3B8MA

Structure of fepe- bacterial polysaccharide co-polymerase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
255
Chain Sequence
KWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Ferric enterobactin (Enterochelin) transport
publication title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 255
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b8mA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 3b8mA01
3MHHC 1SZTA 3WFVA 4FJCC 1Y66A 1QR8A 2X7RB 5HFLA 4ZM1A 1MG1A 4FIPC 1I5XA 2LP7A 1QR9A 1K34A 2P6JA 4N23A 5CMUA 5H9CA 3CP1A 3MHSC 2MK3A 1EBOA 3B8MA 2M7WA 4JGSA 2EBOA 4JPRA 3H01A 4N21A 1Y4MA 1DF5A 2OT5A 3CYOA 1MOFA 4E2LA 5HFMA 1K33A 4E2HA 1QBZA 1JPXA 3B77A 2EZPA 3P30A 3B8PA 1DLBA 1I5YA 4E2CA 1QCEA 2EZOA 1ENVA 4JF3A 5KA6A 3B8OA 4ZM5A 4E29A 3B8NA 3GWOA 1JQ0A 5CN0A 4G2KA 5KA5A 1DF4A 3K9AA 1F23A 4FK5C 3M99B
chains in the Genus database with same CATH superfamily
3K79A 2YS8A 1N36O 1ZTEA 4OX9B 1N0NA 1FXKB 2K9PA 3G67A 1OCRB 3NR7A 3G6BA 5IYBO 4MVOA 4LH7A 1SESA 4PELA 4FVMA 4NVPA 3E8BA 3N2GB 3RT3C 5GTIZ 4JI6B 4J42A 4TUYA 4O2BA 3UO3A 1XBLA 1S0VA 5HFLA 5DEDA 4B7KA 1ZSPA 1J5EO 3SPHA 4YIPA 1OV9A 3CXHF 3ZMSA 5DN6G 2ZKOA 5CA1A 1SERA 3ICXA 1GKFA 3JARA 1V54C 2GSMB 3CX5F 4KHPO 2UU9B 3BA9A 5JQGA 2EZPA 3ZRWA 5AG2A 4WFEA 4YJ2B 1HP8A 5CN0A 2QKSA 4FK5C 4G27B 4F6RA 3ZBHA 5E79Z 5LYJA 1H2NA 4ZBMA 1KECA 3RYCA 3CRMA 1PNLA 4R8CA 2QWQB 3JAMN 3QTCA 2WLLA 2DWDC 5H5NA 3J80N 4WFGA 2GUZB 5B1BC 1AJNA 2R72A 3VOUA 1B6QA 2P22C 3D3QA 4H13B 2WLIB 2Y0PA 5CBGA 5IYCO 2XAQA 1M9NA 2OCCC 3E8FA 3HKEB 3OUSA 1I5YA 1H2MA 2ADQB 4OGQB 4PDLA 1YDXA 1WPXA 1XMQB 1Q43A 4D7TA 4B3MB 5H6RA 4RUFA 5LHHA 1DTOA 1P7GA 1VQKV 4RO2A 4NYKA 3AG1B 2KG7B 5B1AB 4IIJB 4O2AB 1XOUA 3DXRB 4U3FH 4FM1A 2E76B 3CXCU 1T5EA 4D6TH 5C93A 5IYZB 2HHHB 3VQYA 4QPJA 2UU9O 1I08A 1WNSA 4N21A 5JJEB 4MT8A 1W2BU 1S5HC 4W4LA 5KHIA 2DJVA 3G71V 4KL1A 4A5UB 5JJJB 4X1IA 1ZWIC 4I9QA 2UUAB 5KMGB 3QG5A 2OIEA 5CBHA 1YITV 5J2TA 3N27A 3B2EE 1JJOA 4GZRB 5KUMA 4MTXA 3WB1A 2A7WA 3AK2A 5C8YA 3L71H 3SGIA 1VQLV 3TJTA 3T4DA 4EEQA 2LW7A 3CS5A 3K5MA 4JYCA 1W0JG 1MSWD 2BTQB 4LCUC 4H33A 1MNGA 1PNMA 2Y69C 3CCMV 5BXZA 4MVUA 1SQGA 2EIJC 2ZNIA 3HKDB 3RVYA 5EZYA 1PP9H 2JGUA 3STLC 5K1PA 2Q68A 2QKAA 2MK3A 1XMQO 1LNQA 1FXKA 3E83A 2F66C 3P30A 3JYCA 4HBNA 3B8PA 2Q6AA 4G2KA 3ASOB 3ZRVA 2HKOA 3K9AA 1NBMG 3N2GA 1FXHA 4BW9A 4GX5A 2QE7G 3AG4B 5K1XA 5KUKA 1I5XA 3K5LA 3SJQC 3ASNB 4JTCB 3D36C 3DSQA 1R1BA 1BQZA 2V4DA 2HHHO 3OD4A 1PKXA 1NTMH 4X65B 2XT9A 5J2UA 3CD6V 1ZLZA 2EINC 3D8CA 1XILA 4YJ2A 3CMEV 1FS0G 5LHIA 2QTSA 3RYFB 4JI7O 2UUAO 2PF4E 1Q6UA 1YHQV 1R6KA 2XHBA 2JEUA 1SA0B 4FZ1A 4MW8A 1SQXH 1FFXA 2BE3A 4E4EA 1SF9A 4X88A 4JI8B 1VQPV 5JH7B 1MA1A 5JWPA 4PJ0Z 1H8HG 3SJBC 5KHKA 3OTFA 4NXMO 3S3WA 1F4NA 3PJSK 2GUZA 3T1YB 4P9OA 1WLEA 2ZDIC 2CH7B 2X0LA 1BQ0A 2PYJA 4JASA 3SDLA 1XMOB 1MMMA 3I55V 3O65A 2WLIA 3KKYA 3VBBA 1KMIZ 3WG7C 5LHGA 4DV7B 3HKEA 1IXBA 4UV8A 3JD2A 4L87A 1IX9A 4GLXA 4LP8A 2IH3C 2CK3G 2JVDA 3G80A 4JYBA 3J81N 4TV9B 1GN3A 1PL4A 4FM0A 4I55B 2KG7A 4Z2WA 2OTJV 4NTWA 5KHJA 4IIJA 4O2AA 2B5UA 3DXRA 3QNEA 5BY1A 2IH1C 1F7YA 1OCOC 4ZHQB 5IYZA 3S3XA 2DE0X 1N0JA 3ZJZA 4X65O 1VQ7V 2VQFO 1V54B 4WFFA 4BWAA 4NXNB 3H1IH 3ZMTA 4LFBB 4MVQA 5KLVH 4JV5B 1TUEB 2OIGA 4DR6B 2VS0A 2JRIA 5CA0A 4BIUA 4LF6B 4PDMA 5KMGA 4UB8Z 4UVAA 3FAVB 4GX1A 5KHHA 4IYHA 4DR3B 4JI8O 2M7WA 3CMAV 4FLVA 3HKBB 2Q67A 4B7EA 2CUGA 3SYCA 4FLXA 1EZJA 2QWPB 4KXRA 2A79B 1M56C 5LGUA 4QIWF 3T1YO 5LMUB 4UB6Z 1GH6A 5B1BB 4B3TB 2BTQA 1DF4A 4I9WA 1XMOO 1YTFB 1SQVH 2IJJA 3HKDA 1U96A 5H9CA 3LNMB 4CH5A 4DV7O 5IYDO 4LF4O 4LF7B 4X9QA 2CTWA 2OCCB 2FYUH 4PA3A 1JPXA 3B77A 1OZ0A 4I4TB 4J7JA 4O2BB 4MVZA 1IZ3A 3E89A 4XBFA 4DR2B 2JJ2G 2ZIMA 2QWOB 5KA5A 1HNWB 3QO8A 4DV5B 3SPGA 2O57A 3LSUA 2W0FC 1I94B 3K0DA 2C2AA 2EIKC 2ILMA 2QM7A 2UXDB 1K9MW 3KG2A 4FFBB 2JS3A 3M7MX 4MVSA 3K5OA 4GKKO 5E1AC 4O4HB 4FLYA 4JF3A 1Y76B 2ZE7A 4UCRA 2N74A 3CC4V 4FMTA 4XDJA 4NXNO 1GN6A 4LFBO 1JFFA 1BSMA 3VQVA 4DV3B 4JV5O 5EC1C 4NTYA 3ZHRA 5EK0A 4DR6O 3SYOA 3E2EA 4LF6O 1W59A 3OE7G 1DK1A 3FB5C 1XQ8A 3RYHB 1SA0A 4X62B 3DTUB 1YI2V 3K04A 4L8JA 4CS4A 2EULA 4LR3A 5JH7A 4PA7A 2E3CA 2F95B 3A0BZ 1IXMA 4HAMA 5LMUO 2HEPA 1AP5A 2WWWA 4B3TO 2FB5A 4WF9V 3C90A 3EVKA 3P3PA 1N36B 2LQTA 2OYQA 1JA8A 1S3JA 5F2VO 4PDVA 1US6A 4MVMA 2Y69B 3CCLV 3HB3B 1KKCA 2EIJB 3A2FA 3ZHSA 2JGDB 5IT9N 3APQA 2P7TC 4LF7O 4FM2A 1OHHG 3L73H 4JI4B 3CCUV 3HPLC 4ZOLB 1QR9A 3E35A 2EJRA 3H1HH 4DR2O 5IE9A 4J7KA 1HNWO 4JZGA 4X89A 3ASNC 1MOFA 1I94O 1YSCA 3GVMA 1XREA 3ZRXA 4TV9A 3UM7A 1HW7A 2UXDO 4I55A 2DMXA 4RQFA 1YJWV 1OCCC 1SZTA 2RNBA 4KHPB 5JCOC 2F23A 4JYAO 4ZHQA 4PA9A 4R50A 1VF7A 3CHXA 1WP8A 2BCCH 1YTFD 3J7AU 2EINB 2CTPA 5J2TB 3H1KH 1E1QG 1N8RW 1QU7A 3FD9A 3CPWU 1S72V 5C8YB 4X62O 2JS5A 1FFTB 3FAVA 2OTLV 1XNRO 2V7QG 3HKBA 1PNKA 2K1EA 3L74H 1Q6IA 1D2DA 1JQ0A 1L0LH 5B1OA 3ZN0A 3SR2C 1TUBB 2YUAA 4JTDB 1WPBA 1Q81W 1N33O 4Q20A 3K58A 2IW5A 5EIBC 4LF8B 1VEWA 3WB2A 3FX7A 3WG7B 3IC7A 4W4KA 2EIMC 2NR5A 5CBFA 3BFRA 4JI4O 3K57A 3JCZA 3CWBH 4OPHA 3G6EV 4I4TA 3AK3A 1F23A 2KSDA 4H44B 3ZHUA 2QR4A 3TETA 4JI5O 3KZIZ 2Y48A 3LNNA 1BMFG 4PA6A 1JR9A 1G6UA 4FFBA 3ZMUA 2H8PC 3SYPA 1DLBA 2DQ0A 5J2UB 4J9YB 3ZHQA 2N04A 4O4HA 3UT5B 1OCOB 3AG2C 3MAQA 2YDEA 1Y76A 1X59A 1Q8IA 1NTKH 2Q7HA 3E86A 3ABMC 1GM8A 4H37A 4YXWG 2FL4A 3OFNG 4LFAO 3LUTB 1A32A 2Q0OC 1FFXB 1IBMO 4I50B 1M5IA 1HWYA 4ZIBA 5H6QA 3N2KB 3RYHA 2CTRA 3IGAC 3CCJV 4MS2A 5IDJA 4X1YA 2AXTZ 3BHPA 3H01A 4AHCA 1M56B 1K8AW 1SRYA 1ZX3A 2F4VB 5H2FZ 5D5QA 4PI0A 1NI8A 1QVGU 4DR4O 2WPDG 3B8OA 2A3QA 2X6BA 3SPIA 4LF8O 2LGWA 2CDYA 2H3OA 3TXQA 1KP2A 2JGDA 3CCQV 2KKWA 4J7ZA 3ETGA 2DWEC 4ZOLA 5JVDB 3CRQA 5FNVA 5DM6V 4GT1A 4K35A 1BS3A 1VQ4V 2ZINA 3GWKC 2YXHA 5EYPB 3ZMVA 2AZ2A 4LF9O 3C3SA 2EIKB 2DOSA 1IVSA 1WA8A 1KD1W 2EJ7A 4AQYB 4LWSB 3D36A 4JI3B 3OM3B 4J80A 5A2QN 5CA0B 4JI7B 5EC2C 2OWOA 3QO7A 3W7SA 2ZR2A 2ZE8A 2MW2B 4I0XB 1NZ6A 3HR0A 3APOA 3SJCC 2D2CB 5KX5B 3I56V 4FIPC 1W0KG 1YZBA 3SPJA 1RPOA 3LSQA 3CSXA 4AILC 1V55C 4NXMB 3B09A 3ZX6A 4CH6A 1H2GA 1O9HA 3K03A 3I5DA 3ZRSA 2A06H 1B3QA 2IJIA 1HNXB 4EKWA 1Y74B 2F4VO 2GDSA 4TWKA 1TUBA 2ZDIA 1H8EG 1NH2B 1XL4A 1R3LC 3L70H 3BAAA 2P4KA 2YIBD 3KCXA 2NN4A 5FPOA 3M99B 4Z1VA 2VWJA 2DYSC 3X2QC 3CE2A 1GMGA 1P7BA 1Z5VA 1KP3A 4CC5A 1WJZA 1NVPB 3L75H 2Q5ZA 1S5LZ 4AQYO 3T4ZA 3A8TA 2VQFB 2YEVB 1OCCB 4JI3O 1WN7A 1JX9A 1QLNA 1MABG 1JFFB 3RBZA 1AB3A 3UT5A 4K0KB 1S5JA 2YIAA 1M93A 2G38A 2CGOA 4TOIA 2ETNA 2XNDG 3CP1A 1KB9F 2EBOA 4PA4A 4DW1A 3C3TA 5IJ0B 3CYOA 4GCZA 3K3WA 1VF6C 4IT5A 4KP4A 2PI4A 1URFA 4I50A 4DV2B 2NNUA 3N2KA 2AZ0A 1H2KA 1GN4A 4UCUA 1VIBA 4TQDA 5ITZA 4LF5B 1U97A 1HNXO 5EBWC 2Q9LA 2JK5C 4IHJB 1VQ8V 1RM1C 4GYCB 4MW3A 4LF4B 4NTXA 1Q82W 1Q6HA 3TK1A 5L3DA 1WAZA 2QWRB 4N23A 2AHZA 4DV0O 3ABTA 2PY5A 2EIMB 3U0ZA 2IU0A 2Z0AA 4X20B 1HDJA 3THOA 4O4LB 1BZKA 2R9AA 5JVDA 3LDEA 3FB7C 1ORQC 1SQFA 2ADPA 4JAVA 2QA4V 4KUMA 1ZUQA 4GKKB 1RPRA 5EYPA 2Q7GA 4X66O 4LFCO 1D5AA 3LSSA 2PGGA 4LWSA 2OCHA 2CTQA 1K5SA 4K0KO 2XAJA 1QCEA 1P4RA 4EFEA 4X64B 4HZ3A 4DUYO 3AG2B 4DW0A 3W7XA 2WLMA 4MTGA 2WLJA 2LFSA 4DUZO 4ASUG 3ABMB 1NH2D 1G4YB 4I0XA 4GX0A 2B1GA 3OMAB 1VQ9V 2YXYA 1CEZA 4WFBV 1E1RG 5KX5A 2HFEC 1Q3EA 4DV2O 2RDCA 1F4MA 4BR6A 1R6NA 1M90W 4QE9A 2YI9A 2ZCEA 4LF5O 4PDRA 2P06A 2ODMA 3UQ8A 4RAIA 1GAXA 1HR0B 1Y74A 1NVPD 1R3JC 4D7SA 1EBOA 2YXLA 1XHXA 1NTZH 4LH6A 3OEHG 3W7TA 5LL6Y 1N34O 2XAFA 3ZN1A 3DGEA 2IU3A 4DV1B 1NR7A 4BIZA 3FFQA 1R3IC 4B3SB 4J41A 1XNQB 2H94A 4UUJC 2P5OA 2XOKG 3JSLA 5KAIZ 1AI4A 1SQBH 3QO5A 4IYIA 3RVZA 4CBCA 1IBLB 2PZSA 5LXTB 1TAEA 5L3CA 5LP6C 5LGTA 2ZIOA 3TCUA 2PUSA 3ABLC 2F1MA 2Q8VA 2W0XA 1BGYH 1KU9A 5KA6A 1FD9A 1LUWA 3B8NA 4JYAB 2E74B 1NS1A 4U3JB 4O4IA 3DC5A 2YEVA 4IGGA 4WCEV 4J11A 3FB8C 5JCOA 2P6JA 4X64O 2HP8A 1H2LA 4WFHA 5IJ0A 4GKJO 3K5NA 2N05A 4NB5A 5EIBD 3GB7C 1JMKC 1CXZB 4JI1B 5IJ9B 3R65A 3OT7A 4X1YB 2HJFC 4PHZA 1XNRB 3H9VA 4DR7O 2QKCA 1B06A 2YI8A 5CA3A 1K73W 1ZAUA 3OTOO 1V55B 3B8MA 4JTAB 1CP9A 1KC8W 2XAGA 5LGNA 1YIJV 4AI8A 4FZ0A 3JAKB 2QTOA 4P9PA 5LA6B 5DECA 3RW0A 4UCVA 1HR0O 3JATA 2X6CA 1N33B 4IHJA 4J10A 2DW4A 4FLUA 1I0HA 3TGUH 5KAFZ 2ARHA 2GHYA 4DV1O 4B3SO 1XNQO 3JALA 2LO1A 4CH4A 2WA4A 3B4SA 2BOBC 5GONB 5FNVB 2WLNA 2ZE5A 4JI5B 3K06A 4OXSA 4X20A 1IBLO 4NR1A 4O4LA 1R6TA 3OAAG 3K59A 2WLHA 1XI1A 5IY5B 1KUQA 3K08A 1FXVA 1AROP 4HNAB 3OGCC 1P49A 2DYSB 1WA8B 3X2QB 1GTOA 4QGPA 3B40A 5IWAB 2JDIG 2FMLA 3MDSA 2KQXA 1SQPH 5LMNO 1XL6A 2QDOA 2RQ6A 4UVCA 3STZC 1GM9A 2W6JG 3CRCA 3MD0A 1UFIA 1Y67A 4JAUA 4LFAB 1JOYA 3RGBA 1IBMB 4FLWA 1B04A 2P90A 2UUBB 3ZHVA 4MVRA 4TT3G 4JI1O 4BAYA 1Z5WA 5FL7G 3G4SV 4IL6Z 4KFMA 4FLZA 1NR1A 1Q5OA 4TSFG 1RP3B 2XAHA 3JD3A 4K3AA 2Q73A 2BTOA 3ZHTA 2DN9A 4O4JB 4DR4B 2DYRC 3H1JH 4XDKA 3Q4HB 2XTAA 4PI2A 1QHTA 4UV9A 1VQMV 3IAYA 1RM1B 4DK0A 1YEWA 1OCZC 4DXWA 3ABKC 2R70A 5FLXN 2UXBO 1SS3A 2E75B 1ROPA 3ETEA 1M1KW 3HKCB 1QNMA 2HR3A 4FPPA 2WAMA 3OR6C 4JI0B 3JCUZ 2GBOA 4UCSA 2QEXV 5BZBA 5LXTA 4LF9B 5L3GA 1AJQA 1K33A 4GX2A 1R3KC 5IWAO 3EHBB 3EXAA 3GWOA 3P3NA 1XHZA 4I5SA 1PPJH 1KBHA 4U3JA 1I7FA 2XASA 4DV6O 4DR5B 3AEIA 1L0NH 2B9ZA 1YJ9V 4JZ2A 1IURA 3JD0A 3BPZA 4RQEA 3CJHB 1MZFA 2UUBO 2UXCB 3K0GA 3PN1A 1M4UA 5B3SB 2HJDA 1VARA 2ZT9B 5IJ9A 5ITZB 1KQSU 3BRCA 1VQOV 1TGOA 3JAWA 3E8GA 1UPGA 2Q69A 4JYYA 3OEEG 2Z3YA 3JAKA 3UCSC 1JCHA 1M57C 3AK1A 5LA6A 1RSOB 1H2SB 1FJGB 3F7VC 4J9ZB 2UXXA 4YIOA 3A0HZ 3JD1A 1Y66A 4X8AA 1TA8A 2CGNA 1GK9A 1RFYA 5CMUA 1IBKO 4JPRA 1H38A 4MTFA 4UCTA 1EZVH 1EM1A 1VMGA 1Q7YW 2HVKC 5GONA 1YXBA 3OUFA 5D5PA 2RN9A 4OX9O 2EZOA 1EN4A 3KCYA 4B3RB 1HNZB 1AP6A 3RN4A 4JI0O 5TISZ 5B1NA 2PTMA 4X1KB 4EFBA 4WFAV 4HNAA 4QPKA 2D3OW 4ZM1A 3T1HB 5LP6B 2RJZA 3BEHA 4JI6O 3ABLB 2LFRA 4JI2B 4DR1B 1G1XB 1COWG 3IFXA 2P4VA 1PM9A 4Q6GA 1AJPA 1V9PA 4DR5O 2YICA 4K8ZA 1GRJA 2CAZC 4C7UA 3E22B 3MHSC 1L8DA 3NXSA 4FFKA 2GV9A 1QR8A 2FTKA 3TXSA 4DYLA 5BR8B 2GTAA 5EBMC 3ZCCA 2LGQA 3ZIAG 2UXCO 3E8HA 3CCSV 1BL8A 1VF6A 4RWUA 3DC6A 4YHHB 2IJKA 3OGIB 1NJIW 1UJWB 1TVKA 3U10A 3UKMA 3M8AA 2E5LB 4CZZA 1ZL8B 1Z2GA 2IJHA 4O4JA 1FJGO 4P2ZA 4K8XA 4H0LB 4E2LA 3Q4HA 1QBZA 1N32B 1EFRG 1E79G 1QLEC 4UXNA 1D5NA 2JJ1G 5CB4B 4DV0B 2GTSA 1S77D 3BVOA 1WB8A 4JAAA 3H1LH 3CB2A 5IY5C 2FKXA 2QWNB 1OJHA 3AG3C 1MG1A 3HKCA 4B3RO 1HNZO 4NKGB 2WLKA 1Y4MA 3SYQA 4B3MO 1IDSA 4UFZA 5B5EZ 4X66B 4O4IB 4LFCB 3T1HO 4UCOA 4DK1A 2QGNA 2ZD9A 4JI2O 4DR1O 3JASB 5L3BA 1YCIA 5B66Z 1LUVA 3OMIB 4ZI7B 1AILA 4GUNA 1AI7A 3VQWA 4DUYB 2V1DA 2YIBA 1Y6XA 4PV1B 4CS2A 4DUZB 2BOCC 2JEXA 4EB6B 2BSKB 5BR8O 1NQTA 2A0LA 1SQQH 3CJHA 3BY6A 4DV4B 5EBLC 1XUQA 4YHHO 2Y4UA 5LOVB 4JGSA 3SPCA 1JJ2U 4BW5A 5KHGA 2A9HA 2E5LO 3QVNA 3IC9A 1BT8A 2NLJC 2JIZG 3JATB 3F7YC 1QVFU 3WB0A 2UXNA 4ZM5A 4BIOA 4DO2A 1N34B 2ZXWC 4F4LA 3WU2Z 1RSOA 2EILC 3CCEV 2DYRB 3JALB 1N32O 2AGAA 1XEQA 3VQXA 4CS3A 1F51A 1OCZB 4LC1A 1FXKC 1K92A 1OCRC 3ABKB 2PYLA 2PI5A 4MSWC 3CRAA 3SYAA 1PL0A 3RFRA 2WSSG 1AR4A 3P32A 3ZEDA 2ZQMA 1PV0A 3WFVA 5BMVB 1SETA 4WBNB 3BA8A 4X1KA 1VQ6V 3RYIB 1KKDA 4LNUB 5LP6A 1PD3A 3CC7V 1XDCA 1FKAO 3L9DA 4G28B 3O9OA 2YC0A 1R73A 3FYIB 4PD4F 3CCVV 3T2MA 1BCCH 1N4CA 5L3EA 1THZA 2ZR3A 2VQEB 3E22A 1J95A 4R6ZA 4GKJB 1P84F 4XDLA 5B3SC 1SKVA 1YJNV 1Q86W 3SJAC 1BE3H 4CH3A 1VP7A 4DR7B 1DGSA 3CCRV 4DV4O 3W7UA 2B1IA 2DQ3A 2YSUB 3OTOB 3ZS8C 1FAFA 3T1CA 1SZXA 1K97A 1K4CC 4YJ3B 1ZL8A 2ZNJA 4TV8B 3K9SA 2Q4PA 2R9IA 1EN5A 1GM7A 5HFMA 4DRXB 1M57B 2HG5C 1ENVA 1L1FA 1DF5A 2W6IG 5CB4A 2L6LA 4Z1MG 1CPYA 3ML0A 5GTHZ 3U11A 1O9GA 3ETQA 2LP7A 4ICGA 4QJFB 3IJ4A 2ZM6B 1K5QA 2L35A 4HYOA 1K3EA 4TUYB 3AG1C 5B1AC 3LDDA 1BHAA 5LMNB 4E29A 1MSDA 3A0RA 3AG7A 3JASA 1GO3F 2UUCB 5CA1B 1KYOF 1AR1B 4ZI7A 3JARB 1QQCA 5J9PC 5JJNB 2Q7EA 1YF2A 2VWKA 2OT5A 5JQGB 4I7ZB 1VQ5V 3ZRWB 2VQEO 5L3FA 2Y0IA 4FLTA 3OMNB 3FYEB 2AW9A 4E2CA 3OW2U 2Y4TA 4F6RB 1S76D 4EB6A 2BSKA 2Z5UA 5LYJB 3F5TA 3MHHC 2RMKB 2IM9A 4B08A 3JAWB 3RYCB 2ITCC 1WB7A 4YY3B 4OPAA 3RYFA 2WLLB 2HLDG 5LOVA 1WP7A 2LW1A 1VF5B 4DR3O 3CEIA 2QM4A 1AR5A 2CE4A 1EN6A 2R9RB 2IBZH 3R66A 1JVMA 1GN2A 1YVWA 3JD4A 4LBEC 1AVMA 1AI5A 2CH7A 4U7OA 3BCCH 4RUEA 3CC2V 4U7NA 3ZMZA 3W7WA 1QLEB 2UXBB 4E2HA 1K4DC 4TQFA 2F43G 2ITDC 4ZKIA 3D3IA 4R7CA 2YIDA 2ZM6O 2M6YA 2ATKC 1LR1A 3AG3B 3ASOC 3JSNA 4FJCC 2X7RB 4CC6A 2KB1A 2X6AA 1BHBA 5BMVA 3AG4C 3QF7A 4WBNA 4DV5O 2EX3A 1SC5B 3RYIA 2QM8A 4LNUA 2VRZA 3CRRA 4QNHB 4DV6B 1J5EB 2RCVA 3BABA 2HVJC 2UUCO 2F93B 1NT2B 2LJ2A 4F6EA 2QJ1A 3LDCA 1MZEA 3FKSG 4X1IB 3FB6C 1VQNV 3F5WC 3RWRD 4QE7A 1FPOA 1TVKB 4DV3O 2ZE6A 2XUMA 1FYJA 1Q90D 2QSAA 5A9GA 4YY3O 1G8MA 2WA3A 1X4TA 1K34A 3ETDA 2AHYA 4UVBA 3ABUA 4YJ3A 1K7DA 5FPRA 4ABMA 2P67A 4P30A 3L72H 1NKDA 4MTOA 4TV8A 3OR7C 1NU1H 1AI6A 4DRXA 2Q0AA 3EFFK 2ZXWB 1IBKB 3UO2A 5LBQA 2EILB 5GW7A 5EZYB
chains in the Genus database with same CATH topology
3K79A 3CC4V 4FMTA 1Q82W 4XDJA 3NXSA 3TK1A 5L3DA 1QR8A 2FTKA 5EC1C 5EBMC 4N23A 2AHZA 3ZCCA 5EK0A 3ABTA 3SYOA 1FXKB 3ZIAG 2EIMB 1OCRB 5IYBO 3E2EA 3E8HA 4MVOA 2IU0A 1SESA 1BL8A 3CCSV 4PELA 3OE7G 3FB5C 2IJKA 3LDEA 1NJIW 3FB7C 1UJWB 1ORQC 3E8BA 3UKMA 3DTUB 4JAVA 1YI2V 3K04A 4CZZA 2QA4V 4KUMA 4PA7A 1S0VA 1RPRA 5HFLA 1IXMA 4HAMA 2IJHA 3SPHA 2WWWA 3LSSA 3ZMSA 5DN6G 4P2ZA 4WF9V 1SERA 1GKFA 1V54C 4E2LA 1QBZA 2GSMB 1K5SA 1EFRG 1E79G 1S3JA 2EZPA 1QLEC 4UXNA 4PDVA 2XAJA 3ZRWA 1QCEA 1P4RA 2JJ1G 2Y69B 4MVMA 4HZ3A 3HB3B 3CCLV 3AG2B 2EIJB 4WFEA 1S77D 5CN0A 2QKSA 3W7XA 2WLMA 4MTGA 4FK5C 2P7TC 4G27B 2WLJA 2LFSA 5IY5C 4ASUG 3ABMB 1OHHG 1NH2D 1G4YB 3CCUV 3AG3C 2B1GA 1MG1A 3HPLC 3OMAB 4GX0A 1VQ9V 1QR9A 3E35A 2EJRA 4ZBMA 1CEZA 1KECA 4WFBV 1E1RG 2HFEC 2WLKA 1Y4MA 1PNLA 4R8CA 3ASNC 4X89A 3SYQA 1F4MA 1MOFA 1R6NA 2WLLA 1M90W 4QE9A 1YSCA 2DWDC 3ZRXA 4WFGA 3UM7A 2ZD9A 4PDRA 5L3BA 5B1BC 4RQFA 1AJNA 1YJWV 1OCCC 1SZTA 3VOUA 1B6QA 3OMIB 4RAIA 1NVPD 1R3JC 1AI7A 1EBOA 2WLIB 4PA9A 3OEHG 3W7TA 2XAFA 3ZN1A 2V1DA 3DGEA 4R50A 2IU3A 5CBGA 5IYCO 1NR7A 4BIZA 2BOCC 2XAQA 1YTFD 1M9NA 1R3IC 2OCCC 2JEXA 3E8FA 3OUSA 1I5YA 1NQTA 2H94A 2A0LA 4UUJC 4PDLA 2EINB 1WPXA 2XOKG 1E1QG 1N8RW 1AI4A 3QO5A 3BY6A 3CPWU 3RVZA 5H6RA 1S72V 5EBLC 4CBCA 4RUFA 1FFTB 5LHHA 2OTLV 1DTOA 4JGSA 3SPCA 5L3CA 4RO2A 4BW5A 5LGTA 2A9HA 1VQKV 1JJ2U 3TCUA 3ABLC 2NLJC 3AG1B 2JIZG 5B1AB 2V7QG 3F7YC 1PNKA 1QVFU 2K1EA 2UXNA 5KA6A 4ZM5A 3B8NA 1JQ0A 5B1OA 3ZN0A 3CXCU 4DO2A 2ZXWC 4F4LA 2EILC 2YEVA 5C93A 3CCEV 2DYRB 4JTDB 4WCEV 4QPJA 3FB8C 1Q81W 2P6JA 4Q20A 2IW5A 4N21A 1F51A 4MT8A 1W2BU 1OCZB 1S5HC 3WG7B 3IC7A 4LC1A 1FXKC 1K92A 2EIMC 4WFHA 1OCRC 3ABKB 3G71V 5CBFA 2PI5A 1ZWIC 3JCZA 4MSWC 3SYAA 1PL0A 2WSSG 3G6EV 3GB7C 3P32A 3R65A 1F23A 5CBHA 1YITV 2ZQMA 2HJFC 3TETA 3WFVA 5KUMA 1SETA 4MTXA 1K73W 5CA3A 1VQ6V 1V55B 3B8MA 1VQLV 4JTAB 1KKDA 3T4DA 1CP9A 1KC8W 2XAGA 2Y48A 5LGNA 1YIJV 1PD3A 1BMFG 4PA6A 3CC7V 4JYCA 1W0JG 2QTOA 4P9PA 1MSWD 3ZMUA 2H8PC 3SYPA 3RW0A 4G28B 1DLBA 2DQ0A 2X6CA 4J9YB 4LCUC 1R73A 3FYIB 2DW4A 4H33A 3CCVV 1PNMA 2Y69C 3CCMV 3T2MA 4MVUA 1OCOB 3AG2C 2EIJC 3RVYA 5L3EA 1THZA 2ZR3A 1J95A 4R6ZA 2GHYA 4XDLA 3E86A 3STLC 3ABMC 5B3SC 1GM8A 2Q68A 4H37A 4YXWG 2MK3A 1YJNV 3OFNG 2BOBC 1LNQA 3LUTB 2WLNA 1Q86W 1FXKA 3E83A 3K06A 4OXSA 3CCRV 3P30A 3JYCA 3W7UA 2B1IA 3B8PA 2Q6AA 2DQ3A 2YSUB 1HWYA 5H6QA 3OAAG 2WLHA 5IY5B 3IGAC 4G2KA 3ASOB 3ZRVA 3K08A 1FXVA 2HKOA 1AROP 3K9AA 3CCJV 3OGCC 1NBMG 3T1CA 4MS2A 2DYSB 3X2QB 1K97A 5IDJA 1FXHA 1GTOA 1K4CC 2JDIG 4GX5A 2QE7G 3AG4B 5KUKA 1I5XA 3SJQC 3ASNB 4JTCB 1XL6A 3H01A 2R9IA 1M56B 1K8AW 1GM7A 4UVCA 1SRYA 5HFMA 1M57B 3STZC 1GM9A 2HG5C 1QVGU 1PKXA 2WPDG 1ENVA 3B8OA 2X6BA 2W6JG 1L1FA 3CD6V 3SPIA 3MD0A 1DF5A 2W6IG 4JAUA 1JOYA 2EINC 4Z1MG 3CMEV 1KP2A 1CPYA 3ML0A 3CCQV 1FS0G 5LHIA 2LP7A 4QJFB 2P90A 4MVRA 1YHQV 3ETGA 2DWEC 4TT3G 1R6KA 4BAYA 5FL7G 2JEUA 1K5QA 3G4SV 4KFMA 4HYOA 4MW8A 5DM6V 1K3EA 4GT1A 3AG1C 1NR1A 5B1AC 3LDDA 1VQ4V 4X88A 4TSFG 1VQPV 1BHAA 4E29A 1H8HG 3A0RA 3ZMVA 2XAHA 3JD3A 1F4NA 2EIKB 3PJSK 1KD1W 4P9OA 1WLEA 2ZDIC 1GO3F 2DYRC 2X0LA 1AR1B 3D36A 5J9PC 4XDKA 4JASA 2OT5A 4UV9A 1VQ5V 1VQMV 3ZRWB 3OM3B 1RM1B 3I55V 2WLIA 1OCZC 5L3FA 3VBBA 3WG7C 3OMNB 3FYEB 4DXWA 4E2CA 3OW2U 3ABKC 5EC2C 1S76D 5LHGA 3QO7A 3W7SA 2ZR2A 2Z5UA 4UV8A 3MHHC 1ROPA 3ETEA 3JD2A 1M1KW 4L87A 3I56V 4FIPC 2HR3A 2ITCC 1W0KG 2WAMA 4FPPA 3OR6C 4LP8A 3SPJA 2IH3C 1RPOA 2WLLB 2HLDG 3LSQA 2CK3G 2QEXV 1V55C 5BZBA 5L3GA 1AJQA 4JYBA 1K33A 4GX2A 1R3KC 1H2GA 3EHBB 3K03A 2OTJV 3ZRSA 3GWOA 2IJIA 4I5SA 2R9RB 2B5UA 3QNEA 2IH1C 4EKWA 1JVMA 4TWKA 1OCOC 2XASA 3JD4A 4LBEC 2ZDIA 3AEIA 1YJ9V 1VQ7V 3ZJZA 1H8EG 1AI5A 1V54B 4WFFA 4U7OA 4RUEA 3JD0A 3CC2V 4U7NA 3ZMZA 1NH2B 3W7WA 1QLEB 1XL4A 1R3LC 4E2HA 1K4DC 3ZMTA 4MVQA 2F43G 2ITDC 1TUEB 4ZKIA 4RQEA 3D3IA 4R7CA 3K0GA 4BIUA 2ATKC 4PDMA 3M99B 3AG3B 3ASOC 5B3SB 4FJCC 4UVAA 1KQSU 2X7RB 1VQOV 4GX1A 2DYSC 3X2QC 2KB1A 1GMGA 2X6AA 1P7BA 1BHBA 3AG4C 3E8GA 2M7WA 3CMAV 1KP3A 2Q69A 2Q67A 3OEEG 3SYCA 2Z3YA 1EZJA 2QM8A 2A79B 1M56C 5LGUA 1NVPB 4QNHB 4QIWF 1JCHA 1M57C 2HVJC 3T4ZA 5B1BB 3F7VC 2YEVB 1OCCB 4J9ZB 1DF4A 2UXXA 1JX9A 4I9WA 1QLNA 1MABG 1YTFB 3RBZA 2IJJA 3JD1A 1Y66A 4X8AA 1GK9A 3LDCA 5H9CA 5CMUA 3LNMB 3CP1A 2XNDG 4JPRA 2EBOA 1H38A 4MTFA 3FKSG 4PA4A 5IYDO 3CYOA 3FB6C 3K3WA 4GCZA 1VQNV 2OCCB 3F5WC 1Q7YW 4QE7A 4PA3A 1JPXA 2HVKC 3B77A 1OZ0A 4KP4A 3OUFA 2PI4A 4MVZA 2EZOA 3E89A 4XBFA 2JJ2G 5KA5A 1G8MA 3QO8A 3SPGA 2NNUA 5B1NA 2W0FC 3K0DA 4WFAV 2C2AA 4QPKA 2D3OW 4ZM1A 2EIKC 3BEHA 1K34A 2QM7A 3ABLB 2AHYA 2LFRA 3ETDA 4UVBA 3ABUA 1K9MW 1K7DA 3KG2A 2P67A 4P30A 1NKDA 4MTOA 5EBWC 4MVSA 1COWG 2JK5C 3IFXA 3OR7C 1VQ8V 5E1AC 1AI6A 1RM1C 1AJPA 4JF3A 3EFFK 2ZXWB 5LBQA 4MW3A 2EILB 5GW7A 3MHSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  1SZT A;  3WFV A;  4FJC C;  1Y66 A;  1QR8 A;  2X7R B;  5HFL A;  4ZM1 A;  1MG1 A;  4FIP C;  1I5X A;  2LP7 A;  1QR9 A;  1K34 A;  2P6J A;  4N23 A;  5CMU A;  5H9C A;  3CP1 A;  3MHS C;  2MK3 A;  1EBO A;  3B8M A;  2M7W A;  4JGS A;  2EBO A;  4JPR A;  3H01 A;  4N21 A;  1Y4M A;  1DF5 A;  2OT5 A;  3CYO A;  1MOF A;  4E2L A;  5HFM A;  1K33 A;  4E2H A;  1QBZ A;  1JPX A;  3B77 A;  2EZP A;  3P30 A;  3B8P A;  1DLB A;  1I5Y A;  4E2C A;  1QCE A;  2EZO A;  1ENV A;  4JF3 A;  5KA6 A;  3B8O A;  4ZM5 A;  4E29 A;  3B8N A;  3GWO A;  1JQ0 A;  5CN0 A;  4G2K A;  5KA5 A;  1DF4 A;  3K9A A;  1F23 A;  4FK5 C;  3M99 B; 
#chains in the Genus database with same CATH topology
 3K79 A;  2YS8 A;  1N36 O;  1ZTE A;  4OX9 B;  1N0N A;  1FXK B;  2K9P A;  3G67 A;  1OCR B;  3NR7 A;  3G6B A;  5IYB O;  4MVO A;  4LH7 A;  1SES A;  4PEL A;  4FVM A;  4NVP A;  3E8B A;  3N2G B;  3RT3 C;  5GTI Z;  4JI6 B;  4J42 A;  4TUY A;  4O2B A;  3UO3 A;  1XBL A;  1S0V A;  5HFL A;  5DED A;  4B7K A;  1ZSP A;  1J5E O;  3SPH A;  4YIP A;  1OV9 A;  3CXH F;  3ZMS A;  5DN6 G;  2ZKO A;  5CA1 A;  1SER A;  3ICX A;  1GKF A;  3JAR A;  1V54 C;  2GSM B;  3CX5 F;  4KHP O;  2UU9 B;  3BA9 A;  5JQG A;  2EZP A;  3ZRW A;  5AG2 A;  4WFE A;  4YJ2 B;  1HP8 A;  5CN0 A;  2QKS A;  4FK5 C;  4G27 B;  4F6R A;  3ZBH A;  5E79 Z;  5LYJ A;  1H2N A;  4ZBM A;  1KEC A;  3RYC A;  3CRM A;  1PNL A;  4R8C A;  2QWQ B;  3JAM N;  3QTC A;  2WLL A;  2DWD C;  5H5N A;  3J80 N;  4WFG A;  2GUZ B;  5B1B C;  1AJN A;  2R72 A;  3VOU A;  1B6Q A;  2P22 C;  3D3Q A;  4H13 B;  2WLI B;  2Y0P A;  5CBG A;  5IYC O;  2XAQ A;  1M9N A;  2OCC C;  3E8F A;  3HKE B;  3OUS A;  1I5Y A;  1H2M A;  2ADQ B;  4OGQ B;  4PDL A;  1YDX A;  1WPX A;  1XMQ B;  1Q43 A;  4D7T A;  4B3M B;  5H6R A;  4RUF A;  5LHH A;  1DTO A;  1P7G A;  1VQK V;  4RO2 A;  4NYK A;  3AG1 B;  2KG7 B;  5B1A B;  4IIJ B;  4O2A B;  1XOU A;  3DXR B;  4U3F H;  4FM1 A;  2E76 B;  3CXC U;  1T5E A;  4D6T H;  5C93 A;  5IYZ B;  2HHH B;  3VQY A;  4QPJ A;  2UU9 O;  1I08 A;  1WNS A;  4N21 A;  5JJE B;  4MT8 A;  1W2B U;  1S5H C;  4W4L A;  5KHI A;  2DJV A;  3G71 V;  4KL1 A;  4A5U B;  5JJJ B;  4X1I A;  1ZWI C;  4I9Q A;  2UUA B;  5KMG B;  3QG5 A;  2OIE A;  5CBH A;  1YIT V;  5J2T A;  3N27 A;  3B2E E;  1JJO A;  4GZR B;  5KUM A;  4MTX A;  3WB1 A;  2A7W A;  3AK2 A;  5C8Y A;  3L71 H;  3SGI A;  1VQL V;  3TJT A;  3T4D A;  4EEQ A;  2LW7 A;  3CS5 A;  3K5M A;  4JYC A;  1W0J G;  1MSW D;  2BTQ B;  4LCU C;  4H33 A;  1MNG A;  1PNM A;  2Y69 C;  3CCM V;  5BXZ A;  4MVU A;  1SQG A;  2EIJ C;  2ZNI A;  3HKD B;  3RVY A;  5EZY A;  1PP9 H;  2JGU A;  3STL C;  5K1P A;  2Q68 A;  2QKA A;  2MK3 A;  1XMQ O;  1LNQ A;  1FXK A;  3E83 A;  2F66 C;  3P30 A;  3JYC A;  4HBN A;  3B8P A;  2Q6A A;  4G2K A;  3ASO B;  3ZRV A;  2HKO A;  3K9A A;  1NBM G;  3N2G A;  1FXH A;  4BW9 A;  4GX5 A;  2QE7 G;  3AG4 B;  5K1X A;  5KUK A;  1I5X A;  3K5L A;  3SJQ C;  3ASN B;  4JTC B;  3D36 C;  3DSQ A;  1R1B A;  1BQZ A;  2V4D A;  2HHH O;  3OD4 A;  1PKX A;  1NTM H;  4X65 B;  2XT9 A;  5J2U A;  3CD6 V;  1ZLZ A;  2EIN C;  3D8C A;  1XIL A;  4YJ2 A;  3CME V;  1FS0 G;  5LHI A;  2QTS A;  3RYF B;  4JI7 O;  2UUA O;  2PF4 E;  1Q6U A;  1YHQ V;  1R6K A;  2XHB A;  2JEU A;  1SA0 B;  4FZ1 A;  4MW8 A;  1SQX H;  1FFX A;  2BE3 A;  4E4E A;  1SF9 A;  4X88 A;  4JI8 B;  1VQP V;  5JH7 B;  1MA1 A;  5JWP A;  4PJ0 Z;  1H8H G;  3SJB C;  5KHK A;  3OTF A;  4NXM O;  3S3W A;  1F4N A;  3PJS K;  2GUZ A;  3T1Y B;  4P9O A;  1WLE A;  2ZDI C;  2CH7 B;  2X0L A;  1BQ0 A;  2PYJ A;  4JAS A;  3SDL A;  1XMO B;  1MMM A;  3I55 V;  3O65 A;  2WLI A;  3KKY A;  3VBB A;  1KMI Z;  3WG7 C;  5LHG A;  4DV7 B;  3HKE A;  1IXB A;  4UV8 A;  3JD2 A;  4L87 A;  1IX9 A;  4GLX A;  4LP8 A;  2IH3 C;  2CK3 G;  2JVD A;  3G80 A;  4JYB A;  3J81 N;  4TV9 B;  1GN3 A;  1PL4 A;  4FM0 A;  4I55 B;  2KG7 A;  4Z2W A;  2OTJ V;  4NTW A;  5KHJ A;  4IIJ A;  4O2A A;  2B5U A;  3DXR A;  3QNE A;  5BY1 A;  2IH1 C;  1F7Y A;  1OCO C;  4ZHQ B;  5IYZ A;  3S3X A;  2DE0 X;  1N0J A;  3ZJZ A;  4X65 O;  1VQ7 V;  2VQF O;  1V54 B;  4WFF A;  4BWA A;  4NXN B;  3H1I H;  3ZMT A;  4LFB B;  4MVQ A;  5KLV H;  4JV5 B;  1TUE B;  2OIG A;  4DR6 B;  2VS0 A;  2JRI A;  5CA0 A;  4BIU A;  4LF6 B;  4PDM A;  5KMG A;  4UB8 Z;  4UVA A;  3FAV B;  4GX1 A;  5KHH A;  4IYH A;  4DR3 B;  4JI8 O;  2M7W A;  3CMA V;  4FLV A;  3HKB B;  2Q67 A;  4B7E A;  2CUG A;  3SYC A;  4FLX A;  1EZJ A;  2QWP B;  4KXR A;  2A79 B;  1M56 C;  5LGU A;  4QIW F;  3T1Y O;  5LMU B;  4UB6 Z;  1GH6 A;  5B1B B;  4B3T B;  2BTQ A;  1DF4 A;  4I9W A;  1XMO O;  1YTF B;  1SQV H;  2IJJ A;  3HKD A;  1U96 A;  5H9C A;  3LNM B;  4CH5 A;  4DV7 O;  5IYD O;  4LF4 O;  4LF7 B;  4X9Q A;  2CTW A;  2OCC B;  2FYU H;  4PA3 A;  1JPX A;  3B77 A;  1OZ0 A;  4I4T B;  4J7J A;  4O2B B;  4MVZ A;  1IZ3 A;  3E89 A;  4XBF A;  4DR2 B;  2JJ2 G;  2ZIM A;  2QWO B;  5KA5 A;  1HNW B;  3QO8 A;  4DV5 B;  3SPG A;  2O57 A;  3LSU A;  2W0F C;  1I94 B;  3K0D A;  2C2A A;  2EIK C;  2ILM A;  2QM7 A;  2UXD B;  1K9M W;  3KG2 A;  4FFB B;  2JS3 A;  3M7M X;  4MVS A;  3K5O A;  4GKK O;  5E1A C;  4O4H B;  4FLY A;  4JF3 A;  1Y76 B;  2ZE7 A;  4UCR A;  2N74 A;  3CC4 V;  4FMT A;  4XDJ A;  4NXN O;  1GN6 A;  4LFB O;  1JFF A;  1BSM A;  3VQV A;  4DV3 B;  4JV5 O;  5EC1 C;  4NTY A;  3ZHR A;  5EK0 A;  4DR6 O;  3SYO A;  3E2E A;  4LF6 O;  1W59 A;  3OE7 G;  1DK1 A;  3FB5 C;  1XQ8 A;  3RYH B;  1SA0 A;  4X62 B;  3DTU B;  1YI2 V;  3K04 A;  4L8J A;  4CS4 A;  2EUL A;  4LR3 A;  5JH7 A;  4PA7 A;  2E3C A;  2F95 B;  3A0B Z;  1IXM A;  4HAM A;  5LMU O;  2HEP A;  1AP5 A;  2WWW A;  4B3T O;  2FB5 A;  4WF9 V;  3C90 A;  3EVK A;  3P3P A;  1N36 B;  2LQT A;  2OYQ A;  1JA8 A;  1S3J A;  5F2V O;  4PDV A;  1US6 A;  4MVM A;  2Y69 B;  3CCL V;  3HB3 B;  1KKC A;  2EIJ B;  3A2F A;  3ZHS A;  2JGD B;  5IT9 N;  3APQ A;  2P7T C;  4LF7 O;  4FM2 A;  1OHH G;  3L73 H;  4JI4 B;  3CCU V;  3HPL C;  4ZOL B;  1QR9 A;  3E35 A;  2EJR A;  3H1H H;  4DR2 O;  5IE9 A;  4J7K A;  1HNW O;  4JZG A;  4X89 A;  3ASN C;  1MOF A;  1I94 O;  1YSC A;  3GVM A;  1XRE A;  3ZRX A;  4TV9 A;  3UM7 A;  1HW7 A;  2UXD O;  4I55 A;  2DMX A;  4RQF A;  1YJW V;  1OCC C;  1SZT A;  2RNB A;  4KHP B;  5JCO C;  2F23 A;  4JYA O;  4ZHQ A;  4PA9 A;  4R50 A;  1VF7 A;  3CHX A;  1WP8 A;  2BCC H;  1YTF D;  3J7A U;  2EIN B;  2CTP A;  5J2T B;  3H1K H;  1E1Q G;  1N8R W;  1QU7 A;  3FD9 A;  3CPW U;  1S72 V;  5C8Y B;  4X62 O;  2JS5 A;  1FFT B;  3FAV A;  2OTL V;  1XNR O;  2V7Q G;  3HKB A;  1PNK A;  2K1E A;  3L74 H;  1Q6I A;  1D2D A;  1JQ0 A;  1L0L H;  5B1O A;  3ZN0 A;  3SR2 C;  1TUB B;  2YUA A;  4JTD B;  1WPB A;  1Q81 W;  1N33 O;  4Q20 A;  3K58 A;  2IW5 A;  5EIB C;  4LF8 B;  1VEW A;  3WB2 A;  3FX7 A;  3WG7 B;  3IC7 A;  4W4K A;  2EIM C;  2NR5 A;  5CBF A;  3BFR A;  4JI4 O;  3K57 A;  3JCZ A;  3CWB H;  4OPH A;  3G6E V;  4I4T A;  3AK3 A;  1F23 A;  2KSD A;  4H44 B;  3ZHU A;  2QR4 A;  3TET A;  4JI5 O;  3KZI Z;  2Y48 A;  3LNN A;  1BMF G;  4PA6 A;  1JR9 A;  1G6U A;  4FFB A;  3ZMU A;  2H8P C;  3SYP A;  1DLB A;  2DQ0 A;  5J2U B;  4J9Y B;  3ZHQ A;  2N04 A;  4O4H A;  3UT5 B;  1OCO B;  3AG2 C;  3MAQ A;  2YDE A;  1Y76 A;  1X59 A;  1Q8I A;  1NTK H;  2Q7H A;  3E86 A;  3ABM C;  1GM8 A;  4H37 A;  4YXW G;  2FL4 A;  3OFN G;  4LFA O;  3LUT B;  1A32 A;  2Q0O C;  1FFX B;  1IBM O;  4I50 B;  1M5I A;  1HWY A;  4ZIB A;  5H6Q A;  3N2K B;  3RYH A;  2CTR A;  3IGA C;  3CCJ V;  4MS2 A;  5IDJ A;  4X1Y A;  2AXT Z;  3BHP A;  3H01 A;  4AHC A;  1M56 B;  1K8A W;  1SRY A;  1ZX3 A;  2F4V B;  5H2F Z;  5D5Q A;  4PI0 A;  1NI8 A;  1QVG U;  4DR4 O;  2WPD G;  3B8O A;  2A3Q A;  2X6B A;  3SPI A;  4LF8 O;  2LGW A;  2CDY A;  2H3O A;  3TXQ A;  1KP2 A;  2JGD A;  3CCQ V;  2KKW A;  4J7Z A;  3ETG A;  2DWE C;  4ZOL A;  5JVD B;  3CRQ A;  5FNV A;  5DM6 V;  4GT1 A;  4K35 A;  1BS3 A;  1VQ4 V;  2ZIN A;  3GWK C;  2YXH A;  5EYP B;  3ZMV A;  2AZ2 A;  4LF9 O;  3C3S A;  2EIK B;  2DOS A;  1IVS A;  1WA8 A;  1KD1 W;  2EJ7 A;  4AQY B;  4LWS B;  3D36 A;  4JI3 B;  3OM3 B;  4J80 A;  5A2Q N;  5CA0 B;  4JI7 B;  5EC2 C;  2OWO A;  3QO7 A;  3W7S A;  2ZR2 A;  2ZE8 A;  2MW2 B;  4I0X B;  1NZ6 A;  3HR0 A;  3APO A;  3SJC C;  2D2C B;  5KX5 B;  3I56 V;  4FIP C;  1W0K G;  1YZB A;  3SPJ A;  1RPO A;  3LSQ A;  3CSX A;  4AIL C;  1V55 C;  4NXM B;  3B09 A;  3ZX6 A;  4CH6 A;  1H2G A;  1O9H A;  3K03 A;  3I5D A;  3ZRS A;  2A06 H;  1B3Q A;  2IJI A;  1HNX B;  4EKW A;  1Y74 B;  2F4V O;  2GDS A;  4TWK A;  1TUB A;  2ZDI A;  1H8E G;  1NH2 B;  1XL4 A;  1R3L C;  3L70 H;  3BAA A;  2P4K A;  2YIB D;  3KCX A;  2NN4 A;  5FPO A;  3M99 B;  4Z1V A;  2VWJ A;  2DYS C;  3X2Q C;  3CE2 A;  1GMG A;  1P7B A;  1Z5V A;  1KP3 A;  4CC5 A;  1WJZ A;  1NVP B;  3L75 H;  2Q5Z A;  1S5L Z;  4AQY O;  3T4Z A;  3A8T A;  2VQF B;  2YEV B;  1OCC B;  4JI3 O;  1WN7 A;  1JX9 A;  1QLN A;  1MAB G;  1JFF B;  3RBZ A;  1AB3 A;  3UT5 A;  4K0K B;  1S5J A;  2YIA A;  1M93 A;  2G38 A;  2CGO A;  4TOI A;  2ETN A;  2XND G;  3CP1 A;  1KB9 F;  2EBO A;  4PA4 A;  4DW1 A;  3C3T A;  5IJ0 B;  3CYO A;  4GCZ A;  3K3W A;  1VF6 C;  4IT5 A;  4KP4 A;  2PI4 A;  1URF A;  4I50 A;  4DV2 B;  2NNU A;  3N2K A;  2AZ0 A;  1H2K A;  1GN4 A;  4UCU A;  1VIB A;  4TQD A;  5ITZ A;  4LF5 B;  1U97 A;  1HNX O;  5EBW C;  2Q9L A;  2JK5 C;  4IHJ B;  1VQ8 V;  1RM1 C;  4GYC B;  4MW3 A;  4LF4 B;  4NTX A;  1Q82 W;  1Q6H A;  3TK1 A;  5L3D A;  1WAZ A;  2QWR B;  4N23 A;  2AHZ A;  4DV0 O;  3ABT A;  2PY5 A;  2EIM B;  3U0Z A;  2IU0 A;  2Z0A A;  4X20 B;  1HDJ A;  3THO A;  4O4L B;  1BZK A;  2R9A A;  5JVD A;  3LDE A;  3FB7 C;  1ORQ C;  1SQF A;  2ADP A;  4JAV A;  2QA4 V;  4KUM A;  1ZUQ A;  4GKK B;  1RPR A;  5EYP A;  2Q7G A;  4X66 O;  4LFC O;  1D5A A;  3LSS A;  2PGG A;  4LWS A;  2OCH A;  2CTQ A;  1K5S A;  4K0K O;  2XAJ A;  1QCE A;  1P4R A;  4EFE A;  4X64 B;  4HZ3 A;  4DUY O;  3AG2 B;  4DW0 A;  3W7X A;  2WLM A;  4MTG A;  2WLJ A;  2LFS A;  4DUZ O;  4ASU G;  3ABM B;  1NH2 D;  1G4Y B;  4I0X A;  4GX0 A;  2B1G A;  3OMA B;  1VQ9 V;  2YXY A;  1CEZ A;  4WFB V;  1E1R G;  5KX5 A;  2HFE C;  1Q3E A;  4DV2 O;  2RDC A;  1F4M A;  4BR6 A;  1R6N A;  1M90 W;  4QE9 A;  2YI9 A;  2ZCE A;  4LF5 O;  4PDR A;  2P06 A;  2ODM A;  3UQ8 A;  4RAI A;  1GAX A;  1HR0 B;  1Y74 A;  1NVP D;  1R3J C;  4D7S A;  1EBO A;  2YXL A;  1XHX A;  1NTZ H;  4LH6 A;  3OEH G;  3W7T A;  5LL6 Y;  1N34 O;  2XAF A;  3ZN1 A;  3DGE A;  2IU3 A;  4DV1 B;  1NR7 A;  4BIZ A;  3FFQ A;  1R3I C;  4B3S B;  4J41 A;  1XNQ B;  2H94 A;  4UUJ C;  2P5O A;  2XOK G;  3JSL A;  5KAI Z;  1AI4 A;  1SQB H;  3QO5 A;  4IYI A;  3RVZ A;  4CBC A;  1IBL B;  2PZS A;  5LXT B;  1TAE A;  5L3C A;  5LP6 C;  5LGT A;  2ZIO A;  3TCU A;  2PUS A;  3ABL C;  2F1M A;  2Q8V A;  2W0X A;  1BGY H;  1KU9 A;  5KA6 A;  1FD9 A;  1LUW A;  3B8N A;  4JYA B;  2E74 B;  1NS1 A;  4U3J B;  4O4I A;  3DC5 A;  2YEV A;  4IGG A;  4WCE V;  4J11 A;  3FB8 C;  5JCO A;  2P6J A;  4X64 O;  2HP8 A;  1H2L A;  4WFH A;  5IJ0 A;  4GKJ O;  3K5N A;  2N05 A;  4NB5 A;  5EIB D;  3GB7 C;  1JMK C;  1CXZ B;  4JI1 B;  5IJ9 B;  3R65 A;  3OT7 A;  4X1Y B;  2HJF C;  4PHZ A;  1XNR B;  3H9V A;  4DR7 O;  2QKC A;  1B06 A;  2YI8 A;  5CA3 A;  1K73 W;  1ZAU A;  3OTO O;  1V55 B;  3B8M A;  4JTA B;  1CP9 A;  1KC8 W;  2XAG A;  5LGN A;  1YIJ V;  4AI8 A;  4FZ0 A;  3JAK B;  2QTO A;  4P9P A;  5LA6 B;  5DEC A;  3RW0 A;  4UCV A;  1HR0 O;  3JAT A;  2X6C A;  1N33 B;  4IHJ A;  4J10 A;  2DW4 A;  4FLU A;  1I0H A;  3TGU H;  5KAF Z;  2ARH A;  2GHY A;  4DV1 O;  4B3S O;  1XNQ O;  3JAL A;  2LO1 A;  4CH4 A;  2WA4 A;  3B4S A;  2BOB C;  5GON B;  5FNV B;  2WLN A;  2ZE5 A;  4JI5 B;  3K06 A;  4OXS A;  4X20 A;  1IBL O;  4NR1 A;  4O4L A;  1R6T A;  3OAA G;  3K59 A;  2WLH A;  1XI1 A;  5IY5 B;  1KUQ A;  3K08 A;  1FXV A;  1ARO P;  4HNA B;  3OGC C;  1P49 A;  2DYS B;  1WA8 B;  3X2Q B;  1GTO A;  4QGP A;  3B40 A;  5IWA B;  2JDI G;  2FML A;  3MDS A;  2KQX A;  1SQP H;  5LMN O;  1XL6 A;  2QDO A;  2RQ6 A;  4UVC A;  3STZ C;  1GM9 A;  2W6J G;  3CRC A;  3MD0 A;  1UFI A;  1Y67 A;  4JAU A;  4LFA B;  1JOY A;  3RGB A;  1IBM B;  4FLW A;  1B04 A;  2P90 A;  2UUB B;  3ZHV A;  4MVR A;  4TT3 G;  4JI1 O;  4BAY A;  1Z5W A;  5FL7 G;  3G4S V;  4IL6 Z;  4KFM A;  4FLZ A;  1NR1 A;  1Q5O A;  4TSF G;  1RP3 B;  2XAH A;  3JD3 A;  4K3A A;  2Q73 A;  2BTO A;  3ZHT A;  2DN9 A;  4O4J B;  4DR4 B;  2DYR C;  3H1J H;  4XDK A;  3Q4H B;  2XTA A;  4PI2 A;  1QHT A;  4UV9 A;  1VQM V;  3IAY A;  1RM1 B;  4DK0 A;  1YEW A;  1OCZ C;  4DXW A;  3ABK C;  2R70 A;  5FLX N;  2UXB O;  1SS3 A;  2E75 B;  1ROP A;  3ETE A;  1M1K W;  3HKC B;  1QNM A;  2HR3 A;  4FPP A;  2WAM A;  3OR6 C;  4JI0 B;  3JCU Z;  2GBO A;  4UCS A;  2QEX V;  5BZB A;  5LXT A;  4LF9 B;  5L3G A;  1AJQ A;  1K33 A;  4GX2 A;  1R3K C;  5IWA O;  3EHB B;  3EXA A;  3GWO A;  3P3N A;  1XHZ A;  4I5S A;  1PPJ H;  1KBH A;  4U3J A;  1I7F A;  2XAS A;  4DV6 O;  4DR5 B;  3AEI A;  1L0N H;  2B9Z A;  1YJ9 V;  4JZ2 A;  1IUR A;  3JD0 A;  3BPZ A;  4RQE A;  3CJH B;  1MZF A;  2UUB O;  2UXC B;  3K0G A;  3PN1 A;  1M4U A;  5B3S B;  2HJD A;  1VAR A;  2ZT9 B;  5IJ9 A;  5ITZ B;  1KQS U;  3BRC A;  1VQO V;  1TGO A;  3JAW A;  3E8G A;  1UPG A;  2Q69 A;  4JYY A;  3OEE G;  2Z3Y A;  3JAK A;  3UCS C;  1JCH A;  1M57 C;  3AK1 A;  5LA6 A;  1RSO B;  1H2S B;  1FJG B;  3F7V C;  4J9Z B;  2UXX A;  4YIO A;  3A0H Z;  3JD1 A;  1Y66 A;  4X8A A;  1TA8 A;  2CGN A;  1GK9 A;  1RFY A;  5CMU A;  1IBK O;  4JPR A;  1H38 A;  4MTF A;  4UCT A;  1EZV H;  1EM1 A;  1VMG A;  1Q7Y W;  2HVK C;  5GON A;  1YXB A;  3OUF A;  5D5P A;  2RN9 A;  4OX9 O;  2EZO A;  1EN4 A;  3KCY A;  4B3R B;  1HNZ B;  1AP6 A;  3RN4 A;  4JI0 O;  5TIS Z;  5B1N A;  2PTM A;  4X1K B;  4EFB A;  4WFA V;  4HNA A;  4QPK A;  2D3O W;  4ZM1 A;  3T1H B;  5LP6 B;  2RJZ A;  3BEH A;  4JI6 O;  3ABL B;  2LFR A;  4JI2 B;  4DR1 B;  1G1X B;  1COW G;  3IFX A;  2P4V A;  1PM9 A;  4Q6G A;  1AJP A;  1V9P A;  4DR5 O;  2YIC A;  4K8Z A;  1GRJ A;  2CAZ C;  4C7U A;  3E22 B;  3MHS C;  1L8D A;  3NXS A;  4FFK A;  2GV9 A;  1QR8 A;  2FTK A;  3TXS A;  4DYL A;  5BR8 B;  2GTA A;  5EBM C;  3ZCC A;  2LGQ A;  3ZIA G;  2UXC O;  3E8H A;  3CCS V;  1BL8 A;  1VF6 A;  4RWU A;  3DC6 A;  4YHH B;  2IJK A;  3OGI B;  1NJI W;  1UJW B;  1TVK A;  3U10 A;  3UKM A;  3M8A A;  2E5L B;  4CZZ A;  1ZL8 B;  1Z2G A;  2IJH A;  4O4J A;  1FJG O;  4P2Z A;  4K8X A;  4H0L B;  4E2L A;  3Q4H A;  1QBZ A;  1N32 B;  1EFR G;  1E79 G;  1QLE C;  4UXN A;  1D5N A;  2JJ1 G;  5CB4 B;  4DV0 B;  2GTS A;  1S77 D;  3BVO A;  1WB8 A;  4JAA A;  3H1L H;  3CB2 A;  5IY5 C;  2FKX A;  2QWN B;  1OJH A;  3AG3 C;  1MG1 A;  3HKC A;  4B3R O;  1HNZ O;  4NKG B;  2WLK A;  1Y4M A;  3SYQ A;  4B3M O;  1IDS A;  4UFZ A;  5B5E Z;  4X66 B;  4O4I B;  4LFC B;  3T1H O;  4UCO A;  4DK1 A;  2QGN A;  2ZD9 A;  4JI2 O;  4DR1 O;  3JAS B;  5L3B A;  1YCI A;  5B66 Z;  1LUV A;  3OMI B;  4ZI7 B;  1AIL A;  4GUN A;  1AI7 A;  3VQW A;  4DUY B;  2V1D A;  2YIB A;  1Y6X A;  4PV1 B;  4CS2 A;  4DUZ B;  2BOC C;  2JEX A;  4EB6 B;  2BSK B;  5BR8 O;  1NQT A;  2A0L A;  1SQQ H;  3CJH A;  3BY6 A;  4DV4 B;  5EBL C;  1XUQ A;  4YHH O;  2Y4U A;  5LOV B;  4JGS A;  3SPC A;  1JJ2 U;  4BW5 A;  5KHG A;  2A9H A;  2E5L O;  3QVN A;  3IC9 A;  1BT8 A;  2NLJ C;  2JIZ G;  3JAT B;  3F7Y C;  1QVF U;  3WB0 A;  2UXN A;  4ZM5 A;  4BIO A;  4DO2 A;  1N34 B;  2ZXW C;  4F4L A;  3WU2 Z;  1RSO A;  2EIL C;  3CCE V;  2DYR B;  3JAL B;  1N32 O;  2AGA A;  1XEQ A;  3VQX A;  4CS3 A;  1F51 A;  1OCZ B;  4LC1 A;  1FXK C;  1K92 A;  1OCR C;  3ABK B;  2PYL A;  2PI5 A;  4MSW C;  3CRA A;  3SYA A;  1PL0 A;  3RFR A;  2WSS G;  1AR4 A;  3P32 A;  3ZED A;  2ZQM A;  1PV0 A;  3WFV A;  5BMV B;  1SET A;  4WBN B;  3BA8 A;  4X1K A;  1VQ6 V;  3RYI B;  1KKD A;  4LNU B;  5LP6 A;  1PD3 A;  3CC7 V;  1XDC A;  1FKA O;  3L9D A;  4G28 B;  3O9O A;  2YC0 A;  1R73 A;  3FYI B;  4PD4 F;  3CCV V;  3T2M A;  1BCC H;  1N4C A;  5L3E A;  1THZ A;  2ZR3 A;  2VQE B;  3E22 A;  1J95 A;  4R6Z A;  4GKJ B;  1P84 F;  4XDL A;  5B3S C;  1SKV A;  1YJN V;  1Q86 W;  3SJA C;  1BE3 H;  4CH3 A;  1VP7 A;  4DR7 B;  1DGS A;  3CCR V;  4DV4 O;  3W7U A;  2B1I A;  2DQ3 A;  2YSU B;  3OTO B;  3ZS8 C;  1FAF A;  3T1C A;  1SZX A;  1K97 A;  1K4C C;  4YJ3 B;  1ZL8 A;  2ZNJ A;  4TV8 B;  3K9S A;  2Q4P A;  2R9I A;  1EN5 A;  1GM7 A;  5HFM A;  4DRX B;  1M57 B;  2HG5 C;  1ENV A;  1L1F A;  1DF5 A;  2W6I G;  5CB4 A;  2L6L A;  4Z1M G;  1CPY A;  3ML0 A;  5GTH Z;  3U11 A;  1O9G A;  3ETQ A;  2LP7 A;  4ICG A;  4QJF B;  3IJ4 A;  2ZM6 B;  1K5Q A;  2L35 A;  4HYO A;  1K3E A;  4TUY B;  3AG1 C;  5B1A C;  3LDD A;  1BHA A;  5LMN B;  4E29 A;  1MSD A;  3A0R A;  3AG7 A;  3JAS A;  1GO3 F;  2UUC B;  5CA1 B;  1KYO F;  1AR1 B;  4ZI7 A;  3JAR B;  1QQC A;  5J9P C;  5JJN B;  2Q7E A;  1YF2 A;  2VWK A;  2OT5 A;  5JQG B;  4I7Z B;  1VQ5 V;  3ZRW B;  2VQE O;  5L3F A;  2Y0I A;  4FLT A;  3OMN B;  3FYE B;  2AW9 A;  4E2C A;  3OW2 U;  2Y4T A;  4F6R B;  1S76 D;  4EB6 A;  2BSK A;  2Z5U A;  5LYJ B;  3F5T A;  3MHH C;  2RMK B;  2IM9 A;  4B08 A;  3JAW B;  3RYC B;  2ITC C;  1WB7 A;  4YY3 B;  4OPA A;  3RYF A;  2WLL B;  2HLD G;  5LOV A;  1WP7 A;  2LW1 A;  1VF5 B;  4DR3 O;  3CEI A;  2QM4 A;  1AR5 A;  2CE4 A;  1EN6 A;  2R9R B;  2IBZ H;  3R66 A;  1JVM A;  1GN2 A;  1YVW A;  3JD4 A;  4LBE C;  1AVM A;  1AI5 A;  2CH7 A;  4U7O A;  3BCC H;  4RUE A;  3CC2 V;  4U7N A;  3ZMZ A;  3W7W A;  1QLE B;  2UXB B;  4E2H A;  1K4D C;  4TQF A;  2F43 G;  2ITD C;  4ZKI A;  3D3I A;  4R7C A;  2YID A;  2ZM6 O;  2M6Y A;  2ATK C;  1LR1 A;  3AG3 B;  3ASO C;  3JSN A;  4FJC C;  2X7R B;  4CC6 A;  2KB1 A;  2X6A A;  1BHB A;  5BMV A;  3AG4 C;  3QF7 A;  4WBN A;  4DV5 O;  2EX3 A;  1SC5 B;  3RYI A;  2QM8 A;  4LNU A;  2VRZ A;  3CRR A;  4QNH B;  4DV6 B;  1J5E B;  2RCV A;  3BAB A;  2HVJ C;  2UUC O;  2F93 B;  1NT2 B;  2LJ2 A;  4F6E A;  2QJ1 A;  3LDC A;  1MZE A;  3FKS G;  4X1I B;  3FB6 C;  1VQN V;  3F5W C;  3RWR D;  4QE7 A;  1FPO A;  1TVK B;  4DV3 O;  2ZE6 A;  2XUM A;  1FYJ A;  1Q90 D;  2QSA A;  5A9G A;  4YY3 O;  1G8M A;  2WA3 A;  1X4T A;  1K34 A;  3ETD A;  2AHY A;  4UVB A;  3ABU A;  4YJ3 A;  1K7D A;  5FPR A;  4ABM A;  2P67 A;  4P30 A;  3L72 H;  1NKD A;  4MTO A;  4TV8 A;  3OR7 C;  1NU1 H;  1AI6 A;  4DRX A;  2Q0A A;  3EFF K;  2ZXW B;  1IBK B;  3UO2 A;  5LBQ A;  2EIL B;  5GW7 A;  5EZY B; 
#chains in the Genus database with same CATH homology
 3K79 A;  3CC4 V;  4FMT A;  1Q82 W;  4XDJ A;  3NXS A;  3TK1 A;  5L3D A;  1QR8 A;  2FTK A;  5EC1 C;  5EBM C;  4N23 A;  2AHZ A;  3ZCC A;  5EK0 A;  3ABT A;  3SYO A;  1FXK B;  3ZIA G;  2EIM B;  1OCR B;  5IYB O;  3E2E A;  3E8H A;  4MVO A;  2IU0 A;  1SES A;  1BL8 A;  3CCS V;  4PEL A;  3OE7 G;  3FB5 C;  2IJK A;  3LDE A;  1NJI W;  3FB7 C;  1UJW B;  1ORQ C;  3E8B A;  3UKM A;  3DTU B;  4JAV A;  1YI2 V;  3K04 A;  4CZZ A;  2QA4 V;  4KUM A;  4PA7 A;  1S0V A;  1RPR A;  5HFL A;  1IXM A;  4HAM A;  2IJH A;  3SPH A;  2WWW A;  3LSS A;  3ZMS A;  5DN6 G;  4P2Z A;  4WF9 V;  1SER A;  1GKF A;  1V54 C;  4E2L A;  1QBZ A;  2GSM B;  1K5S A;  1EFR G;  1E79 G;  1S3J A;  2EZP A;  1QLE C;  4UXN A;  4PDV A;  2XAJ A;  3ZRW A;  1QCE A;  1P4R A;  2JJ1 G;  2Y69 B;  4MVM A;  4HZ3 A;  3HB3 B;  3CCL V;  3AG2 B;  2EIJ B;  4WFE A;  1S77 D;  5CN0 A;  2QKS A;  3W7X A;  2WLM A;  4MTG A;  4FK5 C;  2P7T C;  4G27 B;  2WLJ A;  2LFS A;  5IY5 C;  4ASU G;  3ABM B;  1OHH G;  1NH2 D;  1G4Y B;  3CCU V;  3AG3 C;  2B1G A;  1MG1 A;  3HPL C;  3OMA B;  4GX0 A;  1VQ9 V;  1QR9 A;  3E35 A;  2EJR A;  4ZBM A;  1CEZ A;  1KEC A;  4WFB V;  1E1R G;  2HFE C;  2WLK A;  1Y4M A;  1PNL A;  4R8C A;  3ASN C;  4X89 A;  3SYQ A;  1F4M A;  1MOF A;  1R6N A;  2WLL A;  1M90 W;  4QE9 A;  1YSC A;  2DWD C;  3ZRX A;  4WFG A;  3UM7 A;  2ZD9 A;  4PDR A;  5L3B A;  5B1B C;  4RQF A;  1AJN A;  1YJW V;  1OCC C;  1SZT A;  3VOU A;  1B6Q A;  3OMI B;  4RAI A;  1NVP D;  1R3J C;  1AI7 A;  1EBO A;  2WLI B;  4PA9 A;  3OEH G;  3W7T A;  2XAF A;  3ZN1 A;  2V1D A;  3DGE A;  4R50 A;  2IU3 A;  5CBG A;  5IYC O;  1NR7 A;  4BIZ A;  2BOC C;  2XAQ A;  1YTF D;  1M9N A;  1R3I C;  2OCC C;  2JEX A;  3E8F A;  3OUS A;  1I5Y A;  1NQT A;  2H94 A;  2A0L A;  4UUJ C;  4PDL A;  2EIN B;  1WPX A;  2XOK G;  1E1Q G;  1N8R W;  1AI4 A;  3QO5 A;  3BY6 A;  3CPW U;  3RVZ A;  5H6R A;  1S72 V;  5EBL C;  4CBC A;  4RUF A;  1FFT B;  5LHH A;  2OTL V;  1DTO A;  4JGS A;  3SPC A;  5L3C A;  4RO2 A;  4BW5 A;  5LGT A;  2A9H A;  1VQK V;  1JJ2 U;  3TCU A;  3ABL C;  2NLJ C;  3AG1 B;  2JIZ G;  5B1A B;  2V7Q G;  3F7Y C;  1PNK A;  1QVF U;  2K1E A;  2UXN A;  5KA6 A;  4ZM5 A;  3B8N A;  1JQ0 A;  5B1O A;  3ZN0 A;  3CXC U;  4DO2 A;  2ZXW C;  4F4L A;  2EIL C;  2YEV A;  5C93 A;  3CCE V;  2DYR B;  4JTD B;  4WCE V;  4QPJ A;  3FB8 C;  1Q81 W;  2P6J A;  4Q20 A;  2IW5 A;  4N21 A;  1F51 A;  4MT8 A;  1W2B U;  1OCZ B;  1S5H C;  3WG7 B;  3IC7 A;  4LC1 A;  1FXK C;  1K92 A;  2EIM C;  4WFH A;  1OCR C;  3ABK B;  3G71 V;  5CBF A;  2PI5 A;  1ZWI C;  3JCZ A;  4MSW C;  3SYA A;  1PL0 A;  2WSS G;  3G6E V;  3GB7 C;  3P32 A;  3R65 A;  1F23 A;  5CBH A;  1YIT V;  2ZQM A;  2HJF C;  3TET A;  3WFV A;  5KUM A;  1SET A;  4MTX A;  1K73 W;  5CA3 A;  1VQ6 V;  1V55 B;  3B8M A;  1VQL V;  4JTA B;  1KKD A;  3T4D A;  1CP9 A;  1KC8 W;  2XAG A;  2Y48 A;  5LGN A;  1YIJ V;  1PD3 A;  1BMF G;  4PA6 A;  3CC7 V;  4JYC A;  1W0J G;  2QTO A;  4P9P A;  1MSW D;  3ZMU A;  2H8P C;  3SYP A;  3RW0 A;  4G28 B;  1DLB A;  2DQ0 A;  2X6C A;  4J9Y B;  4LCU C;  1R73 A;  3FYI B;  2DW4 A;  4H33 A;  3CCV V;  1PNM A;  2Y69 C;  3CCM V;  3T2M A;  4MVU A;  1OCO B;  3AG2 C;  2EIJ C;  3RVY A;  5L3E A;  1THZ A;  2ZR3 A;  1J95 A;  4R6Z A;  2GHY A;  4XDL A;  3E86 A;  3STL C;  3ABM C;  5B3S C;  1GM8 A;  2Q68 A;  4H37 A;  4YXW G;  2MK3 A;  1YJN V;  3OFN G;  2BOB C;  1LNQ A;  3LUT B;  2WLN A;  1Q86 W;  1FXK A;  3E83 A;  3K06 A;  4OXS A;  3CCR V;  3P30 A;  3JYC A;  3W7U A;  2B1I A;  3B8P A;  2Q6A A;  2DQ3 A;  2YSU B;  1HWY A;  5H6Q A;  3OAA G;  2WLH A;  5IY5 B;  3IGA C;  4G2K A;  3ASO B;  3ZRV A;  3K08 A;  1FXV A;  2HKO A;  1ARO P;  3K9A A;  3CCJ V;  3OGC C;  1NBM G;  3T1C A;  4MS2 A;  2DYS B;  3X2Q B;  1K97 A;  5IDJ A;  1FXH A;  1GTO A;  1K4C C;  2JDI G;  4GX5 A;  2QE7 G;  3AG4 B;  5KUK A;  1I5X A;  3SJQ C;  3ASN B;  4JTC B;  1XL6 A;  3H01 A;  2R9I A;  1M56 B;  1K8A W;  1GM7 A;  4UVC A;  1SRY A;  5HFM A;  1M57 B;  3STZ C;  1GM9 A;  2HG5 C;  1QVG U;  1PKX A;  2WPD G;  1ENV A;  3B8O A;  2X6B A;  2W6J G;  1L1F A;  3CD6 V;  3SPI A;  3MD0 A;  1DF5 A;  2W6I G;  4JAU A;  1JOY A;  2EIN C;  4Z1M G;  3CME V;  1KP2 A;  1CPY A;  3ML0 A;  3CCQ V;  1FS0 G;  5LHI A;  2LP7 A;  4QJF B;  2P90 A;  4MVR A;  1YHQ V;  3ETG A;  2DWE C;  4TT3 G;  1R6K A;  4BAY A;  5FL7 G;  2JEU A;  1K5Q A;  3G4S V;  4KFM A;  4HYO A;  4MW8 A;  5DM6 V;  1K3E A;  4GT1 A;  3AG1 C;  1NR1 A;  5B1A C;  3LDD A;  1VQ4 V;  4X88 A;  4TSF G;  1VQP V;  1BHA A;  4E29 A;  1H8H G;  3A0R A;  3ZMV A;  2XAH A;  3JD3 A;  1F4N A;  2EIK B;  3PJS K;  1KD1 W;  4P9O A;  1WLE A;  2ZDI C;  1GO3 F;  2DYR C;  2X0L A;  1AR1 B;  3D36 A;  5J9P C;  4XDK A;  4JAS A;  2OT5 A;  4UV9 A;  1VQ5 V;  1VQM V;  3ZRW B;  3OM3 B;  1RM1 B;  3I55 V;  2WLI A;  1OCZ C;  5L3F A;  3VBB A;  3WG7 C;  3OMN B;  3FYE B;  4DXW A;  4E2C A;  3OW2 U;  3ABK C;  5EC2 C;  1S76 D;  5LHG A;  3QO7 A;  3W7S A;  2ZR2 A;  2Z5U A;  4UV8 A;  3MHH C;  1ROP A;  3ETE A;  3JD2 A;  1M1K W;  4L87 A;  3I56 V;  4FIP C;  2HR3 A;  2ITC C;  1W0K G;  2WAM A;  4FPP A;  3OR6 C;  4LP8 A;  3SPJ A;  2IH3 C;  1RPO A;  2WLL B;  2HLD G;  3LSQ A;  2CK3 G;  2QEX V;  1V55 C;  5BZB A;  5L3G A;  1AJQ A;  4JYB A;  1K33 A;  4GX2 A;  1R3K C;  1H2G A;  3EHB B;  3K03 A;  2OTJ V;  3ZRS A;  3GWO A;  2IJI A;  4I5S A;  2R9R B;  2B5U A;  3QNE A;  2IH1 C;  4EKW A;  1JVM A;  4TWK A;  1OCO C;  2XAS A;  3JD4 A;  4LBE C;  2ZDI A;  3AEI A;  1YJ9 V;  1VQ7 V;  3ZJZ A;  1H8E G;  1AI5 A;  1V54 B;  4WFF A;  4U7O A;  4RUE A;  3JD0 A;  3CC2 V;  4U7N A;  3ZMZ A;  1NH2 B;  3W7W A;  1QLE B;  1XL4 A;  1R3L C;  4E2H A;  1K4D C;  3ZMT A;  4MVQ A;  2F43 G;  2ITD C;  1TUE B;  4ZKI A;  4RQE A;  3D3I A;  4R7C A;  3K0G A;  4BIU A;  2ATK C;  4PDM A;  3M99 B;  3AG3 B;  3ASO C;  5B3S B;  4FJC C;  4UVA A;  1KQS U;  2X7R B;  1VQO V;  4GX1 A;  2DYS C;  3X2Q C;  2KB1 A;  1GMG A;  2X6A A;  1P7B A;  1BHB A;  3AG4 C;  3E8G A;  2M7W A;  3CMA V;  1KP3 A;  2Q69 A;  2Q67 A;  3OEE G;  3SYC A;  2Z3Y A;  1EZJ A;  2QM8 A;  2A79 B;  1M56 C;  5LGU A;  1NVP B;  4QNH B;  4QIW F;  1JCH A;  1M57 C;  2HVJ C;  3T4Z A;  5B1B B;  3F7V C;  2YEV B;  1OCC B;  4J9Z B;  1DF4 A;  2UXX A;  1JX9 A;  4I9W A;  1QLN A;  1MAB G;  1YTF B;  3RBZ A;  2IJJ A;  3JD1 A;  1Y66 A;  4X8A A;  1GK9 A;  3LDC A;  5H9C A;  5CMU A;  3LNM B;  3CP1 A;  2XND G;  4JPR A;  2EBO A;  1H38 A;  4MTF A;  3FKS G;  4PA4 A;  5IYD O;  3CYO A;  3FB6 C;  3K3W A;  4GCZ A;  1VQN V;  2OCC B;  3F5W C;  1Q7Y W;  4QE7 A;  4PA3 A;  1JPX A;  2HVK C;  3B77 A;  1OZ0 A;  4KP4 A;  3OUF A;  2PI4 A;  4MVZ A;  2EZO A;  3E89 A;  4XBF A;  2JJ2 G;  5KA5 A;  1G8M A;  3QO8 A;  3SPG A;  2NNU A;  5B1N A;  2W0F C;  3K0D A;  4WFA V;  2C2A A;  4QPK A;  2D3O W;  4ZM1 A;  2EIK C;  3BEH A;  1K34 A;  2QM7 A;  3ABL B;  2AHY A;  2LFR A;  3ETD A;  4UVB A;  3ABU A;  1K9M W;  1K7D A;  3KG2 A;  2P67 A;  4P30 A;  1NKD A;  4MTO A;  5EBW C;  4MVS A;  1COW G;  2JK5 C;  3IFX A;  3OR7 C;  1VQ8 V;  5E1A C;  1AI6 A;  1RM1 C;  1AJP A;  4JF3 A;  3EFF K;  2ZXW B;  5LBQ A;  4MW3 A;  2EIL B;  5GW7 A;  3MHS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...