0A 1TUEB 1GM9A 2UUAB 1YVWA 1Q3EA 1OCZC 2Q7HA 1I5YA 2YXYA 2LJ2A 3OR6C 3ZRWB 1US6A 2RMKB 3CSXA 1V55B 2DN9A 1IVSA 2P4VA 5FNVB 2YEVA 4X1YB 5H5NA 3CRAA 3GWKC 3E22A 3W7XA 1J95A 4LNUA 3JCUZ 3CC2V 3B4SA 1SA0A 1Q43A 4UCUA 1S3JA 4CS4A 1VF7A 5J9PC 2F4VB 1K3EA 1XEQA 2B5UA 5LHIA 2WLHA 1BZKA 3EHBB 4FLWA 4I0XA 1Q82W 2W0FC 1X4TA 2AHYA 4LC1A 3RFRA 1BQ0A 3ZRSA 1R6NA 1R3JC 3CMAV 2R72A 3AK3A 3WB0A 1XUQA 1GMGA 2R70A 1BT8A 1JX9A 4DW0A 1OHHG 2ADPA 4DK1A 4EEQA 4FLUA 1WLEA 2Q6AA 4U7OA 3P3NA 1NI8A 2ZXWB 5A2QN 2Y0PA 2WA4A 4PA6A 5CN0A 4GZRB 4H13B 1PM9A 3O65A 2Q7GA 1WN7A 3TCUA 4D6TH 2EJRA 1RFYA 3MDSA 3OUSA 4HNAA 1HNXB 3AEIA 3OTOB 3F7VC 3HKCA 2ZQMA 3X2QC 5HFLA 2WAMA 3JATB 3UT5B 4JYCA 3C90A 1K4CC 2QWNB 4ZI7A 2QEXV 4CH3A 3F5WC 4FVMA 3ZHVA 4JPRA 3D3IA 2OIGA 3LUTB 3FB8C 1M9NA 4ABMA 2BE3A 5LYJA 5B1AB 1NJIW 1LUVA 4JTAB 5LP6C 5L3GA 1NH2D 2FKXA 1YF2A 3CB2A 4FLVA 4PV1B 1IBKO 2X6AA 4HBNA 3L72H 1GRJA 4GX5A 4Z1VA 2MK3A 3CHXA 4B3TO 3JALA 4ZBMA 5JCOC 3H1HH 3CCLV 4HYOA 3DXRB 4WCEV 1SQQH 1Q6HA 4ZM1A 4JI0B 1N0JA 5EZYB 1WPBA 4X65O 4B3RB 3SYQA 4JASA 1YJWV 3CCJV 4NKGB 2P4KA 1G4YB 3SPGA 3OFNG 4O2BB 3OT7A 2ZNIA 3CS5A 4DV0B 4MW3A 4DV2B 1WA8B 3UM7A 5CA3A 1KMIZ 2IJKA 4AILC 1KB9F 3TJTA 3L70H 3ZBHA 3B8NA 2EINC 3BA9A 1R6KA 3K08A 3A8TA 4J11A 3ZHUA 5BY1A 5CA0B 2ZE6A 1IBLO 5IYZA 5IWAO 2ZCEA 3L75H 3H01A 5KAFZ 1EN5A 2ZE7A 1QCEA 3ABMB 3LSUA 1FFTB 4MTFA 3SPHA 1VMGA 3JAWB 2ZR2A 3QVNA 3HKBB 3S3XA 2QWQB 4BIZA 1ZWIC 5CMUA 4LF9B 4LF7O 2V7QG 4X62O 1K73W 2XOKG 3FB6C 1RSOA 4LF4B 4LR3A 1EBOA 4CH5A 4JAAA 3HB3B 1IBMB 1CXZB 3ASOC 3BAAA 4LH6A 4UCVA 5J2UB 4DW1A 2OWOA 3D3QA 4HAMA 1Z5WA 2QWRB 2P6JA 1W0JG 2XAJA 1VQNV 4FFKA 2AW9A 4PDMA 4B08A 2DYRC 3WG7C 4LF8O 2HVJC 4UCOA 4UFZA 1OCZB 2JJ2G 5L3EA 3CCVV 5EYPB 4X66O 3J81N 3E8HA 2L6LA 1ZL8B 2QM8A 3GVMA 3VQVA 1HR0B 2UXDB 2ZD9A 5H2FZ 5LOVA 1S72V 4K0KO 1N33B 2JS3A 1QU7A 1XMOB 1YIJV 1H2GA 5KMGB 3E2EA 4UB8Z 2CGNA 3RYHB 1N32B 1AI4A 1TA8A 4O4JA 2IBZH 4LCUC 2EIJC 2GV9A 4X1IB 4CC5A 3RGBA 3UKMA 1WNSA 3OM3B 1KQSU 1MOFA 1ROPA 4D7TA 2BTQB 3FD9A 1J5EO 4JAVA 1AB3A 1OJHA 3B09A 2EX3A 2ZIMA 2Q0AA 3H1LH 1XNRB 4JI5O 3D36A 3O9OA 2ODMA 1HW7A 4RWUA 3JSLA 1HNWB 5L3CA 2AGAA 2WA3A 2O57A 4RQEA 2YICA 4JI2B 1PL4A 3CCUV 4EKWA 1FXVA 4IT5A 3E86A 1I7FA 4ZKIA 4G28B 3F7YC 3SPCA 3H1JH 2PF4E 5JVDA 2HHHO 1M90W 4I9WA 4Q6GA 3C3SA 4PDLA 1N36O 5EIBC 1Q8IA 3ZHRA 1ZUQA 5BXZA 2GTAA 1WP8A 2UXBO 3UQ8A 4UV9A 4JZ2A 2WLLB 4K8ZA 1L0NH 3GWOA 1TUBA 4IHJB 3ABKC 1YSCA 3X2QB 1GN6A 4TSFG 5LMUO 2X0LA 4GKKB 5JJNB 3ZHTA 4DV4B 5C8YA 5KHGA 1V54C 3VQYA 5CB4A 4FFBA 2EZPA 2XNDG 2EULA 2YSUB 1N4CA 3K5MA 2Z3YA 5LP6B 4CZZA 2EZOA 3CCQV 1H2LA 2VQEB 3SDLA 2P67A 1LR1A 1D5NA 2A0LA 5LGTA 3RW0A 2E3CA 2BSKB 4ZHQA 4Z1MG 3K5OA 2UXCB 3E35A 3ZIAG 1K4DC 4WFGA 5LXTA 2DJVA 2CTWA 1HNZO 1YZBA 1E79G 1XMQB 1F7YA 4DR4O 4X88A 1KKDA 3OUFA 4E2HA 5H9CA 2CAZC 5HFMA 1GAXA 4O4IB 3BY6A 4TUYB 1Z2GA 1K9MW 4WFAV 3SPJA 2F23A 4U7NA 2EINB 1SS3A 2YIAA 2EIMC 3P3PA 1B6QA 1YCIA 1KUQA 1P7BA 1KECA 5E79Z 2QTSA 1LNQA 1D5AA 2IU3A 1DGSA 2OTJV 3C3TA 3AG3C 3R66A 2E5LO 5KHKA 2OYQA 1QVGU 1AR1B 4JV5O 2UU9O 4O4HA 4CH4A 1THZA 3M8AA 2N05A 2PYJA 1FPOA 2QDOA 4FZ0A 2JDIG 3K3WA 1NR1A 3CCSV 1BGYH 4X20B 2DQ0A 5IJ0A 2CUGA 3KZIZ 3ZN1A 1UFIA 3VQWA 1AILA 1H2MA 2QJ1A 3W7SA 2VQFO 2Q9LA 4CS3A 5EK0A 2KG7B 1VEWA 3ASOB 2Y69C 2HR3A 1OCRC 5JQGB 4WFBV 1BE3H 2Z0AA 3UCSC 3J7AU 2BTOA 1MSDA 1PNMA 1U97A 1XDCA 2QKSA 4X64O 3WFVA 2Q68A 4IIJB 1DF5A 4ZOLA 1FS0G 3NXSA 1PKXA 1QLNA 2DYRB 2JS5A 3WG7B 3SR2C 4FPPA 4PA4A 4DR7O 2Y48A 4KP4A 3CP1A 4O4LA 1GO3F 3APOA 3OMNB 5FL7G 5KA5A 5KUKA 1AI5A 4R6ZA 1H2NA 2ILMA 1Y74A 3KCXA 5AG2A 1AP5A 3I56V 1ZAUA 5CA1B 1FXKA 1SQFA 5IDJA 1EZVH 4RAIA 2XHBA 2OCHA 4JI1B 3LDEA 4JI6O 3ETDA 4MVRA 2NR5A 1YTFB 4PDRA 4FJCC 3HKDB 3DSQA 4LFCO 3BA8A 4UCSA 2A79B 1B04A 4JI8B 4DR1O 3K79A 1IURA 4LWSB 1H8HG 4UB6Z 1S0VA 3JD3A 1H2KA 1BQZA 2HKOA 5LBQA 2X7RB 2DYSC 3JAMN 4TV9A 4TOIA 3B2EE 1TGOA 3Q4HA 1FFXB 1UJWB 3CE2A 2Q0OC 3JASA 5KHIA 4UVAA 2HJDA 4PI2A 2CH7A 3JD4A 2M7WA 2IH3C 2N74A 3U11A 2X6CA 3E8BA 4GKJB 2A9HA 5B1BC 1K8AW 4RO2A 3SPIA 4X9QA 1OZ0A 1L0LH 3N2GA 4X1YA 1ZLZA 2LGWA 3LNMB 3ABKB 3ABUA 4QE7A 1VQ9V 1MG1A 1VQ8V 1BCCH 1COWG 4B3TB 1V54B 4XDJA 4I0XB 3ASNC 1KBHA 4TV8A 4DV5O 1FKAO 4X65B 4E29A 3FB5C 3D36C 2GBOA 3K5NA 2AXTZ 4ZM5A 1NKDA 4F6RB 4JYAO 2G38A 4ASUG 3A0RA 3MHHC 3T4DA 2R9RB 4I7ZB 4J42A 4W4LA 3QO8A 1XI1A 3P32A 4N23A 1I94B 4GCZA 2UXXA 5BR8O 2ZINA 3I5DA 4J41A 3FKSG 4J7ZA 2XT9A 1DK1A 2UUBB 1FJGB 4YIPA 3LSQA 2P5OA 4LF5O 3MAQA 1NQTA 4I50A 2B9ZA 3U0ZA 2Q5ZA 5IWAB 4OX9O 3JAKB 3RYIA 2F93B 4HNAB 4KFMA 3PJSK 1EFRG 3HKCB 4A5UB 3K0GA 2PYLA 3CWBH 2ZDIA 4NYKA 3RYCA 4JTDB 3TXSA 4LFAO 1H38A 5LHGA 2BOBC 2EIMB 3JATA 3RYFB 4ZI7B 4MVZA 1SKVA 3B40A 4F4LA 2UUAO 1S5HC 2LFRA 1U96A 2JEXA 2W6JG 1JCHA 2WLIB 4B7EA 4LF7B 4X62B 2JGUA 5LL6Y 1Q5OA 1BHAA 2HLDG 1GM8A 1OCCC 3AG3B 3CEIA 3LSSA 2XUMA 2P22C 1I0HA 1X59A 2K1EA 4JZGA 4MVSA 4H44B 2B1GA 4B3MO 2JIZG 2MW2B 2WLJA 3JALB 2W6IG 4MTXA 3N27A 4DRXB 1VQ7V 1PPJH 1T5EA 1SQXH 5B3SC 1JMKC 1QVFU 4BW5A 3T1YB 1Q6IA 4QE9A 1QHTA 1NU1H 5DM6V 4LF8B 3DXRA 3U10A 4K8XA 4BAYA 3T1HB 2YS8A 3ABLC 3SYPA 4X66B 3B77A 1P7GA 3JARB 1NTKH 4DUZO 1R3LC 1YEWA 2Y69B 3E8GA 1OCRB 4X8AA 2N04A 5LA6B 5IJ9A 4K0KB 2VS0A 1MNGA 1MA1A 1VQPV 3QO5A 1EZJA 3OTFA 1URFA 1ENVA 1Y4MA 3RT3C 1R6TA 1H2SB 2LQTA 3VBBA 1NT2B 2CK3G 3CRQA 1Q81W 2D2CB 2EIKC 5IYZB 2VWJA 3P30A 4JF3A 2R9IA 3K9AA 4H0LB 4U3JA 4JI5B 3TXQA 5EIBD 2IM9A 1E1QG 2KQXA 3CMEV 1K7DA 2ZE5A 1XL4A 4ICGA 1DTOA 2HP8A 2RNBA 3JAWA 2QM4A 2H3OA 4L87A 2YC0A 3BVOA 2HHHB 4I4TA 1RSOB 5FLXN 4W4KA 3FX7A 1N36B 4BWAA 2F95B 1SQBH 1Q7YW 2UXBB 1NTMH 2LGQA 3CC4V 2QKCA 2RN9A 2DYSB 5DECA 5LGNA 1SETA 4DR5B 4EB6A 1VF6A 1OV9A 2XAGA 4B3SB 4YJ3B 3CD6V 1O9HA 3K5LA 5GTHZ 1Y6XA 1Y76B 2LW1A 3JD1A 2PUSA 4DO2A 5LMUB 3ZRXA 1K33A 3CC7V 4GX0A 1K97A 2QR4A 5EYPA 4QNHB 1DLBA 4I9QA 1W0KG 1CEZA 2B1IA 2IU0A 5LOVB 1RPOA 1ZL8A 5LMNO 5B1BB 3MHSC 3OGCC 5JWPA 2NN4A 3E83A 2PZSA 3IC9A 4GT1A 4D7SA 4AQYO 3ZMUA 3T2MA 4FLZA 2H8PC 1RM1C 3CJHB 1JOYA 4O4JB 5KMGA 2WWWA 1PL0A 1N34B 4PHZA 5L3FA 4X1IA 4LH7A 5IYCO 1KD1W 5J2TB 2QGNA 5B5EZ 2XTAA 2GUZA 3ASNB 1FXHA 4PDVA 4FMTA 1AP6A 1V9PA 1HNZB 5GONB 4X1KA 2FB5A 3AG4C 3WU2Z 1XL6A 5KLVH 3KKYA 3ML0A 4FM0A 1F51A 4J80A 1VQKV 1AROP 2Q69A 5KHHA 4LFBB 1SRYA 2AZ0A 3A0HZ 2ARHA 1F23A 4H33A 3DC5A 4AHCA 5JVDB 4PA3A 1KP2A 1WPXA 1SQVH 4MT8A 1MSWD 1SQPH 1VIBA 4R50A 1IZ3A 3FAVA 3OEHG 4LF4O 4DR3O 1P84F 3DGEA 1XREA 4UCRA 2A06H 2XAQA 4R7CA 1N0NA 1I5XA 4IYIA 4DR2O 2E5LB 1TUBB 2IH1C 4JV5B 3OW2U 2WLLA 5BMVB 2Q73A 3JD0A 3AG1C 5JJJB 3BHPA 4J9YB 4FM2A 3JSNA 4IHJA 2FL4A 4NXMO 2JJ1G 3TGUH 3OMAB 4KHPO 5C8YB 4JI7B 4NXNO 5D5QA 1S76D 1QLEC 3CPWU 1R3IC 5CB4B 4YJ2B 4FFBB 2QWPB 4NR1A 1VQ6V 3CXHF 3CRMA 1OCCB 4RUFA 1HWYA 2VQFB 3OGIB 2YIBA 4DV7O 2IJHA 4QGPA 4UXNA 1VF5B 3N2KA 5LGUA 1SERA 1XMOO 2Q4PA 2YIDA 3ZN0A 3UO2A 3RVYA 2JGDA 1N32O 1PD3A 3CX5F 5GTIZ 1D2DA 2E74B 1NBMG 3HKEB 4NB5A 5B3SB 5ITZB 2GDSA 4X64B 5JH7A 3T4ZA 4ZHQB 3L9DA 3T1CA 5KHJA 1MABG 5LXTB 3ABLB 4UV8A 4DR7B 2ZNJA 1M93A 3CRRA 4MVOA 4P30A 3QNEA 3G80A 4DV1O 4I55A 1TAEA 2XAHA 2Q8VA 4WBNB 2CTRA 3LNNA 4RQFA 4TUYA 4XDLA 2BCCH 3AK2A 5F2VO 1SC5B 5DEDA 4FIPC 4JI6B 2EIKB 1W2BU 4JYBA 1HP8A 3ZX6A 4GLXA 1FYJA 4LFCB 4JAUA 4JGSA 4DR1B 1P4RA 1BHBA 1S77D 2ZIOA 2ZM6O 4JI4O 4O4HB 4AI8A 4YXWG 2GHYA 2Y0IA 1EM1A 4X89A 4FZ1A 3TK1A 2CTPA 2AZ2A 2EJ7A 5IJ0B 2KKWA 4DV4O 1BL8A 2Z5UA 1GH6A 1H8EG 3CCEV 3ZEDA 3D8CA 1HDJA 2LFSA 1IXMA 3IGAC 2ZE8A 4PI0A 4DV3O 3W7WA 1TVKA 1JJOA 4R8CA 2KG7A 4UCTA 1R1BA 3RBZA 2QWOB 1VARA 4YHHO 5JJEB 3BABA 3FYIB
chains in the Genus database with same CATH topology
2UXXA 1CP9A 1YITV 2V7QG 4H37A 3FKSG 1YJNV 5CBHA 3W7TA 4E2CA 3LSQA 1K73W 2XOKG 5GW7A 1Y66A 4OXSA 3FB6C 1F4MA 1NQTA 5LHHA 1EBOA 1N8RW 3HB3B 4MS2A 3ASOC 3SYAA 1JQ0A 3AG2C 3ETEA 1GK9A 2EIJB 4PA7A 4KFMA 4LP8A 1RM1B 4HAMA 3PJSK 1EFRG 2FTKA 2P6JA 3E8FA 3K0GA 1M56C 2ZDIA 5IYBO 1PNLA 1W0JG 4JTDB 4XBFA 1SZTA 4MSWC 2XAJA 1VQNV 4E2LA 1H38A 2ZR3A 4PDMA 3G6EV 2DYRC 3WG7C 5LHGA 2HVJC 2BOBC 2EIMB 2WPDG 2Q67A 4GX2A 1OCZB 4MVZA 1OCOB 2JJ2G 4F4LA 4CBCA 5L3EA 3CCVV 2ZXWC 1S5HC 3EFFK 3OMIB 2LFRA 2JEXA 2W6JG 2WLIB 1JCHA 3DTUB 3E8HA 1YJ9V 2BOCC 1DF4A 3MD0A 2WSSG 2QM8A 3K06A 4G2KA 1BHAA 2HLDG 1GM8A 2V1DA 3OR7C 1OCCC 4JTCB 2ZD9A 1AJPA 3AG3B 1S72V 3LSSA 5C93A 2K1EA 1YIJV 1H2GA 3E2EA 2ZDIC 3AG4B 4MVSA 1AI4A 4G27B 4PA9A 2B1GA 1RPRA 3LDDA 5EBMC 2JIZG 2WLJA 4LCUC 2W6IG 4MTXA 1VQ7V 2EIJC 2XASA 3UKMA 3OM3B 1KQSU 4BIZA 1K92A 4MVUA 1MOFA 1ROPA 5B3SC 3ABTA 1QVFU 4BW5A 5EC1C 4QE9A 3ETGA 5DM6V 3ZRWA 5KA6A 4JAVA 3SYOA 3STLC 4BAYA 3STZC 2YEVB 3ABLC 3CXCU 1YI2V 3SYPA 3D36A 3B77A 5B1OA 5B1AC 1R3LC 5CBGA 3G4SV 2Y69B 3E8GA 1AI7A 1NR7A 1OCRB 3CCRV 3RVZA 3B8OA 2QE7G 2X6BA 5L3CA 4X8AA 3CYOA 1VQPV 3QO5A 4RQEA 1EZJA 5E1AC 3CCUV 3OAAG 4EKWA 1ORQC 3AG1B 1FXVA 2OCCB 2DQ3A 3E86A 4MVQA 5L3BA 1VQ5V 1ENVA 4ZKIA 4G28B 4WFEA 3F7YC 1SESA 1Y4MA 3SPCA 2D3OW 1KP3A 3VBBA 1M90W 4I9WA 1QLEB 3FB7C 2EILC 2CK3G 4GX1A 4KUMA 1Q81W 3OEEG 5H6RA 4PDLA 2EIKC 2H94A 3OE7G 3P30A 4JF3A 2F43G 2R9IA 3K9AA 4UV9A 3ZMSA 4P9OA 1K5SA 2WLLB 4LBEC 4PELA 3GWOA 3I55V 1E1QG 5BZBA 4P2ZA 4WFFA 3CMEV 1K7DA 1XL4A 3ABKC 1YSCA 3X2QB 5CBFA 1R3KC 5EC2C 4TSFG 3JD2A 1DTOA 5L3DA 2X0LA 2PI4A 4TT3G 1KC8W 4L87A 1JPXA 2IW5A 2AHZA 1V54C 2NLJC 2EZPA 2XNDG 1K34A 2YSUB 1NH2B 3CCMV 1M57B 2Z3YA 1F4NA 1AJNA 2P90A 1JVMA 3JCZA 3ABMC 4CZZA 2HFEC 4J9ZB 2PI5A 2EZOA 4DXWA 1VQOV 1Q7YW 3CCQV 3ZMVA 1BMFG 3HPLC 3CC4V 2P67A 1FXKB 4QPJA 5B1NA 2DYSB 2A0LA 1Q86W 3ZMZA 5LGNA 3K04A 1SETA 5LGTA 2XAGA 2WLKA 3IC7A 4WF9V 3CD6V 1GKFA 3RW0A 4FK5C 4DO2A 3JD1A 2OTLV 3JYCA 4Z1MG 3ZRXA 2IJIA 3E35A 3ZIAG 1K33A 3CC7V 1NVPB 1K4DC 1R73A 4WFGA 4GX0A 4TWKA 1K97A 3SYCA 2P7TC 5IY5B 4QNHB 1VQMV 1DLBA 2WLIA 1E79G 1W0KG 3B8PA 4GCZA 4QJFB 4X88A 1CEZA 2B1IA 2IU0A 1RPOA 1M1KW 5B1BB 4MTGA 3OUFA 1KKDA 3MHSC 2QA4V 4E2HA 3E89A 5H9CA 3OGCC 3E83A 5KUMA 5HFMA 4GT1A 1QR8A 3FYEB 3VOUA 1JJ2U 2DW4A 3ZMUA 3T2MA 1RM1C 2H8PC 3BY6A 1JOYA 3ZMTA 2HJFC 1K9MW 2WWWA 4UUJC 2JEUA 4WFAV 3R65A 1PL0A 1AI6A 3SPJA 1TUEB 4U7NA 2EINB 3LDCA 2EIMC 2JK5C 1GM9A 5L3FA 1OCZC 1I5YA 1OCOC 3K0DA 4QPKA 5IYCO 1KD1W 3OR6C 4P9PA 3ZRWB 1YTFD 2UXNA 1B6QA 4BIUA 3M99B 3ASNB 1FXHA 1V55B 1P7BA 2HG5C 1KECA 4PDVA 1LNQA 4FMTA 2NNUA 2IU3A 3QO7A 2YEVA 3KG2A 2OTJV 3AG3C 2ATKC 1QVGU 1AR1B 3W7XA 1THZA 3AG4C 1XL6A 1J95A 3CC2V 1K5QA 3ML0A 1F51A 1VQKV 1AROP 1YHQV 2JDIG 3K3WA 1NR1A 2Q69A 1S3JA 3CCSV 1SRYA 1F23A 5J9PC 1K3EA 2B5UA 2DQ0A 4H33A 5LHIA 2WLHA 2XAFA 4PA3A 1KP2A 3ZN1A 3EHBB 1WPXA 2ITDC 1GTOA 4MT8A 1MSWD 1Q82W 2DWDC 2W0FC 3W7SA 4R50A 2QTOA 2AHYA 4LC1A 5EK0A 2QM7A 3OEHG 3ZRSA 1R6NA 3ASOB 2Y69C 2HR3A 1R3JC 2WLMA 1OCRC 3DGEA 3CMAV 4WFBV 2XAQA 4R7CA 5H6QA 1I5XA 3AG2B 4WFHA 1GMGA 1JX9A 2IH1C 4XDKA 1PNMA 3OW2U 1M56B 1OHHG 2WLLA 3JD0A 2QKSA 3AG1C 3WFVA 2Q68A 2OCCC 1WLEA 1DF5A 1FS0G 2Q6AA 3NXSA 1PKXA 4J9YB 3SJQC 2DYRB 4U7OA 3WG7B 1QLNA 4I5SA 2GSMB 2DWEC 2JJ1G 3TETA 4FPPA 3OMAB 2ZXWB 4PA4A 1S76D 1QR9A 1QLEC 3CPWU 1R3IC 2Y48A 4KP4A 3CP1A 4PA6A 5CN0A 1VQLV 1VQ6V 3IFXA 1OCCB 4RUFA 1GM7A 1GO3F 1HWYA 3OMNB 5FL7G 5KA5A 5KUKA 1AI5A 4MVMA 4R6ZA 2IJHA 4UXNA 3TCUA 2EJRA 5LGUA 1SERA 1CPYA 3OUSA 3AEIA 3ZN0A 1G8MA 3F7VC 3RVYA 3I56V 2ZQMA 1PD3A 3GB7C 3X2QC 5HFLA 2WAMA 1FXKA 1NBMG 4JYCA 5IDJA 5B3SB 4RAIA 1K4CC 3T4ZA 2QEXV 3F5WC 3LDEA 3ETDA 4MVRA 4JPRA 3D3IA 3T1CA 1YTFB 3LUTB 4MW8A 4PDRA 4FJCC 1MABG 3FB8C 3ABLB 1M9NA 4UV8A 3B8MA 1M57C 2A79B 5B1AB 3K79A 2HVKC 1NJIW 1H8HG 4JTAB 2LP7A 5L3GA 4MVOA 1NH2D 4P30A 1S0VA 3JD3A 4RUEA 2X6AA 3QNEA 1PNKA 2HKOA 4GX5A 1FXKC 2MK3A 5LBQA 2X7RB 2DYSC 2XAHA 4ZBMA 4N21A 4QIWF 2ITCC 4RQFA 3CCLV 4HYOA 1UJWB 4XDLA 2OT5A 4WCEV 3G71V 3BEHA 4ZM1A 4UVAA 1VQ4V 3SYQA 2EILB 3JD4A 2M7WA 2IH3C 4FIPC 4JASA 5IYDO 1QBZA 1YJWV 3CCJV 2EIKB 1W2BU 2X6CA 5IY5C 4JYBA 3ZCCA 1NVPD 1G4YB 5EBLC 5EBWC 3SPGA 3E8BA 3OFNG 4JAUA 2A9HA 4JGSA 4UVBA 5B1BC 1P4RA 1K8AW 1BHBA 4RO2A 1S77D 3SPIA 4HZ3A 1OZ0A 4YXWG 2GHYA 3K03A 5DN6G 3ZJZA 4MW3A 3LNMB 3UM7A 5CA3A 3ABUA 2IJKA 2WLNA 3ABKB 4QE7A 1VQ9V 1MG1A 1VQ8V 1COWG 3B8NA 2EINC 4X89A 1R6KA 3K08A 3TK1A 2IJJA 2EBOA 1V54B 4XDJA 1BL8A 4Q20A 2Z5UA 3ASNC 3W7UA 1V55C 2KB1A 1H8EG 3CCEV 4MTOA 4E29A 3FB5C 2LFSA 4UVCA 1IXMA 3IGAC 3H01A 3ZRVA 1L1FA 1QCEA 3ABMB 3W7WA 4ZM5A 1FFTB 1AJQA 4R8CA 1NKDA 4MTFA 3SPHA 4ASUG 3A0RA 3MHHC 3RBZA 3T4DA 2R9RB 2C2AA 3QO8A 1E1RG 2ZR2A 3P32A 4N23A 3FYIB 1ZWIC 5CMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENV A;  3CP1 A;  2MK3 A;  5CN0 A;  4JGS A;  2P6J A;  2X7R B;  1Y4M A;  4E29 A;  1I5X A;  1I5Y A;  1DLB A;  2EZO A;  3B77 A;  1SZT A;  4JPR A;  4N21 A;  4E2L A;  4E2C A;  3H01 A;  4FJC C;  3B8P A;  5KA5 A;  3M99 B;  1QCE A;  2OT5 A;  1Y66 A;  1F23 A;  3B8O A;  4ZM5 A;  4E2H A;  3MHS C;  4ZM1 A;  5H9C A;  3B8M A;  1JPX A;  3WFV A;  3P30 A;  1EBO A;  5HFM A;  4JF3 A;  3MHH C;  3K9A A;  1DF5 A;  1QR8 A;  1MG1 A;  3CYO A;  3B8N A;  2M7W A;  4FIP C;  1MOF A;  2EZP A;  2LP7 A;  1QBZ A;  1DF4 A;  1K34 A;  4FK5 C;  1JQ0 A;  2EBO A;  5HFL A;  4G2K A;  5KA6 A;  1K33 A;  4N23 A;  3GWO A;  1QR9 A;  5CMU A; 
#chains in the Genus database with same CATH topology
 1CP9 A;  3EXA A;  4DR6 O;  4H37 A;  4E2C A;  5KX5 A;  1Y66 A;  1XHX A;  4OXS A;  1SQG A;  1F4M A;  5IE9 A;  3SJB C;  5LHH A;  1N8R W;  4DV5 B;  4O4L B;  4MS2 A;  4LF6 O;  3AG2 C;  3H1I H;  3ETE A;  1M5I A;  4O2A A;  1GK9 A;  2EIJ B;  1RM1 B;  4JYA B;  3E8F A;  1M56 C;  1PNL A;  4MSW C;  2ZR3 A;  3SJC C;  2WPD G;  4KL1 A;  1S5L Z;  5CA1 A;  3OMI B;  1RP3 B;  2CE4 A;  2BOC C;  1DF4 A;  3MD0 A;  5KAI Z;  2YUA A;  1JFF A;  3K06 A;  2ZKO A;  4G2K A;  5B66 Z;  4JTC B;  4CH6 A;  1Y67 A;  5C93 A;  4OX9 B;  2DMX A;  3AG4 B;  1AR4 A;  3ZS8 C;  2A7W A;  4G27 B;  4PA9 A;  1RPR A;  4TV9 B;  1XNQ O;  2XAS A;  1VF6 C;  4FM1 A;  3ABT A;  3JAS B;  3ZRW A;  3SYO A;  2CH7 B;  2YEV B;  3CXC U;  1YI2 V;  4DUY O;  5FNV A;  3E22 B;  3G4S V;  4BIO A;  1NR7 A;  4LNU B;  3RVZ A;  2QE7 G;  1IBK B;  1SA0 B;  2M6Y A;  4F6E A;  4JI3 O;  3ZHS A;  3CYO A;  3N2G B;  4B7K A;  3AG1 B;  2JRI A;  1VQ5 V;  4B3M B;  4DV6 O;  1SES A;  2D3O W;  2UUC O;  1QLE B;  2EIL C;  4GX1 A;  3OEE G;  4TV8 B;  2H94 A;  2F43 G;  1MZE A;  2ZT9 B;  4DUZ B;  1K5S A;  4LBE C;  4PEL A;  3I55 V;  4P2Z A;  4YY3 O;  4WFF A;  4F6R A;  3ZHQ A;  5CBF A;  5EC2 C;  3JD2 A;  4L8J A;  2R9A A;  2PI4 A;  1BSM A;  2KSD A;  1KC8 W;  1YDX A;  1FD9 A;  2IW5 A;  2AHZ A;  4JI1 O;  5K1X A;  3KCY A;  1IX9 A;  1IBL B;  1B06 A;  3CCM V;  4I50 B;  4JI8 O;  1F4N A;  1AJN A;  1JVM A;  3IAY A;  3RYI B;  2HFE C;  4OPH A;  4NTW A;  1BMF G;  3JAK A;  4QPJ A;  2CDY A;  3ZMZ A;  3RYC B;  5IT9 N;  1A32 A;  3UT5 A;  2WLK A;  3IC7 A;  4WF9 V;  3BFR A;  1PV0 A;  4FK5 C;  3FFQ A;  1UPG A;  5LYJ B;  1NVP B;  4E4E A;  3RYF A;  3ICX A;  2P7T C;  2WLI A;  3L74 H;  4FLT A;  3VQX A;  4QJF B;  3SJA C;  1M1K W;  4GKJ O;  4MTG A;  2QA4 V;  5KUM A;  2V4D A;  1QR8 A;  3FYE B;  3VOU A;  2DW4 A;  3ZMT A;  2HJF C;  2QSA A;  4UUJ C;  3APQ A;  2F4V O;  2JEU A;  1FAF A;  3R65 A;  3A2F A;  3LDC A;  2JK5 C;  4KXR A;  4DRX A;  5EZY A;  3K0D A;  1OCO C;  4QPK A;  1XQ8 A;  4P9P A;  1YTF D;  2UXN A;  4BIU A;  3M99 B;  1ZX3 A;  1XIL A;  2HG5 C;  3ETQ A;  2NNU A;  3QO7 A;  3KG2 A;  4O2B A;  2JVD A;  2ATK C;  3JAR A;  3G67 A;  5IJ9 B;  1ZTE A;  5LMN B;  2RQ6 A;  4OGQ B;  1WA8 A;  2ADQ B;  4CS2 A;  1K5Q A;  5LA6 A;  1GN2 A;  1YHQ V;  4AQY B;  1NS1 A;  4K3A A;  1WB8 A;  1I94 O;  1MZF A;  1J5E B;  2XAF A;  5CA0 A;  5K1P A;  2ITD C;  1GTO A;  4Z2W A;  4IGG A;  2UUB O;  1FJG O;  1AR5 A;  2DWD C;  2QTO A;  2QM7 A;  4U3J B;  1HNX O;  1KU9 A;  2WLM A;  3OTO O;  2A3Q A;  5H6Q A;  3AG2 B;  2RCV A;  4WFH A;  1SZX A;  4XDK A;  1M56 B;  3HKB A;  3S3W A;  1BS3 A;  3K59 A;  2OCC C;  1G6U A;  3SJQ C;  3WB1 A;  1YXB A;  2F66 C;  4I5S A;  2GSM B;  2DWE C;  1MMM A;  3TET A;  1QR9 A;  3CRC A;  2E76 B;  3H9V A;  1VQL V;  4J7K A;  3IFX A;  4I4T B;  2Y4T A;  4NTY A;  1GM7 A;  4MVM A;  5J2U A;  4FLX A;  2E75 B;  4DR3 B;  3QF7 A;  3K9S A;  1CPY A;  2FML A;  1PP9 H;  1G8M A;  3OD4 A;  3GB7 C;  4DR2 B;  2ETN A;  4EB6 B;  1L8D A;  4JI0 O;  4B3R O;  1AVM A;  3T1Y O;  4DK0 A;  4YJ3 A;  4MW8 A;  4NXM B;  1Y76 A;  4KHP B;  3T1H O;  1G1X B;  4NXN B;  4GUN A;  3B8M A;  1M57 C;  2HVK C;  4TQD A;  2LP7 A;  4PJ0 Z;  2F1M A;  5FPR A;  4DV0 O;  4DV2 O;  1KYO F;  4RUE A;  2YI8 A;  3RYH A;  4DV7 B;  1PNK A;  1FXK C;  2HEP A;  2RJZ A;  2FYU H;  4N21 A;  4QIW F;  2ITC C;  3CJH A;  2OT5 A;  3AG7 A;  3G71 V;  3BEH A;  1WJZ A;  2BTQ A;  1VQ4 V;  2EIL B;  2VRZ A;  2GUZ B;  1JA8 A;  5IYD O;  1QBZ A;  1GN3 A;  5J2T A;  5IY5 C;  3ZCC A;  4DYL A;  1VP7 A;  1JR9 A;  1SF9 A;  5A9G A;  1NVP D;  4DR4 B;  5EBL C;  5EBW C;  4X1K B;  3G6B A;  4BW9 A;  4EFE A;  4UVB A;  1WP7 A;  5GON A;  4BR6 A;  4HZ3 A;  1ZSP A;  3K03 A;  5DN6 G;  3ZJZ A;  2Q7E A;  2WLN A;  4LF9 O;  1B3Q A;  4EFB A;  4DV1 B;  3QTC A;  3L73 H;  2Y4U A;  2IJJ A;  4C7U A;  2EBO A;  4Q20 A;  4GYC B;  5TIS Z;  3W7U A;  1V55 C;  2KB1 A;  1IBM O;  4MTO A;  3PN1 A;  4UVC A;  3FAV B;  4ZIB A;  3ZRV A;  1L1F A;  4J7J A;  2UU9 B;  1AJQ A;  3UO3 A;  1WB7 A;  2PGG A;  1P49 A;  2K9P A;  2C2A A;  2ZM6 B;  4JI4 B;  1E1R G;  1GN4 A;  3BCC H;  4DR5 O;  4B3S O;  5BMV A;  1YIT V;  3L71 H;  1YJN V;  5CBH A;  3W7T A;  2UXD O;  1HR0 O;  5GW7 A;  1N33 O;  3H1K H;  2DOS A;  2P06 A;  4YJ2 A;  1W59 A;  4J10 A;  4NTX A;  5LP6 A;  2L35 A;  3SYA A;  1JQ0 A;  2YDE A;  3N2K B;  4DV3 B;  1S5J A;  4PA7 A;  4LP8 A;  1NTZ H;  2OIE A;  2FTK A;  1EN4 A;  1M4U A;  1QQC A;  1XOU A;  2JGD B;  5IYB O;  5JCO A;  4XBF A;  1SZT A;  3A0B Z;  4E2L A;  4YHH B;  3G6E V;  5FPO A;  3RWR D;  4NVP A;  1N34 O;  2BSK A;  2Q67 A;  4GX2 A;  5JH7 B;  1OCO B;  2PTM A;  1XNR O;  4CBC A;  2ZXW C;  3HKE A;  3EFF K;  5ITZ A;  3DTU B;  1YJ9 V;  4DR6 B;  2WSS G;  2V1D A;  3OR7 C;  1HNW O;  2YXH A;  1AJP A;  3QG5 A;  1IXB A;  4JI2 O;  1O9G A;  2ZDI C;  4LF6 B;  4O4I A;  4I55 B;  5EBM C;  3LDD A;  1EN6 A;  1K92 A;  4LFB O;  4MVU A;  3RN4 A;  5EC1 C;  3EVK A;  4WBN A;  3ETG A;  5KA6 A;  3WB2 A;  1Z5V A;  3STL C;  2DE0 X;  3STZ C;  1WAZ A;  5B1O A;  5B1A C;  5CBG A;  1AI7 A;  3CCR V;  3B8O A;  2X6B A;  3K57 A;  3BRC A;  5E1A C;  1Q6U A;  3OAA G;  1ORQ C;  1XBL A;  4GKK O;  2OCC B;  2DQ3 A;  4MVQ A;  5L3B A;  4X20 A;  4WFE A;  3THO A;  1XNQ B;  1IDS A;  1KP3 A;  4OPA A;  4U3F H;  4JI7 O;  3FB7 C;  3J80 N;  4KUM A;  2CTQ A;  3BPZ A;  5H6R A;  4IYH A;  3OE7 G;  3SGI A;  1KKC A;  5D5P A;  4YIO A;  2VQE O;  5JQG A;  1XHZ A;  4DUY B;  4TQF A;  2PY5 A;  1TVK B;  3ZMS A;  4P9O A;  2LO1 A;  1Q90 D;  5BZB A;  2VWK A;  4ZOL B;  4FLY A;  4JI3 B;  1R3K C;  3M7M X;  4IIJ A;  5L3D A;  4TT3 G;  2GTS A;  2UXC O;  1LUW A;  1JPX A;  1NZ6 A;  4DV6 B;  3K58 A;  5KX5 B;  2NLJ C;  1XMQ O;  1K34 A;  1NH2 B;  2UUC B;  1QNM A;  1M57 B;  3DC6 A;  2P90 A;  1Y74 B;  3JCZ A;  3ABM C;  1I08 A;  4J9Z B;  2PI5 A;  4DXW A;  1VQO V;  3ZMV A;  4O2A B;  3HPL C;  1FXK B;  5B1N A;  3NR7 A;  1Q86 W;  3K04 A;  4YY3 B;  3AK1 A;  5BR8 B;  2YI9 A;  3F5T A;  1GKF A;  4JYY A;  2OTL V;  3JYC A;  2CGO A;  3IJ4 A;  2IJI A;  1R73 A;  4LF5 B;  4TWK A;  3HKD A;  3SYC A;  5IY5 B;  1VQM V;  1JFF B;  4K35 A;  4LWS A;  2LW7 A;  3B8P A;  2YXL A;  3E89 A;  2QKA A;  2RDC A;  2W0X A;  1JJ2 U;  4PD4 F;  4IL6 Z;  3Q4H B;  2YIB D;  4CC6 A;  4LFA B;  1AI6 A;  1FFX A;  3HR0 A;  1TUE B;  1GM9 A;  2UUA B;  1YVW A;  1Q3E A;  1OCZ C;  2Q7H A;  1I5Y A;  2YXY A;  2LJ2 A;  3OR6 C;  3ZRW B;  1US6 A;  2RMK B;  3CSX A;  1V55 B;  2DN9 A;  1IVS A;  2P4V A;  5FNV B;  2YEV A;  4X1Y B;  5H5N A;  3CRA A;  3GWK C;  3E22 A;  3W7X A;  1J95 A;  4LNU A;  3JCU Z;  3CC2 V;  3B4S A;  1SA0 A;  1Q43 A;  4UCU A;  1S3J A;  4CS4 A;  1VF7 A;  5J9P C;  2F4V B;  1K3E A;  1XEQ A;  2B5U A;  5LHI A;  2WLH A;  1BZK A;  3EHB B;  4FLW A;  4I0X A;  1Q82 W;  2W0F C;  1X4T A;  2AHY A;  4LC1 A;  3RFR A;  1BQ0 A;  3ZRS A;  1R6N A;  1R3J C;  3CMA V;  2R72 A;  3AK3 A;  3WB0 A;  1XUQ A;  1GMG A;  2R70 A;  1BT8 A;  1JX9 A;  4DW0 A;  1OHH G;  2ADP A;  4DK1 A;  4EEQ A;  4FLU A;  1WLE A;  2Q6A A;  4U7O A;  3P3N A;  1NI8 A;  2ZXW B;  5A2Q N;  2Y0P A;  2WA4 A;  4PA6 A;  5CN0 A;  4GZR B;  4H13 B;  1PM9 A;  3O65 A;  2Q7G A;  1WN7 A;  3TCU A;  4D6T H;  2EJR A;  1RFY A;  3MDS A;  3OUS A;  4HNA A;  1HNX B;  3AEI A;  3OTO B;  3F7V C;  3HKC A;  2ZQM A;  3X2Q C;  5HFL A;  2WAM A;  3JAT B;  3UT5 B;  4JYC A;  3C90 A;  1K4C C;  2QWN B;  4ZI7 A;  2QEX V;  4CH3 A;  3F5W C;  4FVM A;  3ZHV A;  4JPR A;  3D3I A;  2OIG A;  3LUT B;  3FB8 C;  1M9N A;  4ABM A;  2BE3 A;  5LYJ A;  5B1A B;  1NJI W;  1LUV A;  4JTA B;  5LP6 C;  5L3G A;  1NH2 D;  2FKX A;  1YF2 A;  3CB2 A;  4FLV A;  4PV1 B;  1IBK O;  2X6A A;  4HBN A;  3L72 H;  1GRJ A;  4GX5 A;  4Z1V A;  2MK3 A;  3CHX A;  4B3T O;  3JAL A;  4ZBM A;  5JCO C;  3H1H H;  3CCL V;  4HYO A;  3DXR B;  4WCE V;  1SQQ H;  1Q6H A;  4ZM1 A;  4JI0 B;  1N0J A;  5EZY B;  1WPB A;  4X65 O;  4B3R B;  3SYQ A;  4JAS A;  1YJW V;  3CCJ V;  4NKG B;  2P4K A;  1G4Y B;  3SPG A;  3OFN G;  4O2B B;  3OT7 A;  2ZNI A;  3CS5 A;  4DV0 B;  4MW3 A;  4DV2 B;  1WA8 B;  3UM7 A;  5CA3 A;  1KMI Z;  2IJK A;  4AIL C;  1KB9 F;  3TJT A;  3L70 H;  3ZBH A;  3B8N A;  2EIN C;  3BA9 A;  1R6K A;  3K08 A;  3A8T A;  4J11 A;  3ZHU A;  5BY1 A;  5CA0 B;  2ZE6 A;  1IBL O;  5IYZ A;  5IWA O;  2ZCE A;  3L75 H;  3H01 A;  5KAF Z;  1EN5 A;  2ZE7 A;  1QCE A;  3ABM B;  3LSU A;  1FFT B;  4MTF A;  3SPH A;  1VMG A;  3JAW B;  2ZR2 A;  3QVN A;  3HKB B;  3S3X A;  2QWQ B;  4BIZ A;  1ZWI C;  5CMU A;  4LF9 B;  4LF7 O;  2V7Q G;  4X62 O;  1K73 W;  2XOK G;  3FB6 C;  1RSO A;  4LF4 B;  4LR3 A;  1EBO A;  4CH5 A;  4JAA A;  3HB3 B;  1IBM B;  1CXZ B;  3ASO C;  3BAA A;  4LH6 A;  4UCV A;  5J2U B;  4DW1 A;  2OWO A;  3D3Q A;  4HAM A;  1Z5W A;  2QWR B;  2P6J A;  1W0J G;  2XAJ A;  1VQN V;  4FFK A;  2AW9 A;  4PDM A;  4B08 A;  2DYR C;  3WG7 C;  4LF8 O;  2HVJ C;  4UCO A;  4UFZ A;  1OCZ B;  2JJ2 G;  5L3E A;  3CCV V;  5EYP B;  4X66 O;  3J81 N;  3E8H A;  2L6L A;  1ZL8 B;  2QM8 A;  3GVM A;  3VQV A;  1HR0 B;  2UXD B;  2ZD9 A;  5H2F Z;  5LOV A;  1S72 V;  4K0K O;  1N33 B;  2JS3 A;  1QU7 A;  1XMO B;  1YIJ V;  1H2G A;  5KMG B;  3E2E A;  4UB8 Z;  2CGN A;  3RYH B;  1N32 B;  1AI4 A;  1TA8 A;  4O4J A;  2IBZ H;  4LCU C;  2EIJ C;  2GV9 A;  4X1I B;  4CC5 A;  3RGB A;  3UKM A;  1WNS A;  3OM3 B;  1KQS U;  1MOF A;  1ROP A;  4D7T A;  2BTQ B;  3FD9 A;  1J5E O;  4JAV A;  1AB3 A;  1OJH A;  3B09 A;  2EX3 A;  2ZIM A;  2Q0A A;  3H1L H;  1XNR B;  4JI5 O;  3D36 A;  3O9O A;  2ODM A;  1HW7 A;  4RWU A;  3JSL A;  1HNW B;  5L3C A;  2AGA A;  2WA3 A;  2O57 A;  4RQE A;  2YIC A;  4JI2 B;  1PL4 A;  3CCU V;  4EKW A;  1FXV A;  4IT5 A;  3E86 A;  1I7F A;  4ZKI A;  4G28 B;  3F7Y C;  3SPC A;  3H1J H;  2PF4 E;  5JVD A;  2HHH O;  1M90 W;  4I9W A;  4Q6G A;  3C3S A;  4PDL A;  1N36 O;  5EIB C;  1Q8I A;  3ZHR A;  1ZUQ A;  5BXZ A;  2GTA A;  1WP8 A;  2UXB O;  3UQ8 A;  4UV9 A;  4JZ2 A;  2WLL B;  4K8Z A;  1L0N H;  3GWO A;  1TUB A;  4IHJ B;  3ABK C;  1YSC A;  3X2Q B;  1GN6 A;  4TSF G;  5LMU O;  2X0L A;  4GKK B;  5JJN B;  3ZHT A;  4DV4 B;  5C8Y A;  5KHG A;  1V54 C;  3VQY A;  5CB4 A;  4FFB A;  2EZP A;  2XND G;  2EUL A;  2YSU B;  1N4C A;  3K5M A;  2Z3Y A;  5LP6 B;  4CZZ A;  2EZO A;  3CCQ V;  1H2L A;  2VQE B;  3SDL A;  2P67 A;  1LR1 A;  1D5N A;  2A0L A;  5LGT A;  3RW0 A;  2E3C A;  2BSK B;  4ZHQ A;  4Z1M G;  3K5O A;  2UXC B;  3E35 A;  3ZIA G;  1K4D C;  4WFG A;  5LXT A;  2DJV A;  2CTW A;  1HNZ O;  1YZB A;  1E79 G;  1XMQ B;  1F7Y A;  4DR4 O;  4X88 A;  1KKD A;  3OUF A;  4E2H A;  5H9C A;  2CAZ C;  5HFM A;  1GAX A;  4O4I B;  3BY6 A;  4TUY B;  1Z2G A;  1K9M W;  4WFA V;  3SPJ A;  2F23 A;  4U7N A;  2EIN B;  1SS3 A;  2YIA A;  2EIM C;  3P3P A;  1B6Q A;  1YCI A;  1KUQ A;  1P7B A;  1KEC A;  5E79 Z;  2QTS A;  1LNQ A;  1D5A A;  2IU3 A;  1DGS A;  2OTJ V;  3C3T A;  3AG3 C;  3R66 A;  2E5L O;  5KHK A;  2OYQ A;  1QVG U;  1AR1 B;  4JV5 O;  2UU9 O;  4O4H A;  4CH4 A;  1THZ A;  3M8A A;  2N05 A;  2PYJ A;  1FPO A;  2QDO A;  4FZ0 A;  2JDI G;  3K3W A;  1NR1 A;  3CCS V;  1BGY H;  4X20 B;  2DQ0 A;  5IJ0 A;  2CUG A;  3KZI Z;  3ZN1 A;  1UFI A;  3VQW A;  1AIL A;  1H2M A;  2QJ1 A;  3W7S A;  2VQF O;  2Q9L A;  4CS3 A;  5EK0 A;  2KG7 B;  1VEW A;  3ASO B;  2Y69 C;  2HR3 A;  1OCR C;  5JQG B;  4WFB V;  1BE3 H;  2Z0A A;  3UCS C;  3J7A U;  2BTO A;  1MSD A;  1PNM A;  1U97 A;  1XDC A;  2QKS A;  4X64 O;  3WFV A;  2Q68 A;  4IIJ B;  1DF5 A;  4ZOL A;  1FS0 G;  3NXS A;  1PKX A;  1QLN A;  2DYR B;  2JS5 A;  3WG7 B;  3SR2 C;  4FPP A;  4PA4 A;  4DR7 O;  2Y48 A;  4KP4 A;  3CP1 A;  4O4L A;  1GO3 F;  3APO A;  3OMN B;  5FL7 G;  5KA5 A;  5KUK A;  1AI5 A;  4R6Z A;  1H2N A;  2ILM A;  1Y74 A;  3KCX A;  5AG2 A;  1AP5 A;  3I56 V;  1ZAU A;  5CA1 B;  1FXK A;  1SQF A;  5IDJ A;  1EZV H;  4RAI A;  2XHB A;  2OCH A;  4JI1 B;  3LDE A;  4JI6 O;  3ETD A;  4MVR A;  2NR5 A;  1YTF B;  4PDR A;  4FJC C;  3HKD B;  3DSQ A;  4LFC O;  3BA8 A;  4UCS A;  2A79 B;  1B04 A;  4JI8 B;  4DR1 O;  3K79 A;  1IUR A;  4LWS B;  1H8H G;  4UB6 Z;  1S0V A;  3JD3 A;  1H2K A;  1BQZ A;  2HKO A;  5LBQ A;  2X7R B;  2DYS C;  3JAM N;  4TV9 A;  4TOI A;  3B2E E;  1TGO A;  3Q4H A;  1FFX B;  1UJW B;  3CE2 A;  2Q0O C;  3JAS A;  5KHI A;  4UVA A;  2HJD A;  4PI2 A;  2CH7 A;  3JD4 A;  2M7W A;  2IH3 C;  2N74 A;  3U11 A;  2X6C A;  3E8B A;  4GKJ B;  2A9H A;  5B1B C;  1K8A W;  4RO2 A;  3SPI A;  4X9Q A;  1OZ0 A;  1L0L H;  3N2G A;  4X1Y A;  1ZLZ A;  2LGW A;  3LNM B;  3ABK B;  3ABU A;  4QE7 A;  1VQ9 V;  1MG1 A;  1VQ8 V;  1BCC H;  1COW G;  4B3T B;  1V54 B;  4XDJ A;  4I0X B;  3ASN C;  1KBH A;  4TV8 A;  4DV5 O;  1FKA O;  4X65 B;  4E29 A;  3FB5 C;  3D36 C;  2GBO A;  3K5N A;  2AXT Z;  4ZM5 A;  1NKD A;  4F6R B;  4JYA O;  2G38 A;  4ASU G;  3A0R A;  3MHH C;  3T4D A;  2R9R B;  4I7Z B;  4J42 A;  4W4L A;  3QO8 A;  1XI1 A;  3P32 A;  4N23 A;  1I94 B;  4GCZ A;  2UXX A;  5BR8 O;  2ZIN A;  3I5D A;  4J41 A;  3FKS G;  4J7Z A;  2XT9 A;  1DK1 A;  2UUB B;  1FJG B;  4YIP A;  3LSQ A;  2P5O A;  4LF5 O;  3MAQ A;  1NQT A;  4I50 A;  2B9Z A;  3U0Z A;  2Q5Z A;  5IWA B;  4OX9 O;  3JAK B;  3RYI A;  2F93 B;  4HNA B;  4KFM A;  3PJS K;  1EFR G;  3HKC B;  4A5U B;  3K0G A;  2PYL A;  3CWB H;  2ZDI A;  4NYK A;  3RYC A;  4JTD B;  3TXS A;  4LFA O;  1H38 A;  5LHG A;  2BOB C;  2EIM B;  3JAT A;  3RYF B;  4ZI7 B;  4MVZ A;  1SKV A;  3B40 A;  4F4L A;  2UUA O;  1S5H C;  2LFR A;  1U96 A;  2JEX A;  2W6J G;  1JCH A;  2WLI B;  4B7E A;  4LF7 B;  4X62 B;  2JGU A;  5LL6 Y;  1Q5O A;  1BHA A;  2HLD G;  1GM8 A;  1OCC C;  3AG3 B;  3CEI A;  3LSS A;  2XUM A;  2P22 C;  1I0H A;  1X59 A;  2K1E A;  4JZG A;  4MVS A;  4H44 B;  2B1G A;  4B3M O;  2JIZ G;  2MW2 B;  2WLJ A;  3JAL B;  2W6I G;  4MTX A;  3N27 A;  4DRX B;  1VQ7 V;  1PPJ H;  1T5E A;  1SQX H;  5B3S C;  1JMK C;  1QVF U;  4BW5 A;  3T1Y B;  1Q6I A;  4QE9 A;  1QHT A;  1NU1 H;  5DM6 V;  4LF8 B;  3DXR A;  3U10 A;  4K8X A;  4BAY A;  3T1H B;  2YS8 A;  3ABL C;  3SYP A;  4X66 B;  3B77 A;  1P7G A;  3JAR B;  1NTK H;  4DUZ O;  1R3L C;  1YEW A;  2Y69 B;  3E8G A;  1OCR B;  4X8A A;  2N04 A;  5LA6 B;  5IJ9 A;  4K0K B;  2VS0 A;  1MNG A;  1MA1 A;  1VQP V;  3QO5 A;  1EZJ A;  3OTF A;  1URF A;  1ENV A;  1Y4M A;  3RT3 C;  1R6T A;  1H2S B;  2LQT A;  3VBB A;  1NT2 B;  2CK3 G;  3CRQ A;  1Q81 W;  2D2C B;  2EIK C;  5IYZ B;  2VWJ A;  3P30 A;  4JF3 A;  2R9I A;  3K9A A;  4H0L B;  4U3J A;  4JI5 B;  3TXQ A;  5EIB D;  2IM9 A;  1E1Q G;  2KQX A;  3CME V;  1K7D A;  2ZE5 A;  1XL4 A;  4ICG A;  1DTO A;  2HP8 A;  2RNB A;  3JAW A;  2QM4 A;  2H3O A;  4L87 A;  2YC0 A;  3BVO A;  2HHH B;  4I4T A;  1RSO B;  5FLX N;  4W4K A;  3FX7 A;  1N36 B;  4BWA A;  2F95 B;  1SQB H;  1Q7Y W;  2UXB B;  1NTM H;  2LGQ A;  3CC4 V;  2QKC A;  2RN9 A;  2DYS B;  5DEC A;  5LGN A;  1SET A;  4DR5 B;  4EB6 A;  1VF6 A;  1OV9 A;  2XAG A;  4B3S B;  4YJ3 B;  3CD6 V;  1O9H A;  3K5L A;  5GTH Z;  1Y6X A;  1Y76 B;  2LW1 A;  3JD1 A;  2PUS A;  4DO2 A;  5LMU B;  3ZRX A;  1K33 A;  3CC7 V;  4GX0 A;  1K97 A;  2QR4 A;  5EYP A;  4QNH B;  1DLB A;  4I9Q A;  1W0K G;  1CEZ A;  2B1I A;  2IU0 A;  5LOV B;  1RPO A;  1ZL8 A;  5LMN O;  5B1B B;  3MHS C;  3OGC C;  5JWP A;  2NN4 A;  3E83 A;  2PZS A;  3IC9 A;  4GT1 A;  4D7S A;  4AQY O;  3ZMU A;  3T2M A;  4FLZ A;  2H8P C;  1RM1 C;  3CJH B;  1JOY A;  4O4J B;  5KMG A;  2WWW A;  1PL0 A;  1N34 B;  4PHZ A;  5L3F A;  4X1I A;  4LH7 A;  5IYC O;  1KD1 W;  5J2T B;  2QGN A;  5B5E Z;  2XTA A;  2GUZ A;  3ASN B;  1FXH A;  4PDV A;  4FMT A;  1AP6 A;  1V9P A;  1HNZ B;  5GON B;  4X1K A;  2FB5 A;  3AG4 C;  3WU2 Z;  1XL6 A;  5KLV H;  3KKY A;  3ML0 A;  4FM0 A;  1F51 A;  4J80 A;  1VQK V;  1ARO P;  2Q69 A;  5KHH A;  4LFB B;  1SRY A;  2AZ0 A;  3A0H Z;  2ARH A;  1F23 A;  4H33 A;  3DC5 A;  4AHC A;  5JVD B;  4PA3 A;  1KP2 A;  1WPX A;  1SQV H;  4MT8 A;  1MSW D;  1SQP H;  1VIB A;  4R50 A;  1IZ3 A;  3FAV A;  3OEH G;  4LF4 O;  4DR3 O;  1P84 F;  3DGE A;  1XRE A;  4UCR A;  2A06 H;  2XAQ A;  4R7C A;  1N0N A;  1I5X A;  4IYI A;  4DR2 O;  2E5L B;  1TUB B;  2IH1 C;  4JV5 B;  3OW2 U;  2WLL A;  5BMV B;  2Q73 A;  3JD0 A;  3AG1 C;  5JJJ B;  3BHP A;  4J9Y B;  4FM2 A;  3JSN A;  4IHJ A;  2FL4 A;  4NXM O;  2JJ1 G;  3TGU H;  3OMA B;  4KHP O;  5C8Y B;  4JI7 B;  4NXN O;  5D5Q A;  1S76 D;  1QLE C;  3CPW U;  1R3I C;  5CB4 B;  4YJ2 B;  4FFB B;  2QWP B;  4NR1 A;  1VQ6 V;  3CXH F;  3CRM A;  1OCC B;  4RUF A;  1HWY A;  2VQF B;  3OGI B;  2YIB A;  4DV7 O;  2IJH A;  4QGP A;  4UXN A;  1VF5 B;  3N2K A;  5LGU A;  1SER A;  1XMO O;  2Q4P A;  2YID A;  3ZN0 A;  3UO2 A;  3RVY A;  2JGD A;  1N32 O;  1PD3 A;  3CX5 F;  5GTI Z;  1D2D A;  2E74 B;  1NBM G;  3HKE B;  4NB5 A;  5B3S B;  5ITZ B;  2GDS A;  4X64 B;  5JH7 A;  3T4Z A;  4ZHQ B;  3L9D A;  3T1C A;  5KHJ A;  1MAB G;  5LXT B;  3ABL B;  4UV8 A;  4DR7 B;  2ZNJ A;  1M93 A;  3CRR A;  4MVO A;  4P30 A;  3QNE A;  3G80 A;  4DV1 O;  4I55 A;  1TAE A;  2XAH A;  2Q8V A;  4WBN B;  2CTR A;  3LNN A;  4RQF A;  4TUY A;  4XDL A;  2BCC H;  3AK2 A;  5F2V O;  1SC5 B;  5DED A;  4FIP C;  4JI6 B;  2EIK B;  1W2B U;  4JYB A;  1HP8 A;  3ZX6 A;  4GLX A;  1FYJ A;  4LFC B;  4JAU A;  4JGS A;  4DR1 B;  1P4R A;  1BHB A;  1S77 D;  2ZIO A;  2ZM6 O;  4JI4 O;  4O4H B;  4AI8 A;  4YXW G;  2GHY A;  2Y0I A;  1EM1 A;  4X89 A;  4FZ1 A;  3TK1 A;  2CTP A;  2AZ2 A;  2EJ7 A;  5IJ0 B;  2KKW A;  4DV4 O;  1BL8 A;  2Z5U A;  1GH6 A;  1H8E G;  3CCE V;  3ZED A;  3D8C A;  1HDJ A;  2LFS A;  1IXM A;  3IGA C;  2ZE8 A;  4PI0 A;  4DV3 O;  3W7W A;  1TVK A;  1JJO A;  4R8C A;  2KG7 A;  4UCT A;  1R1B A;  3RBZ A;  2QWO B;  1VAR A;  4YHH O;  5JJE B;  3BAB A;  3FYI B; 
#chains in the Genus database with same CATH homology
 2UXX A;  1CP9 A;  1YIT V;  2V7Q G;  4H37 A;  3FKS G;  1YJN V;  5CBH A;  3W7T A;  4E2C A;  3LSQ A;  1K73 W;  2XOK G;  5GW7 A;  1Y66 A;  4OXS A;  3FB6 C;  1F4M A;  1NQT A;  5LHH A;  1EBO A;  1N8R W;  3HB3 B;  4MS2 A;  3ASO C;  3SYA A;  1JQ0 A;  3AG2 C;  3ETE A;  1GK9 A;  2EIJ B;  4PA7 A;  4KFM A;  4LP8 A;  1RM1 B;  4HAM A;  3PJS K;  1EFR G;  2FTK A;  2P6J A;  3E8F A;  3K0G A;  1M56 C;  2ZDI A;  5IYB O;  1PNL A;  1W0J G;  4JTD B;  4XBF A;  1SZT A;  4MSW C;  2XAJ A;  1VQN V;  4E2L A;  1H38 A;  2ZR3 A;  4PDM A;  3G6E V;  2DYR C;  3WG7 C;  5LHG A;  2HVJ C;  2BOB C;  2EIM B;  2WPD G;  2Q67 A;  4GX2 A;  1OCZ B;  4MVZ A;  1OCO B;  2JJ2 G;  4F4L A;  4CBC A;  5L3E A;  3CCV V;  2ZXW C;  1S5H C;  3EFF K;  3OMI B;  2LFR A;  2JEX A;  2W6J G;  2WLI B;  1JCH A;  3DTU B;  3E8H A;  1YJ9 V;  2BOC C;  1DF4 A;  3MD0 A;  2WSS G;  2QM8 A;  3K06 A;  4G2K A;  1BHA A;  2HLD G;  1GM8 A;  2V1D A;  3OR7 C;  1OCC C;  4JTC B;  2ZD9 A;  1AJP A;  3AG3 B;  1S72 V;  3LSS A;  5C93 A;  2K1E A;  1YIJ V;  1H2G A;  3E2E A;  2ZDI C;  3AG4 B;  4MVS A;  1AI4 A;  4G27 B;  4PA9 A;  2B1G A;  1RPR A;  3LDD A;  5EBM C;  2JIZ G;  2WLJ A;  4LCU C;  2W6I G;  4MTX A;  1VQ7 V;  2EIJ C;  2XAS A;  3UKM A;  3OM3 B;  1KQS U;  4BIZ A;  1K92 A;  4MVU A;  1MOF A;  1ROP A;  5B3S C;  3ABT A;  1QVF U;  4BW5 A;  5EC1 C;  4QE9 A;  3ETG A;  5DM6 V;  3ZRW A;  5KA6 A;  4JAV A;  3SYO A;  3STL C;  4BAY A;  3STZ C;  2YEV B;  3ABL C;  3CXC U;  1YI2 V;  3SYP A;  3D36 A;  3B77 A;  5B1O A;  5B1A C;  1R3L C;  5CBG A;  3G4S V;  2Y69 B;  3E8G A;  1AI7 A;  1NR7 A;  1OCR B;  3CCR V;  3RVZ A;  3B8O A;  2QE7 G;  2X6B A;  5L3C A;  4X8A A;  3CYO A;  1VQP V;  3QO5 A;  4RQE A;  1EZJ A;  5E1A C;  3CCU V;  3OAA G;  4EKW A;  1ORQ C;  3AG1 B;  1FXV A;  2OCC B;  2DQ3 A;  3E86 A;  4MVQ A;  5L3B A;  1VQ5 V;  1ENV A;  4ZKI A;  4G28 B;  4WFE A;  3F7Y C;  1SES A;  1Y4M A;  3SPC A;  2D3O W;  1KP3 A;  3VBB A;  1M90 W;  4I9W A;  1QLE B;  3FB7 C;  2EIL C;  2CK3 G;  4GX1 A;  4KUM A;  1Q81 W;  3OEE G;  5H6R A;  4PDL A;  2EIK C;  2H94 A;  3OE7 G;  3P30 A;  4JF3 A;  2F43 G;  2R9I A;  3K9A A;  4UV9 A;  3ZMS A;  4P9O A;  1K5S A;  2WLL B;  4LBE C;  4PEL A;  3GWO A;  3I55 V;  1E1Q G;  5BZB A;  4P2Z A;  4WFF A;  3CME V;  1K7D A;  1XL4 A;  3ABK C;  1YSC A;  3X2Q B;  5CBF A;  1R3K C;  5EC2 C;  4TSF G;  3JD2 A;  1DTO A;  5L3D A;  2X0L A;  2PI4 A;  4TT3 G;  1KC8 W;  4L87 A;  1JPX A;  2IW5 A;  2AHZ A;  1V54 C;  2NLJ C;  2EZP A;  2XND G;  1K34 A;  2YSU B;  1NH2 B;  3CCM V;  1M57 B;  2Z3Y A;  1F4N A;  1AJN A;  2P90 A;  1JVM A;  3JCZ A;  3ABM C;  4CZZ A;  2HFE C;  4J9Z B;  2PI5 A;  2EZO A;  4DXW A;  1VQO V;  1Q7Y W;  3CCQ V;  3ZMV A;  1BMF G;  3HPL C;  3CC4 V;  2P67 A;  1FXK B;  4QPJ A;  5B1N A;  2DYS B;  2A0L A;  1Q86 W;  3ZMZ A;  5LGN A;  3K04 A;  1SET A;  5LGT A;  2XAG A;  2WLK A;  3IC7 A;  4WF9 V;  3CD6 V;  1GKF A;  3RW0 A;  4FK5 C;  4DO2 A;  3JD1 A;  2OTL V;  3JYC A;  4Z1M G;  3ZRX A;  2IJI A;  3E35 A;  3ZIA G;  1K33 A;  3CC7 V;  1NVP B;  1K4D C;  1R73 A;  4WFG A;  4GX0 A;  4TWK A;  1K97 A;  3SYC A;  2P7T C;  5IY5 B;  4QNH B;  1VQM V;  1DLB A;  2WLI A;  1E79 G;  1W0K G;  3B8P A;  4GCZ A;  4QJF B;  4X88 A;  1CEZ A;  2B1I A;  2IU0 A;  1RPO A;  1M1K W;  5B1B B;  4MTG A;  3OUF A;  1KKD A;  3MHS C;  2QA4 V;  4E2H A;  3E89 A;  5H9C A;  3OGC C;  3E83 A;  5KUM A;  5HFM A;  4GT1 A;  1QR8 A;  3FYE B;  3VOU A;  1JJ2 U;  2DW4 A;  3ZMU A;  3T2M A;  1RM1 C;  2H8P C;  3BY6 A;  1JOY A;  3ZMT A;  2HJF C;  1K9M W;  2WWW A;  4UUJ C;  2JEU A;  4WFA V;  3R65 A;  1PL0 A;  1AI6 A;  3SPJ A;  1TUE B;  4U7N A;  2EIN B;  3LDC A;  2EIM C;  2JK5 C;  1GM9 A;  5L3F A;  1OCZ C;  1I5Y A;  1OCO C;  3K0D A;  4QPK A;  5IYC O;  1KD1 W;  3OR6 C;  4P9P A;  3ZRW B;  1YTF D;  2UXN A;  1B6Q A;  4BIU A;  3M99 B;  3ASN B;  1FXH A;  1V55 B;  1P7B A;  2HG5 C;  1KEC A;  4PDV A;  1LNQ A;  4FMT A;  2NNU A;  2IU3 A;  3QO7 A;  2YEV A;  3KG2 A;  2OTJ V;  3AG3 C;  2ATK C;  1QVG U;  1AR1 B;  3W7X A;  1THZ A;  3AG4 C;  1XL6 A;  1J95 A;  3CC2 V;  1K5Q A;  3ML0 A;  1F51 A;  1VQK V;  1ARO P;  1YHQ V;  2JDI G;  3K3W A;  1NR1 A;  2Q69 A;  1S3J A;  3CCS V;  1SRY A;  1F23 A;  5J9P C;  1K3E A;  2B5U A;  2DQ0 A;  4H33 A;  5LHI A;  2WLH A;  2XAF A;  4PA3 A;  1KP2 A;  3ZN1 A;  3EHB B;  1WPX A;  2ITD C;  1GTO A;  4MT8 A;  1MSW D;  1Q82 W;  2DWD C;  2W0F C;  3W7S A;  4R50 A;  2QTO A;  2AHY A;  4LC1 A;  5EK0 A;  2QM7 A;  3OEH G;  3ZRS A;  1R6N A;  3ASO B;  2Y69 C;  2HR3 A;  1R3J C;  2WLM A;  1OCR C;  3DGE A;  3CMA V;  4WFB V;  2XAQ A;  4R7C A;  5H6Q A;  1I5X A;  3AG2 B;  4WFH A;  1GMG A;  1JX9 A;  2IH1 C;  4XDK A;  1PNM A;  3OW2 U;  1M56 B;  1OHH G;  2WLL A;  3JD0 A;  2QKS A;  3AG1 C;  3WFV A;  2Q68 A;  2OCC C;  1WLE A;  1DF5 A;  1FS0 G;  2Q6A A;  3NXS A;  1PKX A;  4J9Y B;  3SJQ C;  2DYR B;  4U7O A;  3WG7 B;  1QLN A;  4I5S A;  2GSM B;  2DWE C;  2JJ1 G;  3TET A;  4FPP A;  3OMA B;  2ZXW B;  4PA4 A;  1S76 D;  1QR9 A;  1QLE C;  3CPW U;  1R3I C;  2Y48 A;  4KP4 A;  3CP1 A;  4PA6 A;  5CN0 A;  1VQL V;  1VQ6 V;  3IFX A;  1OCC B;  4RUF A;  1GM7 A;  1GO3 F;  1HWY A;  3OMN B;  5FL7 G;  5KA5 A;  5KUK A;  1AI5 A;  4MVM A;  4R6Z A;  2IJH A;  4UXN A;  3TCU A;  2EJR A;  5LGU A;  1SER A;  1CPY A;  3OUS A;  3AEI A;  3ZN0 A;  1G8M A;  3F7V C;  3RVY A;  3I56 V;  2ZQM A;  1PD3 A;  3GB7 C;  3X2Q C;  5HFL A;  2WAM A;  1FXK A;  1NBM G;  4JYC A;  5IDJ A;  5B3S B;  4RAI A;  1K4C C;  3T4Z A;  2QEX V;  3F5W C;  3LDE A;  3ETD A;  4MVR A;  4JPR A;  3D3I A;  3T1C A;  1YTF B;  3LUT B;  4MW8 A;  4PDR A;  4FJC C;  1MAB G;  3FB8 C;  3ABL B;  1M9N A;  4UV8 A;  3B8M A;  1M57 C;  2A79 B;  5B1A B;  3K79 A;  2HVK C;  1NJI W;  1H8H G;  4JTA B;  2LP7 A;  5L3G A;  4MVO A;  1NH2 D;  4P30 A;  1S0V A;  3JD3 A;  4RUE A;  2X6A A;  3QNE A;  1PNK A;  2HKO A;  4GX5 A;  1FXK C;  2MK3 A;  5LBQ A;  2X7R B;  2DYS C;  2XAH A;  4ZBM A;  4N21 A;  4QIW F;  2ITC C;  4RQF A;  3CCL V;  4HYO A;  1UJW B;  4XDL A;  2OT5 A;  4WCE V;  3G71 V;  3BEH A;  4ZM1 A;  4UVA A;  1VQ4 V;  3SYQ A;  2EIL B;  3JD4 A;  2M7W A;  2IH3 C;  4FIP C;  4JAS A;  5IYD O;  1QBZ A;  1YJW V;  3CCJ V;  2EIK B;  1W2B U;  2X6C A;  5IY5 C;  4JYB A;  3ZCC A;  1NVP D;  1G4Y B;  5EBL C;  5EBW C;  3SPG A;  3E8B A;  3OFN G;  4JAU A;  2A9H A;  4JGS A;  4UVB A;  5B1B C;  1P4R A;  1K8A W;  1BHB A;  4RO2 A;  1S77 D;  3SPI A;  4HZ3 A;  1OZ0 A;  4YXW G;  2GHY A;  3K03 A;  5DN6 G;  3ZJZ A;  4MW3 A;  3LNM B;  3UM7 A;  5CA3 A;  3ABU A;  2IJK A;  2WLN A;  3ABK B;  4QE7 A;  1VQ9 V;  1MG1 A;  1VQ8 V;  1COW G;  3B8N A;  2EIN C;  4X89 A;  1R6K A;  3K08 A;  3TK1 A;  2IJJ A;  2EBO A;  1V54 B;  4XDJ A;  1BL8 A;  4Q20 A;  2Z5U A;  3ASN C;  3W7U A;  1V55 C;  2KB1 A;  1H8E G;  3CCE V;  4MTO A;  4E29 A;  3FB5 C;  2LFS A;  4UVC A;  1IXM A;  3IGA C;  3H01 A;  3ZRV A;  1L1F A;  1QCE A;  3ABM B;  3W7W A;  4ZM5 A;  1FFT B;  1AJQ A;  4R8C A;  1NKD A;  4MTF A;  3SPH A;  4ASU G;  3A0R A;  3MHH C;  3RBZ A;  3T4D A;  2R9R B;  2C2A A;  3QO8 A;  1E1R G;  2ZR2 A;  3P32 A;  4N23 A;  3FYI B;  1ZWI C;  5CMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...