3B8MA

Structure of fepe- bacterial polysaccharide co-polymerase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
255
Chain Sequence
KWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Ferric enterobactin (Enterochelin) transport
total genus 88
structure length 255
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b8mA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 3b8mA01
4ZM5A 3H01A 4E29A 1I5XA 2M7WA 1QCEA 1QR9A 3MHHC 4G2KA 1I5YA 3K9AA 1DLBA 4JGSA 3WFVA 3B77A 3B8PA 2EZPA 5HFMA 1EBOA 3B8NA 3B8MA 2MK3A 4E2HA 5KA6A 1DF4A 4ZM1A 1MOFA 1JPXA 2P6JA 3CYOA 3M99B 4JF3A 4JPRA 1QR8A 4E2CA 1Y4MA 4FK5C 1ENVA 4N21A 1QBZA 1DF5A 1JQ0A 2EBOA 1SZTA 2OT5A 2X7RB 3MHSC 4FIPC 1Y66A 5KA5A 3B8OA 4FJCC 2EZOA 5H9CA 4E2LA 4N23A 1K33A 3GWOA 1K34A 1MG1A 1F23A 5CMUA 5HFLA 3CP1A 3P30A 2LP7A 5CN0A
chains in the Genus database with same CATH superfamily
1H2LA 3CCSV 2YI8A 1XUQA 2P90A 3ABKC 3ZEDA 1KC8W 3B40A 2YUAA 2BOCC 3T1CA 4JASA 3O65A 3LDEA 4P9PA 2JS3A 4I0XB 1U97A 2ZCEA 1RFYA 1AR4A 4DV5O 3UCSC 2M6YA 1MG1A 4LF5O 1WJZA 4LFBB 2P4KA 1Y74A 4BAYA 4B3MB 4QJFB 3IC9A 4DR2O 3ABMC 3RYCB 3CSXA 4TOIA 2BTOA 4O2BA 3K04A 4PDMA 3AK3A 4JI6B 3A8TA 2WLIB 5F2VO 1KKCA 3BY6A 4GT1A 5L3EA 1Q90D 4AQYB 4O4JA 3OEHG 3P30A 4J11A 4E2LA 4UCUA 3K03A 4LFAB 3APOA 1PD3A 3K5MA 5KAFZ 4CS2A 4DK0A 2C2AA 3N2KA 2P6JA 1QVGU 4WFBV 3X2QC 2PGGA 1TUBB 2PYJA 4O4LA 4QE9A 1HNWB 4DR7B 1F4MA 3JALA 1BSMA 2VS0A 4WBNA 3VQWA 3K5OA 2V7QG 3ZRWB 2EULA 4CH4A 4EFEA 2EILC 1YEWA 2E5LB 1N0JA 3K0GA 4NTYA 1S5JA 1XEQA 2K1EA 4I5SA 1H8EG 1SA0B 4WFFA 2B9ZA 4GUNA 3HKBB 2HHHO 4MVSA 1M90W 2ILMA 2ZKOA 4JGSA 5L3DA 5KX5A 4WF9V 3P32A 4RO2A 3T1HO 2YICA 5CA0B 2W0FC 1W2BU 3B4SA 2YIBA 3UT5B 4N23A 3KCYA 2D3OW 4X65B 2EIKB 3HKCA 3K5NA 2Q68A 1N34B 1EN4A 3H9VA 3G6BA 2ZE6A 1NR1A 3ZX6A 4J41A 1K3EA 4ZKIA 5L3GA 2VQFB 3HKEB 3JYCA 4O2AB 1F7YA 1K34A 4UB6Z 4X62B 2F93B 5LGTA 2LP7A 4YHHO 5EC2C 4LF7O 4DRXB 2UUBO 2QKSA 3A0HZ 4WBNB 2ADQB 2EINC 4PDLA 2NLJC 1XI1A 3MAQA 2KG7A 3H1KH 2Y4TA 4MTOA 4HZ3A 4W4LA 3RGBA 1U96A 2VWKA 1IXBA 4HNAB 3P3NA 4YJ2B 2FMLA 4K8XA 4UV8A 2CK3G 1MA1A 3J81N 1E1QG 5LL6Y 3AK2A 5B66Z 4K8ZA 2BCCH 4P30A 3W7XA 4JI7O 3E8GA 4GX1A 4IYHA 3DGEA 2H8PC 4PA9A 1AP6A 5LOVA 3RFRA 4ZIBA 2PUSA 3CEIA 1SF9A 3BCCH 5CB4A 2Y0PA 4DR7O 1SKVA 2HKOA 3K58A 3ASNB 3ZHTA 1KP2A 1I94O 2Q9LA 3TXQA 4FFBB 1VQ6V 1OCCC 2Y69C 1EBOA 2UUCB 5IE9A 3LDDA 4NTWA 1VQNV 4D6TH 4I50B 2HEPA 2XAJA 1X59A 4J7JA 1G4YB 4TQDA 3U10A 2WPDG 4PA6A 1FS0G 2GBOA 5A2QN 2CTQA 4YJ3B 1PV0A 2F4VB 2EIMC 3HR0A 4DRXA 2WSSG 4JAUA 1GN2A 3EXAA 3OUFA 2OYQA 2RMKB 3RYIA 2UXNA 2WLJA 1D5AA 2KB1A 4O2AA 2NN4A 2P06A 3CRAA 3JD0A 3GWKC 2QKAA 1GAXA 1R73A 1KUQA 2Q7HA 4I9QA 1R6NA 1AJPA 1PL4A 3RYCA 3I56V 2K9PA 2CH7A 3OW2U 4DV1B 5IJ9A 1UFIA 4YY3B 3CCUV 2Q7GA 1LUWA 3E8HA 5JJJB 5LMNB 2P22C 5H5NA 4BR6A 2ZR3A 4WFAV 3S3XA 1ZL8B 4K35A 1OV9A 3CYOA 5FL7G 4Z2WA 2LJ2A 5CA1A 2A9HA 2P7TC 2ZNJA 3E89A 4DUYO 1WPXA 4O4IA 1I7FA 4J80A 4FLTA 4OXSA 1SQBH 4B3MO 1M56B 2OIEA 4QNHB 4JI8O 2ZQMA 4J7ZA 2BE3A 1BQZA 4JI4O 2OTJV 2QM7A 3ZRWA 1VQPV 1IBLB 1OCCB 3B8NA 2P5OA 2W6JG 2Q6AA 1LR1A 1EM1A 3ASOC 1HNXO 4GYCB 4J9YB 2EIKC 4TT3G 1AJNA 2JRIA 1RSOB 3MD0A 3ZHQA 3CCVV 3MHHC 5FPRA 1JOYA 4E4EA 1ZWIC 3ZMVA 1QLEC 1DF4A 2UUCO 2EJRA 1ENVA 5FPOA 2QGNA 2WLMA 3MDSA 4UCOA 2DWEC 2L6LA 3ASNC 3E22B 3P3PA 1AI7A 3CC7V 2LFSA 3EFFK 1FKAO 3JSLA 2DWDC 1QCEA 5B3SB 1OCOC 4CH3A 5B5EZ 4IT5A 4QGPA 3AG3B 3FFQA 3ZS8C 1MNGA 2YIBD 2QWRB 1FD9A 5KMGA 4O4HA 4X66O 3QO5A 1BGYH 4ICGA 3E35A 3STZC 4JAVA 2XT9A 3A2FA 4MTXA 4MVMA 2HHHB 4J42A 4F6RB 1NTMH 1KP3A 4UCVA 1JJOA 3FYEB 3JARA 1YTFD 1JCHA 5EBWC 4RUEA 4JPRA 3ABMB 2Q73A 1IBKB 4FIPC 4P2ZA 2H3OA 3ZHUA 4DYLA 4R50A 2OCHA 1WP8A 1P7GA 4DV0B 3TXSA 4B3RB 4C7UA 2HVKC 2KG7B 4FZ0A 1XMOB 3RBZA 2Q8VA 2YXYA 4YJ2A 4NVPA 3T4DA 5LXTB 4OX9O 1XNRB 3RT3C 5LP6B 2IBZH 3K9SA 3TGUH 5BR8O 3SR2C 2RNBA 2EX3A 3O9OA 5IWAB 4DR1O 5HFLA 1NZ6A 4LFBO 3JCUZ 5CA1B 2Q69A 5EIBD 4LF7B 1Q7YW 1OCRC 3KZIZ 4CZZA 3SDLA 4EB6A 4FMTA 1KBHA 1Q8IA 2N04A 2X7RB 4CC6A 4DK1A 3CCMV 3OUSA 3CRQA 4BIUA 2JIZG 3K08A 1YJ9V 3JAWA 1N8RW 4JI5O 1EN6A 3OGIB 3CD6V 2UXDO 3RVYA 4ASUG 2ZXWC 3F7VC 2ZM6O 3G71V 4U7NA 3Q4HB 5C93A 2WLLA 4LNUA 4YJ3A 2HG5C 4LH6A 1NJIW 5BXZA 5KHGA 3IFXA 2YEVB 4JI3O 2ITDC 4UVAA 1N4CA 5IDJA 2R9RB 3DC5A 1KD1W 1G8MA 2ZE8A 4QE7A 4I4TB 1HNWO 1AP5A 2YXLA 2IU3A 1AR1B 3W7UA 1V54B 1QVFU 4KL1A 3K59A 2QKCA 1RM1C 4XDKA 1Q6HA 3THOA 1SQQH 3BFRA 1AB3A 4NXNB 2RCVA 1Y4MA 1N36B 2PZSA 1N0NA 3ZHSA 1AI4A 4JYCA 3WU2Z 4LF6O 5JCOC 3GVMA 1FXVA 3UO3A 1XREA 1M9NA 1BS3A 5IJ0B 2OWOA 3WFVA 4YIOA 1NH2D 3CMEV 1AROP 4X1KB 3AG4B 1EN5A 2V4DA 4JI7B 1MSWD 2B1IA 3CRCA 3OMAB 3CJHB 5LP6C 2IJKA 4X1IB 4B3SB 1COWG 3GWOA 1VQ5V 1O9HA 5B1AB 4H33A 2QA4V 4I55A 1YVWA 2FTKA 4IYIA 3SJQC 5DEDA 4HNAA 3CCJV 3BABA 3ZMTA 3JD2A 3CX5F 4N21A 2WLLB 4BIOA 3K5LA 3ZRSA 4D7SA 4GLXA 5DM6V 1K4CC 2YEVA 2DYSB 4YY3O 2FKXA 3SJCC 2XAGA 1H2KA 1XDCA 4YHHB 4E29A 3K0DA 2A7WA 2LGQA 2UXCO 2PTMA 4FFBA 3T1HB 2F1MA 1RPOA 2OIGA 1OCZB 1HNZO 2GUZB 1XL6A 5LHGA 3D3IA 3HKCB 1S77D 2BSKB 4K0KO 1RP3B 3KKYA 1VF6C 1RPRA 4O4HB 1Y76A 1L1FA 2E3CA 1N34O 2HJDA 2IJIA 4OPAA 1K73W 2UXDB 2A79B 4JI8B 4LWSA 2N74A 3JATB 1P49A 4FVMA 1V54C 4WFHA 4PDVA 1NKDA 4GX5A 3JD3A 2W6IG 4RAIA 1H2MA 3RYFA 3DSQA 3T2MA 1K33A 2CUGA 2KQXA 3J7AU 2CTWA 3OE7G 4PJ0Z 4DR5B 1BHAA 2AXTZ 1IX9A 3H1HH 3B2EE 3RYIB 5LMNO 5D5QA 1WB8A 2ZT9B 2UXXA 3AK1A 5EZYB 3CXCU 2VQFO 1R6TA 2GDSA 5LXTA 1WAZA 4BW5A 3B8OA 1ROPA 3LSSA 1M57B 2CH7B 1S72V 2JEUA 2RN9A 1G6UA 1NH2B 3E8BA 4FLYA 1DLBA 4NXMO 3R66A 4UVCA 4X9QA 4PELA 4DW1A 5JWPA 1I0HA 4L8JA 1AJQA 3IGAC 3C3SA 4UV9A 1GM7A 5IYZA 2QWQB 5IYDO 2FYUH 2WLNA 4O4IB 2Y69B 3FB8C 1WP7A 3ZHRA 3IJ4A 2QWPB 4P9OA 2DE0X 5EYPB 3ZIAG 3N2KB 3UQ8A 1NVPB 2BTQB 1OJHA 2ZDIA 1M56C 3ABKB 4EKWA 3N27A 1ZX3A 2Q4PA 3U11A 1Z5VA 4DR4O 5D5PA 2ATKC 2AGAA 2HVJC 3ABUA 2QM4A 1EFRG 2XUMA 2DN9A 1KU9A 4L87A 1I94B 2YS8A 2GTSA 5ITZA 3ETDA 1HR0O 5EBMC 2YIDA 5HFMA 1SS3A 1XNQB 2AHYA 1DGSA 4LNUB 2Q5ZA 4RQEA 3H1JH 1XQ8A 5IY5C 1S0VA 2IH3C 1VF6A 2WA4A 1WNSA 2GUZA 3D3QA 4FLXA 1I08A 3ZJZA 2RDCA 1NS1A 1PL0A 3BA9A 4PI2A 3LDCA 2FB5A 4B3TO 3UM7A 3C90A 5B3SC 1YI2V 4LWSB 1H2GA 3AG7A 1HNXB 1Y74B 5KHJA 3ETEA 4DV3B 4H44B 2GV9A 3IAYA 4X1IA 5KMGB 4ZM5A 3RYFB 1ZUQA 3CHXA 1K8AW 1ZL8A 1QR9A 4MVRA 3T1YB 3N2GA 1QHTA 4JI0B 4MT8A 4LF8O 1MZEA 4IL6Z 3AG1B 3JALB 4MS2A 3NR7A 2MW2B 5IYBO 4IHJB 2OT5A 3ML0A 5IWAO 3B09A 4DR1B 2F43G 1WPBA 2CTPA 3FAVB 4UFZA 5CA3A 1X4TA 4H37A 1DK1A 4IIJB 2UUBB 1I5YA 3W7TA 2LGWA 4UVBA 1R6KA 4JI4B 1PP9H 2ITCC 2XAFA 1KECA 3SGIA 4FLUA 5JVDA 2JJ2G 1N36O 1NQTA 5H6QA 1PNKA 1B06A 2LW7A 1F23A 3SPJA 4DV2O 1AI5A 4X88A 4UCTA 1B3QA 5CA0A 1GRJA 1Z2GA 1VF5B 4H0LB 2XNDG 1KMIZ 2WWWA 3LUTB 3R65A 3D36C 2JGDB 3QF7A 2DW4A 3S3WA 4JZGA 3SJBC 5JQGA 5KLVH 4MVUA 1FXKC 5CN0A 5IY5B 3ZRXA 1S5HC 2L35A 2F23A 2QE7G 1VQ9V 1D2DA 4LFCO 3BAAA 1BE3H 5KA6A 2YC0A 4GX0A 3N2GB 3CCQV 4OX9B 3SJAC 3UO2A 4D7TA 2HP8A 5LHHA 1SA0A 2RQ6A 3L9DA 4RUFA 4X66B 1JJ2U 4IHJA 1AILA 2P4VA 2G38A 4DUZB 3JD4A 2W0XA 1NVPD 4LP8A 2F66C 1BL8A 4HYOA 4DR3B 4XBFA 1MOFA 3ABLC 4WFEA 2UUAO 4X1YA 4Q20A 4FK5C 4KHPB 1H2NA 2LQTA 5H9CA 4DUYB 3ZN1A 3FD9A 4FLWA 4R8CA 5CMUA 1K4DC 4DV6O 3W7SA 3JAKB 2ZE5A 4ZI7A 2ZM6B 3G4SV 3CWBH 4JI0O 3HKEA 3ZCCA 3B8MA 2PYLA 1R3IC 1JPXA 2NR5A 3QO8A 3ZBHA 3QNEA 4Z1MG 3MHSC 5BR8B 4CS4A 5IJ9B 2R70A 2CGNA 3OTOB 3M7MX 1Q6IA 1SQVH 2YXHA 5KHKA 4PHZA 1ZSPA 3FB5C 1P4RA 4ZHQA 4JAAA 4QIWF 4I55B 5B1BB 4X20A 5LYJB 3ETGA 1R3JC 2E76B 4LBEC 2YI9A 1QLNA 3CB2A 1RSOA 1J5EB 3WB0A 2X6AA 4UUJC 1YJNV 1HW7A 1IBMB 5KHIA 1I5XA 3BEHA 4LH7A 1KKDA 2Q67A 2QWNB 4FM0A 1QNMA 4DR6O 4DV4B 2PI5A 1K5SA 3L74H 4FLVA 4U3JB 3CS5A 3AG2C 5EYPA 2BTQA 2E75B 1GKFA 3HKDA 3RYHA 4UXNA 2CGOA 1R3KC 1SQPH 3WG7B 1VQKV 4TWKA 1RM1B 3LNMB 3QO7A 1NT2B 1F4NA 3RVZA 4CS3A 1KYOF 4DXWA 1EZVH 5KAIZ 5AG2A 4TUYB 1H38A 1OZ0A 4MVOA 3JCZA 1XHXA 5ITZB 5LA6B 1FFXB 4NYKA 2EBOA 3E22A 2GSMB 4FFKA 2UU9B 1JX9A 4I0XA 1MABG 4UCSA 5DECA 1M5IA 2IM9A 4JYYA 3BA8A 2IJJA 2UXBO 3WB1A 2KSDA 4ZBMA 1SC5B 1FJGB 1HNZB 2CE4A 1B6QA 2P67A 1K97A 1MSDA 3AG3C 3DTUB 4NKGB 4TV9B 5DN6G 4B3SO 5BMVB 5J2TB 1W59A 3E83A 3SYAA 4O4LB 5KHHA 1HWYA 1M57C 4O4JB 2WA3A 1TA8A 2YSUB 2CTRA 1TVKA 1O9GA 1IURA 4GX2A 2DYSC 4QPJA 1Y67A 1XHZA 1FXKB 3BVOA 1NTZH 2LFRA 3F7YC 3ABTA 1KB9F 4LF4O 3DC6A 4EB6B 1XMOO 1Q43A 5CBFA 3X2QB 2Y4UA 4TV8A 1GN6A 3HB3B 2DYRB 1YDXA 3CCLV 4GKJB 2XAHA 1XNRO 2JK5C 3JAWB 4K0KB 1UPGA 5L3BA 2ADPA 3J80N 4DV7B 3I55V 3WG7C 2R9AA 3GB7C 5J2UB 4DO2A 2ZE7A 1QU7A 2LO1A 3FX7A 3OTFA 3SPGA 1CPYA 2V1DA 3SPIA 5LMUO 2JJ1G 4NXNO 1DF5A 1WA8B 1XBLA 1XL4A 1N32B 1M1KW 1AVMA 1FXHA 1WLEA 4I4TA 4NTXA 5JCOA 1MZFA 5JQGB 1OCOB 3HKDB 2B1GA 1BT8A 4X1KA 2QDOA 1T5EA 3PJSK 3RWRD 2IH1C 1P84F 1Z5WA 4IGGA 3JASA 1SZXA 3BHPA 2A3QA 4JI1B 1YHQV 3OMIB 4Q6GA 1P7BA 1WN7A 1BZKA 2XASA 2EZOA 1M4UA 3ZHVA 5CBHA 4LF5B 1TUBA 2VQEO 5E1AC 1FFXA 1YSCA 3I5DA 1IZ3A 1L8DA 1SERA 3G80A 5C8YB 2X0LA 2ZIMA 3JARB 4KFMA 4CH5A 1K5QA 1CP9A 5GONB 2EILB 3CJHA 1NI8A 4PI0A 2JS5A 1FJGO 4FJCC 4AQYO 1K92A 2IJHA 4G28B 5FLXN 4LF6B 4DV2B 2ZDIC 4GKKO 2N05A 4UB8Z 1GH6A 5FNVB 1PM9A 1SETA 1H2SB 3NXSA 4IIJA 2ZINA 2PI4A 2ZNIA 4JYAO 1LNQA 2DMXA 1NTKH 1ZAUA 4DR4B 3JAMN 3EHBB 1Q5OA 2H94A 1AI6A 1ZLZA 1HR0B 2ODMA 5LP6A 2XOKG 1KQSU 2EIMB 1GK9A 4GCZA 4I9WA 5IYCO 2VWJA 3UKMA 4OGQB 3OAAG 1V55B 3H1IH 3OD4A 5B1OA 2AHZA 4DV5B 3UT5A 4K3AA 2DOSA 1F51A 4DR5O 2EIJC 2LW1A 3RYHB 2DQ3A 3W7WA 4F4LA 4I50A 2DYRC 5CBGA 3OMNB 5EZYA 3E8FA 5A9GA 3CE2A 4B3TB 2QR4A 2EINB 3OM3B 4DR3O 1VIBA 2UXCB 3L73H 2E74B 1XNQO 4TUYA 4BIZA 3K57A 5LMUB 1TUEB 5J2UA 1JFFA 4AILC 5LGNA 1TAEA 1OCZC 1N32O 4DV3O 4YXWG 5J2TA 3CC2V 4LFAO 5H2FZ 3T4ZA 3DXRB 3B8PA 2QTOA 4XDLA 3WB2A 4JTAB 3ZRVA 4FZ1A 3ICXA 4J9ZB 4JI6O 5KUMA 3ZMUA 1QBZA 1WB7A 1SZTA 3K79A 1PKXA 1YXBA 3STLC 5EC1C 3T1YO 1NR7A 4LF8B 3C3TA 3B77A 3BPZA 1GN4A 4JI2B 1Q86W 2HJFC 1S76D 4E2HA 4PDRA 2IU0A 5GONA 2Z3YA 4W4KA 3TETA 3IC7A 2DQ0A 3ASOB 4MTFA 4U3FH 3SYCA 4JYBA 1W0JG 4TV9A 5LOVB 4GKKB 2WLHA 4MVZA 3K9AA 4NR1A 4FLZA 4NXMB 4DR6B 1BQ0A 1HDJA 1M93A 2Q0AA 2F4VO 1AR5A 1JVMA 4ZM1A 4TV8B 4EFBA 4UCRA 3A0RA 1QLEB 4B7KA 3OGCC 4B7EA 2HFEC 3SYOA 3CRRA 5JH7B 5LBQA 1VF7A 1A32A 1GTOA 4X65O 2QM8A 4KP4A 4QPKA 4G2KA 2EJ7A 1N33O 2X6CA 4FM1A 4TQFA 1XMQO 2QEXV 1YIJV 1UJWB 4BWAA 5KX5B 3DXRA 3M99B 4CC5A 3JASB 2QJ1A 3QVNA 4H13B 3K06A 3VQVA 1Y76B 3AG2B 5JJNB 1W0KG 2OTLV 2AZ2A 3CRMA 1CXZB 1GM8A 3ABLB 1JMKC 1VEWA 4LFCB 4JTCB 1V55C 5K1PA 1LUVA 4CBCA 4WFGA 4GKJO 1QR8A 2YIAA 4JF3A 4ZOLA 2O57A 1JA8A 1K7DA 3LNNA 1GN3A 4TSFG 3SYQA 4DV6B 1VP7A 3G6EV 4I7ZB 1JR9A 2HR3A 3CC4V 4FPPA 1Y6XA 5L3FA 3F5TA 1IBLO 1BHBA 4J7KA 3L70H 2PY5A 4KHPO 2NNUA 1Q81W 3HPLC 1VMGA 5EBLC 4DV1O 3M8AA 4Z1VA 1PPJH 2DJVA 4MTGA 1L0LH 5BMVA 5JH7A 5LHIA 4LF4B 1VQ8V 4EEQA 2JGDA 3VQYA 4LC1A 4LF9O 2AW9A 4RWUA 2QSAA 5FNVA 4JI2O 2XAQA 4NB5A 5J9PC 2KKWA 1SESA 5H6RA 3ETQA 2GHYA 3OR6C 2ETNA 4X62O 4HBNA 2EIJB 2VQEB 4PA4A 1FXKA 4PA3A 1YJWV 3APQA 2M7WA 2HLDG 2B5UA 1YF2A 2Z5UA 3SPHA 3AEIA 3BRCA 4E2CA 4X64B 1Q82W 4MW8A 3OEEG 1Y66A 2ZD9A 1VQMV 2VRZA 2ARHA 2CAZC 3CP1A 4PV1B 3SPCA 1GO3F 2XTAA 2XHBA 4R7CA 1VQ7V 1BMFG 3LSUA 2A0LA 4F6EA 1TGOA 3E86A 2WLIA 4DUZO 1N33B 4BW9A 2CDYA 1PNLA 1B04A 3CPWU 1J95A 1IBKO 1S3JA 3CXHF 3Q4HA 4KUMA 4JV5B 2IW5A 2UU9O 5IT9N 1XOUA 1R1BA 2OCCC 1WA8A 1JFFB 2ZIOA 4AI8A 2JVDA 4HAMA 4DW0A 1SQGA 3D36A 3TJTA 1IDSA 4O2BB 4XDJA 2EZPA 2MK3A 2E5LO 4F6RA 1YTFB 5KUKA 3FB6C 1Q3EA 1SQXH 2RJZA 5JJEB 5E79Z 4U7OA 4LCUC 1OCRB 4MSWC 1TVKB 2D2CB 1SQFA 5JVDB 3TCUA 1SRYA 1DTOA 2GTAA 3AG1C 3OFNG 4JYAB 3SYPA 2UUAB 3CMAV 4KXRA 4X89A 1MMMA 2QWOB 3A0BZ 2WAMA 1IXMA 3FAVA 4DV0O 3JAKA 2JDIG 3HKBA 3H1LH 4PD4F 4ZI7B 4B3RO 2ZXWB 4X8AA 3VQXA 3L71H 3AG4C 5L3CA 1YZBA 4U3JA 4RQFA 4LF9B 4J10A 2Y0IA 1Q6UA 4R6ZA 5B1NA 1JQ0A 5KA5A 1E1RG 1NBMG 4YIPA 1ZTEA 3OTOO 3VBBA 4JTDB 3K3WA 1GM9A 5BY1A 3U0ZA 1FAFA 3H01A 1K9MW 1BCCH 1ORQC 3L75H 2Y48A 4X20B 3TK1A 5BZBA 2R72A 3D8CA 1L0NH 4JZ2A 1OHHG 1URFA 3OT7A 4A5UB 3CCRV 1QQCA 2WLKA 4X64O 3ZMZA 1NU1H 1J5EO 3PN1A 3RN4A 2YDEA 1IBMO 1US6A 1YCIA 1R3LC 4DV7O 5K1XA 2OCCB 4DR2B 2QTSA 1E79G 1H8HG 3ZMSA 3ZN0A 4X1YB 1CEZA 1EZJA 5LGUA 1IVSA 2Q0OC 4DV4O 3E2EA 1YITV 5LA6A 3QG5A 1FFTB 5EIBC 3JATA 5GTHZ 3OR7C 4JI3B 2F95B 3KCXA 4JV5O 3LSQA 5B1AC 1FYJA 5C8YA 2ZR2A 1XILA 2R9IA 2Q7EA 4LR3A 3KG2A 4GZRB 4AHCA 1XMQB 4PA7A 4JI1O 4OPHA 5IJ0A 1VQOV 1VARA 5CB4B 2JGUA 4ZHQB 2Z0AA 5B1BC 3L72H 3VOUA 5GW7A 3G67A 1D5NA 3FKSG 1PNMA 3FYIB 4ZOLB 1S5LZ 2X6BA 4FM2A 1THZA 4MW3A 2PF4E 1G1XB 2UXBB 2FL4A 4WCEV 1VQLV 4MVQA 1FPOA 5EK0A 3F5WC 3QTCA 3EVKA 4JI5B 2BSKA 4CH6A 5GTIZ 5IYZB 2AZ0A 1HP8A 5LYJA 2A06H 2JEXA 3FB7C 3RW0A 1V9PA 4G27B 4B08A 3CCEV 1GMGA 5TISZ 3JD1A 2BOBC 4ABMA 1VQ4V 3JSNA
chains in the Genus database with same CATH topology
3ZRXA 5EC1C 3CCSV 1S5HC 2P90A 3ABKC 2QE7G 1KC8W 1VQ9V 1NR7A 3RBZA 3B77A 2BOCC 3T1CA 4JASA 3T4DA 1Q86W 5KA6A 4GX0A 2HJFC 3LDEA 4P9PA 3CCQV 1S76D 4E2HA 4PDRA 2IU0A 5LHHA 2Z3YA 3TETA 3IC7A 4RUFA 2DQ0A 3ASOB 1MG1A 4MTFA 1JJ2U 5HFLA 3SYCA 4JYBA 1W0JG 4BAYA 2Q69A 4QJFB 2WLHA 4MVZA 1Q7YW 3K9AA 1OCRC 3JD4A 4CZZA 3ABMC 1NVPD 4LP8A 1BL8A 4HYOA 1JVMA 4XBFA 4ZM1A 4FMTA 1MOFA 3ABLC 3K04A 4PDMA 4WFEA 2WLIB 3A0RA 1QLEB 4Q20A 3OGCC 4FK5C 2HFEC 2X7RB 3BY6A 4GT1A 3SYOA 3CCMV 3OUSA 5L3EA 4BIUA 5H9CA 3ZN1A 2JIZG 3K08A 1YJ9V 1N8RW 4R8CA 5LBQA 5CMUA 3OEHG 1GTOA 3P30A 1K4DC 4E2LA 3W7SA 3CD6V 3K03A 2QM8A 5LHGA 3RVYA 4ASUG 4KP4A 1PD3A 2ZXWC 3F7VC 4QPKA 4G2KA 3G4SV 3G71V 2X6CA 4U7NA 5C93A 2WLLA 2C2AA 2QEXV 1YIJV 3ZCCA 3B8MA 1UJWB 1R3IC 1JPXA 2HG5C 3QO8A 2P6JA 1QVGU 3M99B 3QNEA 4Z1MG 1NJIW 4WFBV 3IFXA 3X2QC 3MHSC 2YEVB 3K06A 2ITDC 4QE9A 4UVAA 5IDJA 2R9RB 3AG2B 1KD1W 1W0KG 1G8MA 2OTLV 4QE7A 1F4MA 3FB5C 2IU3A 1P4RA 1GM8A 3ABLB 1V54B 1AR1B 3W7UA 1QVFU 2V7QG 3ZRWB 1RM1C 4XDKA 4QIWF 4JTCB 1V55C 5B1BB 2EILC 4CBCA 4WFGA 1QR8A 1Y4MA 3ETGA 4JF3A 3K0GA 1R3JC 4LBEC 1QLNA 1AI4A 4JYCA 1K7DA 2X6AA 2K1EA 4I5SA 4UUJC 1YJNV 4TSFG 1H8EG 3SYQA 1FXVA 3G6EV 4WFFA 1I5XA 3BEHA 1M9NA 1KKDA 2Q67A 4MVSA 2HR3A 1M90W 3CC4V 4FPPA 4JGSA 3WFVA 5L3DA 5L3FA 1NH2D 3CMEV 1AROP 2PI5A 3AG4B 1K5SA 3P32A 4WF9V 1BHBA 4RO2A 3AG2C 1MSWD 1W2BU 2W0FC 2B1IA 2NNUA 3OMAB 1Q81W 3HPLC 1GKFA 4UXNA 4N23A 5EBLC 2IJKA 1COWG 3GWOA 1R3KC 1VQ5V 2D3OW 3WG7B 1VQKV 4MTGA 4TWKA 5B1AB 1RM1B 2EIKB 3LNMB 3QO7A 4H33A 2Q68A 5LHIA 2QA4V 1VQ8V 1F4NA 3RVZA 2FTKA 4DXWA 1NR1A 4LC1A 3SJQC 1H38A 1OZ0A 3CCJV 4MVOA 2XAQA 1K3EA 3JCZA 3ZMTA 4ZKIA 5J9PC 5L3GA 3JD2A 4N21A 2WLLB 2EBOA 3JYCA 1SESA 5H6RA 2GSMB 2GHYA 3ZRSA 3OR6C 1K34A 5DM6V 1JX9A 1K4CC 2EIJB 2YEVA 2DYSB 5LGTA 2LP7A 4PA4A 1FXKA 1MABG 2XAGA 5EC2C 4PA3A 1YJWV 4E29A 2M7WA 2QKSA 3K0DA 2IJJA 2HLDG 2B5UA 2Z5UA 2EINC 4ZBMA 3SPHA 3AEIA 4PDLA 2NLJC 1RPOA 1OCZB 4E2CA 1Q82W 4MW8A 1Y66A 1B6QA 1XL6A 3DTUB 1K97A 2P67A 2ZD9A 3AG3C 3D3IA 3OEEG 5DN6G 1S77D 1VQMV 3SYAA 3E83A 3CP1A 4MTOA 1RPRA 4HZ3A 1GO3F 3SPCA 1L1FA 2IJIA 4R7CA 1K73W 1VQ7V 1BMFG 1HWYA 2A0LA 2A79B 1M57C 3E86A 2WLIA 4UV8A 1V54C 2CK3G 2YSUB 4WFHA 4PDVA 1NKDA 1PNLA 4GX5A 1E1QG 3JD3A 2W6IG 4GX2A 4RAIA 4P30A 3W7XA 3CPWU 2DYSC 3E8GA 4GX1A 4QPJA 1J95A 1S3JA 3DGEA 4KUMA 2H8PC 4PA9A 3T2MA 1FXKB 2IW5A 1K33A 2LFRA 2OCCC 3OE7G 3F7YC 1BHAA 3ABTA 2HKOA 4HAMA 3D36A 3ASNB 1KP2A 1VQ6V 1OCCC 5CBFA 3X2QB 4XDJA 2EZPA 2Y69C 3HB3B 1EBOA 2DYRB 2MK3A 2UXXA 3CCLV 2XAHA 3CXCU 2JK5C 3LDDA 4BW5A 1YTFB 3B8OA 1VQNV 5KUKA 1ROPA 3FB6C 2XAJA 3LSSA 1M57B 1G4YB 5L3BA 2WPDG 4PA6A 1FS0G 3I55V 1S72V 2JEUA 3WG7C 4U7OA 4LCUC 1OCRB 4MSWC 3GB7C 1NH2B 4DO2A 3E8BA 1DLBA 3TCUA 1SRYA 2EIMC 1DTOA 3SPGA 1CPYA 2V1DA 4UVCA 3SPIA 3AG1C 2WSSG 3OFNG 2JJ1G 3SYPA 4JAUA 3CMAV 4PELA 4X89A 1AJQA 3IGAC 1DF5A 1XL4A 4UV9A 1GM7A 2WAMA 3OUFA 1M1KW 1IXMA 1FXHA 1WLEA 2JDIG 2UXNA 2WLJA 2KB1A 5IYDO 2ZXWB 2WLNA 2Y69B 4X8AA 1OCOB 3FB8C 2B1GA 3AG4C 5L3CA 3JD0A 3PJSK 4P9OA 2IH1C 3ZIAG 4RQFA 1NVPB 1R73A 2ZDIA 1M56C 3ABKB 4EKWA 4R6ZA 5B1NA 3OMIB 1YHQV 1JQ0A 5KA5A 1P7BA 1E1RG 2XASA 1NBMG 1AJPA 1R6NA 3I56V 2EZOA 2ATKC 3OW2U 3VBBA 4JTDB 3K3WA 1GM9A 2HVJC 5CBHA 3ABUA 5E1AC 1EFRG 3CCUV 1YSCA 1SERA 3H01A 3E8HA 4L87A 2X0LA 1K9MW 4KFMA 1K5QA 1CP9A 1ORQC 3ETDA 2Y48A 5EBMC 2ZR3A 2EILB 3TK1A 4WFAV 5BZBA 5HFMA 1OHHG 5FL7G 3CYOA 2AHYA 4RQEA 3CCRV 2WLKA 2A9HA 2P7TC 4FJCC 3E89A 3ZMZA 1K92A 2IJHA 1WPXA 4G28B 1R3LC 5IY5C 1S0VA 2IH3C 2ZDIC 2OCCB 4OXSA 1E79G 1H8HG 1M56B 4QNHB 3ZJZA 2ZQMA 3ZMSA 3ZN0A 1PL0A 1CEZA 1EZJA 5LGUA 1SETA 3LDCA 2OTJV 2QM7A 3ZRWA 3E2EA 3UM7A 1VQPV 1OCCB 3NXSA 3B8NA 1YITV 2PI4A 5B3SC 1FFTB 1LNQA 2W6JG 1YI2V 1H2GA 2Q6AA 3OR7C 3ASOC 3LSQA 3ETEA 5B1AC 4J9YB 2EIKC 4TT3G 1AJNA 3MD0A 3EHBB 4ZM5A 2H94A 2ZR2A 1AI6A 2R9IA 3CCVV 1K8AW 1QR9A 3MHHC 4MVRA 3KG2A 1JOYA 4MT8A 1ZWIC 3ZMVA 1QLEC 2XOKG 1KQSU 1DF4A 2EIMB 4PA7A 1GK9A 4GCZA 2EJRA 4I9WA 5IYCO 3AG1B 1ENVA 4MS2A 3UKMA 1VQOV 5IYBO 2OT5A 2WLMA 3ML0A 3OAAG 1V55B 5B1BC 2DWEC 5B1OA 2AHZA 2F43G 3ASNC 3VOUA 5GW7A 3FKSG 1AI7A 3CC7V 1F51A 1PNMA 2EIJC 2LFSA 3EFFK 3FYIB 2DQ3A 3W7WA 5CA3A 4F4LA 2X6BA 2DYRC 2DWDC 1THZA 4H37A 1QCEA 3OMNB 4MW3A 5B3SB 1I5YA 1OCOC 4UVBA 5CBGA 1R6KA 3W7TA 4WCEV 3E8FA 2EINB 3OM3B 1VQLV 2ITCC 2XAFA 1KECA 4MVQA 4BIZA 1TUEB 3F5WC 5EK0A 3AG3B 2JJ2G 5LGNA 1NQTA 1OCZC 5H6QA 1PNKA 3QO5A 4YXWG 1F23A 3SPJA 3E35A 3STZC 4JAVA 1AI5A 4X88A 3CC2V 4MTXA 4MVMA 3T4ZA 3B8PA 1KP3A 2JEXA 2QTOA 4XDLA 3FB7C 2XNDG 3FYEB 4JTAB 3RW0A 3ZRVA 1YTFD 2WWWA 3LUTB 1JCHA 3R65A 5EBWC 4RUEA 4J9ZB 4JPRA 4G27B 5KUMA 3ABMB 3ZMUA 1QBZA 1SZTA 3CCEV 4FIPC 4P2ZA 1GMGA 2DW4A 3K79A 3JD1A 2BOBC 4R50A 4MVUA 1FXKC 1VQ4V 1PKXA 3STLC 5CN0A 2HVKC 5IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZM5 A;  3H01 A;  4E29 A;  1I5X A;  2M7W A;  1QCE A;  1QR9 A;  3MHH C;  4G2K A;  1I5Y A;  3K9A A;  1DLB A;  4JGS A;  3WFV A;  3B77 A;  3B8P A;  2EZP A;  5HFM A;  1EBO A;  3B8N A;  3B8M A;  2MK3 A;  4E2H A;  5KA6 A;  1DF4 A;  4ZM1 A;  1MOF A;  1JPX A;  2P6J A;  3CYO A;  3M99 B;  4JF3 A;  4JPR A;  1QR8 A;  4E2C A;  1Y4M A;  4FK5 C;  1ENV A;  4N21 A;  1QBZ A;  1DF5 A;  1JQ0 A;  2EBO A;  1SZT A;  2OT5 A;  2X7R B;  3MHS C;  4FIP C;  1Y66 A;  5KA5 A;  3B8O A;  4FJC C;  2EZO A;  5H9C A;  4E2L A;  4N23 A;  1K33 A;  3GWO A;  1K34 A;  1MG1 A;  1F23 A;  5CMU A;  5HFL A;  3CP1 A;  3P30 A;  2LP7 A;  5CN0 A; 
#chains in the Genus database with same CATH topology
 1H2L A;  3CCS V;  2YI8 A;  1XUQ A;  2P90 A;  3ABK C;  3ZED A;  1KC8 W;  3B40 A;  2YUA A;  2BOC C;  3T1C A;  4JAS A;  3O65 A;  3LDE A;  4P9P A;  2JS3 A;  4I0X B;  1U97 A;  2ZCE A;  1RFY A;  1AR4 A;  4DV5 O;  3UCS C;  2M6Y A;  1MG1 A;  4LF5 O;  1WJZ A;  4LFB B;  2P4K A;  1Y74 A;  4BAY A;  4B3M B;  4QJF B;  3IC9 A;  4DR2 O;  3ABM C;  3RYC B;  3CSX A;  4TOI A;  2BTO A;  4O2B A;  3K04 A;  4PDM A;  3AK3 A;  4JI6 B;  3A8T A;  2WLI B;  5F2V O;  1KKC A;  3BY6 A;  4GT1 A;  5L3E A;  1Q90 D;  4AQY B;  4O4J A;  3OEH G;  3P30 A;  4J11 A;  4E2L A;  4UCU A;  3K03 A;  4LFA B;  3APO A;  1PD3 A;  3K5M A;  5KAF Z;  4CS2 A;  4DK0 A;  2C2A A;  3N2K A;  2P6J A;  1QVG U;  4WFB V;  3X2Q C;  2PGG A;  1TUB B;  2PYJ A;  4O4L A;  4QE9 A;  1HNW B;  4DR7 B;  1F4M A;  3JAL A;  1BSM A;  2VS0 A;  4WBN A;  3VQW A;  3K5O A;  2V7Q G;  3ZRW B;  2EUL A;  4CH4 A;  4EFE A;  2EIL C;  1YEW A;  2E5L B;  1N0J A;  3K0G A;  4NTY A;  1S5J A;  1XEQ A;  2K1E A;  4I5S A;  1H8E G;  1SA0 B;  4WFF A;  2B9Z A;  4GUN A;  3HKB B;  2HHH O;  4MVS A;  1M90 W;  2ILM A;  2ZKO A;  4JGS A;  5L3D A;  5KX5 A;  4WF9 V;  3P32 A;  4RO2 A;  3T1H O;  2YIC A;  5CA0 B;  2W0F C;  1W2B U;  3B4S A;  2YIB A;  3UT5 B;  4N23 A;  3KCY A;  2D3O W;  4X65 B;  2EIK B;  3HKC A;  3K5N A;  2Q68 A;  1N34 B;  1EN4 A;  3H9V A;  3G6B A;  2ZE6 A;  1NR1 A;  3ZX6 A;  4J41 A;  1K3E A;  4ZKI A;  5L3G A;  2VQF B;  3HKE B;  3JYC A;  4O2A B;  1F7Y A;  1K34 A;  4UB6 Z;  4X62 B;  2F93 B;  5LGT A;  2LP7 A;  4YHH O;  5EC2 C;  4LF7 O;  4DRX B;  2UUB O;  2QKS A;  3A0H Z;  4WBN B;  2ADQ B;  2EIN C;  4PDL A;  2NLJ C;  1XI1 A;  3MAQ A;  2KG7 A;  3H1K H;  2Y4T A;  4MTO A;  4HZ3 A;  4W4L A;  3RGB A;  1U96 A;  2VWK A;  1IXB A;  4HNA B;  3P3N A;  4YJ2 B;  2FML A;  4K8X A;  4UV8 A;  2CK3 G;  1MA1 A;  3J81 N;  1E1Q G;  5LL6 Y;  3AK2 A;  5B66 Z;  4K8Z A;  2BCC H;  4P30 A;  3W7X A;  4JI7 O;  3E8G A;  4GX1 A;  4IYH A;  3DGE A;  2H8P C;  4PA9 A;  1AP6 A;  5LOV A;  3RFR A;  4ZIB A;  2PUS A;  3CEI A;  1SF9 A;  3BCC H;  5CB4 A;  2Y0P A;  4DR7 O;  1SKV A;  2HKO A;  3K58 A;  3ASN B;  3ZHT A;  1KP2 A;  1I94 O;  2Q9L A;  3TXQ A;  4FFB B;  1VQ6 V;  1OCC C;  2Y69 C;  1EBO A;  2UUC B;  5IE9 A;  3LDD A;  4NTW A;  1VQN V;  4D6T H;  4I50 B;  2HEP A;  2XAJ A;  1X59 A;  4J7J A;  1G4Y B;  4TQD A;  3U10 A;  2WPD G;  4PA6 A;  1FS0 G;  2GBO A;  5A2Q N;  2CTQ A;  4YJ3 B;  1PV0 A;  2F4V B;  2EIM C;  3HR0 A;  4DRX A;  2WSS G;  4JAU A;  1GN2 A;  3EXA A;  3OUF A;  2OYQ A;  2RMK B;  3RYI A;  2UXN A;  2WLJ A;  1D5A A;  2KB1 A;  4O2A A;  2NN4 A;  2P06 A;  3CRA A;  3JD0 A;  3GWK C;  2QKA A;  1GAX A;  1R73 A;  1KUQ A;  2Q7H A;  4I9Q A;  1R6N A;  1AJP A;  1PL4 A;  3RYC A;  3I56 V;  2K9P A;  2CH7 A;  3OW2 U;  4DV1 B;  5IJ9 A;  1UFI A;  4YY3 B;  3CCU V;  2Q7G A;  1LUW A;  3E8H A;  5JJJ B;  5LMN B;  2P22 C;  5H5N A;  4BR6 A;  2ZR3 A;  4WFA V;  3S3X A;  1ZL8 B;  4K35 A;  1OV9 A;  3CYO A;  5FL7 G;  4Z2W A;  2LJ2 A;  5CA1 A;  2A9H A;  2P7T C;  2ZNJ A;  3E89 A;  4DUY O;  1WPX A;  4O4I A;  1I7F A;  4J80 A;  4FLT A;  4OXS A;  1SQB H;  4B3M O;  1M56 B;  2OIE A;  4QNH B;  4JI8 O;  2ZQM A;  4J7Z A;  2BE3 A;  1BQZ A;  4JI4 O;  2OTJ V;  2QM7 A;  3ZRW A;  1VQP V;  1IBL B;  1OCC B;  3B8N A;  2P5O A;  2W6J G;  2Q6A A;  1LR1 A;  1EM1 A;  3ASO C;  1HNX O;  4GYC B;  4J9Y B;  2EIK C;  4TT3 G;  1AJN A;  2JRI A;  1RSO B;  3MD0 A;  3ZHQ A;  3CCV V;  3MHH C;  5FPR A;  1JOY A;  4E4E A;  1ZWI C;  3ZMV A;  1QLE C;  1DF4 A;  2UUC O;  2EJR A;  1ENV A;  5FPO A;  2QGN A;  2WLM A;  3MDS A;  4UCO A;  2DWE C;  2L6L A;  3ASN C;  3E22 B;  3P3P A;  1AI7 A;  3CC7 V;  2LFS A;  3EFF K;  1FKA O;  3JSL A;  2DWD C;  1QCE A;  5B3S B;  1OCO C;  4CH3 A;  5B5E Z;  4IT5 A;  4QGP A;  3AG3 B;  3FFQ A;  3ZS8 C;  1MNG A;  2YIB D;  2QWR B;  1FD9 A;  5KMG A;  4O4H A;  4X66 O;  3QO5 A;  1BGY H;  4ICG A;  3E35 A;  3STZ C;  4JAV A;  2XT9 A;  3A2F A;  4MTX A;  4MVM A;  2HHH B;  4J42 A;  4F6R B;  1NTM H;  1KP3 A;  4UCV A;  1JJO A;  3FYE B;  3JAR A;  1YTF D;  1JCH A;  5EBW C;  4RUE A;  4JPR A;  3ABM B;  2Q73 A;  1IBK B;  4FIP C;  4P2Z A;  2H3O A;  3ZHU A;  4DYL A;  4R50 A;  2OCH A;  1WP8 A;  1P7G A;  4DV0 B;  3TXS A;  4B3R B;  4C7U A;  2HVK C;  2KG7 B;  4FZ0 A;  1XMO B;  3RBZ A;  2Q8V A;  2YXY A;  4YJ2 A;  4NVP A;  3T4D A;  5LXT B;  4OX9 O;  1XNR B;  3RT3 C;  5LP6 B;  2IBZ H;  3K9S A;  3TGU H;  5BR8 O;  3SR2 C;  2RNB A;  2EX3 A;  3O9O A;  5IWA B;  4DR1 O;  5HFL A;  1NZ6 A;  4LFB O;  3JCU Z;  5CA1 B;  2Q69 A;  5EIB D;  4LF7 B;  1Q7Y W;  1OCR C;  3KZI Z;  4CZZ A;  3SDL A;  4EB6 A;  4FMT A;  1KBH A;  1Q8I A;  2N04 A;  2X7R B;  4CC6 A;  4DK1 A;  3CCM V;  3OUS A;  3CRQ A;  4BIU A;  2JIZ G;  3K08 A;  1YJ9 V;  3JAW A;  1N8R W;  4JI5 O;  1EN6 A;  3OGI B;  3CD6 V;  2UXD O;  3RVY A;  4ASU G;  2ZXW C;  3F7V C;  2ZM6 O;  3G71 V;  4U7N A;  3Q4H B;  5C93 A;  2WLL A;  4LNU A;  4YJ3 A;  2HG5 C;  4LH6 A;  1NJI W;  5BXZ A;  5KHG A;  3IFX A;  2YEV B;  4JI3 O;  2ITD C;  4UVA A;  1N4C A;  5IDJ A;  2R9R B;  3DC5 A;  1KD1 W;  1G8M A;  2ZE8 A;  4QE7 A;  4I4T B;  1HNW O;  1AP5 A;  2YXL A;  2IU3 A;  1AR1 B;  3W7U A;  1V54 B;  1QVF U;  4KL1 A;  3K59 A;  2QKC A;  1RM1 C;  4XDK A;  1Q6H A;  3THO A;  1SQQ H;  3BFR A;  1AB3 A;  4NXN B;  2RCV A;  1Y4M A;  1N36 B;  2PZS A;  1N0N A;  3ZHS A;  1AI4 A;  4JYC A;  3WU2 Z;  4LF6 O;  5JCO C;  3GVM A;  1FXV A;  3UO3 A;  1XRE A;  1M9N A;  1BS3 A;  5IJ0 B;  2OWO A;  3WFV A;  4YIO A;  1NH2 D;  3CME V;  1ARO P;  4X1K B;  3AG4 B;  1EN5 A;  2V4D A;  4JI7 B;  1MSW D;  2B1I A;  3CRC A;  3OMA B;  3CJH B;  5LP6 C;  2IJK A;  4X1I B;  4B3S B;  1COW G;  3GWO A;  1VQ5 V;  1O9H A;  5B1A B;  4H33 A;  2QA4 V;  4I55 A;  1YVW A;  2FTK A;  4IYI A;  3SJQ C;  5DED A;  4HNA A;  3CCJ V;  3BAB A;  3ZMT A;  3JD2 A;  3CX5 F;  4N21 A;  2WLL B;  4BIO A;  3K5L A;  3ZRS A;  4D7S A;  4GLX A;  5DM6 V;  1K4C C;  2YEV A;  2DYS B;  4YY3 O;  2FKX A;  3SJC C;  2XAG A;  1H2K A;  1XDC A;  4YHH B;  4E29 A;  3K0D A;  2A7W A;  2LGQ A;  2UXC O;  2PTM A;  4FFB A;  3T1H B;  2F1M A;  1RPO A;  2OIG A;  1OCZ B;  1HNZ O;  2GUZ B;  1XL6 A;  5LHG A;  3D3I A;  3HKC B;  1S77 D;  2BSK B;  4K0K O;  1RP3 B;  3KKY A;  1VF6 C;  1RPR A;  4O4H B;  1Y76 A;  1L1F A;  2E3C A;  1N34 O;  2HJD A;  2IJI A;  4OPA A;  1K73 W;  2UXD B;  2A79 B;  4JI8 B;  4LWS A;  2N74 A;  3JAT B;  1P49 A;  4FVM A;  1V54 C;  4WFH A;  4PDV A;  1NKD A;  4GX5 A;  3JD3 A;  2W6I G;  4RAI A;  1H2M A;  3RYF A;  3DSQ A;  3T2M A;  1K33 A;  2CUG A;  2KQX A;  3J7A U;  2CTW A;  3OE7 G;  4PJ0 Z;  4DR5 B;  1BHA A;  2AXT Z;  1IX9 A;  3H1H H;  3B2E E;  3RYI B;  5LMN O;  5D5Q A;  1WB8 A;  2ZT9 B;  2UXX A;  3AK1 A;  5EZY B;  3CXC U;  2VQF O;  1R6T A;  2GDS A;  5LXT A;  1WAZ A;  4BW5 A;  3B8O A;  1ROP A;  3LSS A;  1M57 B;  2CH7 B;  1S72 V;  2JEU A;  2RN9 A;  1G6U A;  1NH2 B;  3E8B A;  4FLY A;  1DLB A;  4NXM O;  3R66 A;  4UVC A;  4X9Q A;  4PEL A;  4DW1 A;  5JWP A;  1I0H A;  4L8J A;  1AJQ A;  3IGA C;  3C3S A;  4UV9 A;  1GM7 A;  5IYZ A;  2QWQ B;  5IYD O;  2FYU H;  2WLN A;  4O4I B;  2Y69 B;  3FB8 C;  1WP7 A;  3ZHR A;  3IJ4 A;  2QWP B;  4P9O A;  2DE0 X;  5EYP B;  3ZIA G;  3N2K B;  3UQ8 A;  1NVP B;  2BTQ B;  1OJH A;  2ZDI A;  1M56 C;  3ABK B;  4EKW A;  3N27 A;  1ZX3 A;  2Q4P A;  3U11 A;  1Z5V A;  4DR4 O;  5D5P A;  2ATK C;  2AGA A;  2HVJ C;  3ABU A;  2QM4 A;  1EFR G;  2XUM A;  2DN9 A;  1KU9 A;  4L87 A;  1I94 B;  2YS8 A;  2GTS A;  5ITZ A;  3ETD A;  1HR0 O;  5EBM C;  2YID A;  5HFM A;  1SS3 A;  1XNQ B;  2AHY A;  1DGS A;  4LNU B;  2Q5Z A;  4RQE A;  3H1J H;  1XQ8 A;  5IY5 C;  1S0V A;  2IH3 C;  1VF6 A;  2WA4 A;  1WNS A;  2GUZ A;  3D3Q A;  4FLX A;  1I08 A;  3ZJZ A;  2RDC A;  1NS1 A;  1PL0 A;  3BA9 A;  4PI2 A;  3LDC A;  2FB5 A;  4B3T O;  3UM7 A;  3C90 A;  5B3S C;  1YI2 V;  4LWS B;  1H2G A;  3AG7 A;  1HNX B;  1Y74 B;  5KHJ A;  3ETE A;  4DV3 B;  4H44 B;  2GV9 A;  3IAY A;  4X1I A;  5KMG B;  4ZM5 A;  3RYF B;  1ZUQ A;  3CHX A;  1K8A W;  1ZL8 A;  1QR9 A;  4MVR A;  3T1Y B;  3N2G A;  1QHT A;  4JI0 B;  4MT8 A;  4LF8 O;  1MZE A;  4IL6 Z;  3AG1 B;  3JAL B;  4MS2 A;  3NR7 A;  2MW2 B;  5IYB O;  4IHJ B;  2OT5 A;  3ML0 A;  5IWA O;  3B09 A;  4DR1 B;  2F43 G;  1WPB A;  2CTP A;  3FAV B;  4UFZ A;  5CA3 A;  1X4T A;  4H37 A;  1DK1 A;  4IIJ B;  2UUB B;  1I5Y A;  3W7T A;  2LGW A;  4UVB A;  1R6K A;  4JI4 B;  1PP9 H;  2ITC C;  2XAF A;  1KEC A;  3SGI A;  4FLU A;  5JVD A;  2JJ2 G;  1N36 O;  1NQT A;  5H6Q A;  1PNK A;  1B06 A;  2LW7 A;  1F23 A;  3SPJ A;  4DV2 O;  1AI5 A;  4X88 A;  4UCT A;  1B3Q A;  5CA0 A;  1GRJ A;  1Z2G A;  1VF5 B;  4H0L B;  2XND G;  1KMI Z;  2WWW A;  3LUT B;  3R65 A;  3D36 C;  2JGD B;  3QF7 A;  2DW4 A;  3S3W A;  4JZG A;  3SJB C;  5JQG A;  5KLV H;  4MVU A;  1FXK C;  5CN0 A;  5IY5 B;  3ZRX A;  1S5H C;  2L35 A;  2F23 A;  2QE7 G;  1VQ9 V;  1D2D A;  4LFC O;  3BAA A;  1BE3 H;  5KA6 A;  2YC0 A;  4GX0 A;  3N2G B;  3CCQ V;  4OX9 B;  3SJA C;  3UO2 A;  4D7T A;  2HP8 A;  5LHH A;  1SA0 A;  2RQ6 A;  3L9D A;  4RUF A;  4X66 B;  1JJ2 U;  4IHJ A;  1AIL A;  2P4V A;  2G38 A;  4DUZ B;  3JD4 A;  2W0X A;  1NVP D;  4LP8 A;  2F66 C;  1BL8 A;  4HYO A;  4DR3 B;  4XBF A;  1MOF A;  3ABL C;  4WFE A;  2UUA O;  4X1Y A;  4Q20 A;  4FK5 C;  4KHP B;  1H2N A;  2LQT A;  5H9C A;  4DUY B;  3ZN1 A;  3FD9 A;  4FLW A;  4R8C A;  5CMU A;  1K4D C;  4DV6 O;  3W7S A;  3JAK B;  2ZE5 A;  4ZI7 A;  2ZM6 B;  3G4S V;  3CWB H;  4JI0 O;  3HKE A;  3ZCC A;  3B8M A;  2PYL A;  1R3I C;  1JPX A;  2NR5 A;  3QO8 A;  3ZBH A;  3QNE A;  4Z1M G;  3MHS C;  5BR8 B;  4CS4 A;  5IJ9 B;  2R70 A;  2CGN A;  3OTO B;  3M7M X;  1Q6I A;  1SQV H;  2YXH A;  5KHK A;  4PHZ A;  1ZSP A;  3FB5 C;  1P4R A;  4ZHQ A;  4JAA A;  4QIW F;  4I55 B;  5B1B B;  4X20 A;  5LYJ B;  3ETG A;  1R3J C;  2E76 B;  4LBE C;  2YI9 A;  1QLN A;  3CB2 A;  1RSO A;  1J5E B;  3WB0 A;  2X6A A;  4UUJ C;  1YJN V;  1HW7 A;  1IBM B;  5KHI A;  1I5X A;  3BEH A;  4LH7 A;  1KKD A;  2Q67 A;  2QWN B;  4FM0 A;  1QNM A;  4DR6 O;  4DV4 B;  2PI5 A;  1K5S A;  3L74 H;  4FLV A;  4U3J B;  3CS5 A;  3AG2 C;  5EYP A;  2BTQ A;  2E75 B;  1GKF A;  3HKD A;  3RYH A;  4UXN A;  2CGO A;  1R3K C;  1SQP H;  3WG7 B;  1VQK V;  4TWK A;  1RM1 B;  3LNM B;  3QO7 A;  1NT2 B;  1F4N A;  3RVZ A;  4CS3 A;  1KYO F;  4DXW A;  1EZV H;  5KAI Z;  5AG2 A;  4TUY B;  1H38 A;  1OZ0 A;  4MVO A;  3JCZ A;  1XHX A;  5ITZ B;  5LA6 B;  1FFX B;  4NYK A;  2EBO A;  3E22 A;  2GSM B;  4FFK A;  2UU9 B;  1JX9 A;  4I0X A;  1MAB G;  4UCS A;  5DEC A;  1M5I A;  2IM9 A;  4JYY A;  3BA8 A;  2IJJ A;  2UXB O;  3WB1 A;  2KSD A;  4ZBM A;  1SC5 B;  1FJG B;  1HNZ B;  2CE4 A;  1B6Q A;  2P67 A;  1K97 A;  1MSD A;  3AG3 C;  3DTU B;  4NKG B;  4TV9 B;  5DN6 G;  4B3S O;  5BMV B;  5J2T B;  1W59 A;  3E83 A;  3SYA A;  4O4L B;  5KHH A;  1HWY A;  1M57 C;  4O4J B;  2WA3 A;  1TA8 A;  2YSU B;  2CTR A;  1TVK A;  1O9G A;  1IUR A;  4GX2 A;  2DYS C;  4QPJ A;  1Y67 A;  1XHZ A;  1FXK B;  3BVO A;  1NTZ H;  2LFR A;  3F7Y C;  3ABT A;  1KB9 F;  4LF4 O;  3DC6 A;  4EB6 B;  1XMO O;  1Q43 A;  5CBF A;  3X2Q B;  2Y4U A;  4TV8 A;  1GN6 A;  3HB3 B;  2DYR B;  1YDX A;  3CCL V;  4GKJ B;  2XAH A;  1XNR O;  2JK5 C;  3JAW B;  4K0K B;  1UPG A;  5L3B A;  2ADP A;  3J80 N;  4DV7 B;  3I55 V;  3WG7 C;  2R9A A;  3GB7 C;  5J2U B;  4DO2 A;  2ZE7 A;  1QU7 A;  2LO1 A;  3FX7 A;  3OTF A;  3SPG A;  1CPY A;  2V1D A;  3SPI A;  5LMU O;  2JJ1 G;  4NXN O;  1DF5 A;  1WA8 B;  1XBL A;  1XL4 A;  1N32 B;  1M1K W;  1AVM A;  1FXH A;  1WLE A;  4I4T A;  4NTX A;  5JCO A;  1MZF A;  5JQG B;  1OCO B;  3HKD B;  2B1G A;  1BT8 A;  4X1K A;  2QDO A;  1T5E A;  3PJS K;  3RWR D;  2IH1 C;  1P84 F;  1Z5W A;  4IGG A;  3JAS A;  1SZX A;  3BHP A;  2A3Q A;  4JI1 B;  1YHQ V;  3OMI B;  4Q6G A;  1P7B A;  1WN7 A;  1BZK A;  2XAS A;  2EZO A;  1M4U A;  3ZHV A;  5CBH A;  4LF5 B;  1TUB A;  2VQE O;  5E1A C;  1FFX A;  1YSC A;  3I5D A;  1IZ3 A;  1L8D A;  1SER A;  3G80 A;  5C8Y B;  2X0L A;  2ZIM A;  3JAR B;  4KFM A;  4CH5 A;  1K5Q A;  1CP9 A;  5GON B;  2EIL B;  3CJH A;  1NI8 A;  4PI0 A;  2JS5 A;  1FJG O;  4FJC C;  4AQY O;  1K92 A;  2IJH A;  4G28 B;  5FLX N;  4LF6 B;  4DV2 B;  2ZDI C;  4GKK O;  2N05 A;  4UB8 Z;  1GH6 A;  5FNV B;  1PM9 A;  1SET A;  1H2S B;  3NXS A;  4IIJ A;  2ZIN A;  2PI4 A;  2ZNI A;  4JYA O;  1LNQ A;  2DMX A;  1NTK H;  1ZAU A;  4DR4 B;  3JAM N;  3EHB B;  1Q5O A;  2H94 A;  1AI6 A;  1ZLZ A;  1HR0 B;  2ODM A;  5LP6 A;  2XOK G;  1KQS U;  2EIM B;  1GK9 A;  4GCZ A;  4I9W A;  5IYC O;  2VWJ A;  3UKM A;  4OGQ B;  3OAA G;  1V55 B;  3H1I H;  3OD4 A;  5B1O A;  2AHZ A;  4DV5 B;  3UT5 A;  4K3A A;  2DOS A;  1F51 A;  4DR5 O;  2EIJ C;  2LW1 A;  3RYH B;  2DQ3 A;  3W7W A;  4F4L A;  4I50 A;  2DYR C;  5CBG A;  3OMN B;  5EZY A;  3E8F A;  5A9G A;  3CE2 A;  4B3T B;  2QR4 A;  2EIN B;  3OM3 B;  4DR3 O;  1VIB A;  2UXC B;  3L73 H;  2E74 B;  1XNQ O;  4TUY A;  4BIZ A;  3K57 A;  5LMU B;  1TUE B;  5J2U A;  1JFF A;  4AIL C;  5LGN A;  1TAE A;  1OCZ C;  1N32 O;  4DV3 O;  4YXW G;  5J2T A;  3CC2 V;  4LFA O;  5H2F Z;  3T4Z A;  3DXR B;  3B8P A;  2QTO A;  4XDL A;  3WB2 A;  4JTA B;  3ZRV A;  4FZ1 A;  3ICX A;  4J9Z B;  4JI6 O;  5KUM A;  3ZMU A;  1QBZ A;  1WB7 A;  1SZT A;  3K79 A;  1PKX A;  1YXB A;  3STL C;  5EC1 C;  3T1Y O;  1NR7 A;  4LF8 B;  3C3T A;  3B77 A;  3BPZ A;  1GN4 A;  4JI2 B;  1Q86 W;  2HJF C;  1S76 D;  4E2H A;  4PDR A;  2IU0 A;  5GON A;  2Z3Y A;  4W4K A;  3TET A;  3IC7 A;  2DQ0 A;  3ASO B;  4MTF A;  4U3F H;  3SYC A;  4JYB A;  1W0J G;  4TV9 A;  5LOV B;  4GKK B;  2WLH A;  4MVZ A;  3K9A A;  4NR1 A;  4FLZ A;  4NXM B;  4DR6 B;  1BQ0 A;  1HDJ A;  1M93 A;  2Q0A A;  2F4V O;  1AR5 A;  1JVM A;  4ZM1 A;  4TV8 B;  4EFB A;  4UCR A;  3A0R A;  1QLE B;  4B7K A;  3OGC C;  4B7E A;  2HFE C;  3SYO A;  3CRR A;  5JH7 B;  5LBQ A;  1VF7 A;  1A32 A;  1GTO A;  4X65 O;  2QM8 A;  4KP4 A;  4QPK A;  4G2K A;  2EJ7 A;  1N33 O;  2X6C A;  4FM1 A;  4TQF A;  1XMQ O;  2QEX V;  1YIJ V;  1UJW B;  4BWA A;  5KX5 B;  3DXR A;  3M99 B;  4CC5 A;  3JAS B;  2QJ1 A;  3QVN A;  4H13 B;  3K06 A;  3VQV A;  1Y76 B;  3AG2 B;  5JJN B;  1W0K G;  2OTL V;  2AZ2 A;  3CRM A;  1CXZ B;  1GM8 A;  3ABL B;  1JMK C;  1VEW A;  4LFC B;  4JTC B;  1V55 C;  5K1P A;  1LUV A;  4CBC A;  4WFG A;  4GKJ O;  1QR8 A;  2YIA A;  4JF3 A;  4ZOL A;  2O57 A;  1JA8 A;  1K7D A;  3LNN A;  1GN3 A;  4TSF G;  3SYQ A;  4DV6 B;  1VP7 A;  3G6E V;  4I7Z B;  1JR9 A;  2HR3 A;  3CC4 V;  4FPP A;  1Y6X A;  5L3F A;  3F5T A;  1IBL O;  1BHB A;  4J7K A;  3L70 H;  2PY5 A;  4KHP O;  2NNU A;  1Q81 W;  3HPL C;  1VMG A;  5EBL C;  4DV1 O;  3M8A A;  4Z1V A;  1PPJ H;  2DJV A;  4MTG A;  1L0L H;  5BMV A;  5JH7 A;  5LHI A;  4LF4 B;  1VQ8 V;  4EEQ A;  2JGD A;  3VQY A;  4LC1 A;  4LF9 O;  2AW9 A;  4RWU A;  2QSA A;  5FNV A;  4JI2 O;  2XAQ A;  4NB5 A;  5J9P C;  2KKW A;  1SES A;  5H6R A;  3ETQ A;  2GHY A;  3OR6 C;  2ETN A;  4X62 O;  4HBN A;  2EIJ B;  2VQE B;  4PA4 A;  1FXK A;  4PA3 A;  1YJW V;  3APQ A;  2M7W A;  2HLD G;  2B5U A;  1YF2 A;  2Z5U A;  3SPH A;  3AEI A;  3BRC A;  4E2C A;  4X64 B;  1Q82 W;  4MW8 A;  3OEE G;  1Y66 A;  2ZD9 A;  1VQM V;  2VRZ A;  2ARH A;  2CAZ C;  3CP1 A;  4PV1 B;  3SPC A;  1GO3 F;  2XTA A;  2XHB A;  4R7C A;  1VQ7 V;  1BMF G;  3LSU A;  2A0L A;  4F6E A;  1TGO A;  3E86 A;  2WLI A;  4DUZ O;  1N33 B;  4BW9 A;  2CDY A;  1PNL A;  1B04 A;  3CPW U;  1J95 A;  1IBK O;  1S3J A;  3CXH F;  3Q4H A;  4KUM A;  4JV5 B;  2IW5 A;  2UU9 O;  5IT9 N;  1XOU A;  1R1B A;  2OCC C;  1WA8 A;  1JFF B;  2ZIO A;  4AI8 A;  2JVD A;  4HAM A;  4DW0 A;  1SQG A;  3D36 A;  3TJT A;  1IDS A;  4O2B B;  4XDJ A;  2EZP A;  2MK3 A;  2E5L O;  4F6R A;  1YTF B;  5KUK A;  3FB6 C;  1Q3E A;  1SQX H;  2RJZ A;  5JJE B;  5E79 Z;  4U7O A;  4LCU C;  1OCR B;  4MSW C;  1TVK B;  2D2C B;  1SQF A;  5JVD B;  3TCU A;  1SRY A;  1DTO A;  2GTA A;  3AG1 C;  3OFN G;  4JYA B;  3SYP A;  2UUA B;  3CMA V;  4KXR A;  4X89 A;  1MMM A;  2QWO B;  3A0B Z;  2WAM A;  1IXM A;  3FAV A;  4DV0 O;  3JAK A;  2JDI G;  3HKB A;  3H1L H;  4PD4 F;  4ZI7 B;  4B3R O;  2ZXW B;  4X8A A;  3VQX A;  3L71 H;  3AG4 C;  5L3C A;  1YZB A;  4U3J A;  4RQF A;  4LF9 B;  4J10 A;  2Y0I A;  1Q6U A;  4R6Z A;  5B1N A;  1JQ0 A;  5KA5 A;  1E1R G;  1NBM G;  4YIP A;  1ZTE A;  3OTO O;  3VBB A;  4JTD B;  3K3W A;  1GM9 A;  5BY1 A;  3U0Z A;  1FAF A;  3H01 A;  1K9M W;  1BCC H;  1ORQ C;  3L75 H;  2Y48 A;  4X20 B;  3TK1 A;  5BZB A;  2R72 A;  3D8C A;  1L0N H;  4JZ2 A;  1OHH G;  1URF A;  3OT7 A;  4A5U B;  3CCR V;  1QQC A;  2WLK A;  4X64 O;  3ZMZ A;  1NU1 H;  1J5E O;  3PN1 A;  3RN4 A;  2YDE A;  1IBM O;  1US6 A;  1YCI A;  1R3L C;  4DV7 O;  5K1X A;  2OCC B;  4DR2 B;  2QTS A;  1E79 G;  1H8H G;  3ZMS A;  3ZN0 A;  4X1Y B;  1CEZ A;  1EZJ A;  5LGU A;  1IVS A;  2Q0O C;  4DV4 O;  3E2E A;  1YIT V;  5LA6 A;  3QG5 A;  1FFT B;  5EIB C;  3JAT A;  5GTH Z;  3OR7 C;  4JI3 B;  2F95 B;  3KCX A;  4JV5 O;  3LSQ A;  5B1A C;  1FYJ A;  5C8Y A;  2ZR2 A;  1XIL A;  2R9I A;  2Q7E A;  4LR3 A;  3KG2 A;  4GZR B;  4AHC A;  1XMQ B;  4PA7 A;  4JI1 O;  4OPH A;  5IJ0 A;  1VQO V;  1VAR A;  5CB4 B;  2JGU A;  4ZHQ B;  2Z0A A;  5B1B C;  3L72 H;  3VOU A;  5GW7 A;  3G67 A;  1D5N A;  3FKS G;  1PNM A;  3FYI B;  4ZOL B;  1S5L Z;  2X6B A;  4FM2 A;  1THZ A;  4MW3 A;  2PF4 E;  1G1X B;  2UXB B;  2FL4 A;  4WCE V;  1VQL V;  4MVQ A;  1FPO A;  5EK0 A;  3F5W C;  3QTC A;  3EVK A;  4JI5 B;  2BSK A;  4CH6 A;  5GTI Z;  5IYZ B;  2AZ0 A;  1HP8 A;  5LYJ A;  2A06 H;  2JEX A;  3FB7 C;  3RW0 A;  1V9P A;  4G27 B;  4B08 A;  3CCE V;  1GMG A;  5TIS Z;  3JD1 A;  2BOB C;  4ABM A;  1VQ4 V;  3JSN A; 
#chains in the Genus database with same CATH homology
 3ZRX A;  5EC1 C;  3CCS V;  1S5H C;  2P90 A;  3ABK C;  2QE7 G;  1KC8 W;  1VQ9 V;  1NR7 A;  3RBZ A;  3B77 A;  2BOC C;  3T1C A;  4JAS A;  3T4D A;  1Q86 W;  5KA6 A;  4GX0 A;  2HJF C;  3LDE A;  4P9P A;  3CCQ V;  1S76 D;  4E2H A;  4PDR A;  2IU0 A;  5LHH A;  2Z3Y A;  3TET A;  3IC7 A;  4RUF A;  2DQ0 A;  3ASO B;  1MG1 A;  4MTF A;  1JJ2 U;  5HFL A;  3SYC A;  4JYB A;  1W0J G;  4BAY A;  2Q69 A;  4QJF B;  2WLH A;  4MVZ A;  1Q7Y W;  3K9A A;  1OCR C;  3JD4 A;  4CZZ A;  3ABM C;  1NVP D;  4LP8 A;  1BL8 A;  4HYO A;  1JVM A;  4XBF A;  4ZM1 A;  4FMT A;  1MOF A;  3ABL C;  3K04 A;  4PDM A;  4WFE A;  2WLI B;  3A0R A;  1QLE B;  4Q20 A;  3OGC C;  4FK5 C;  2HFE C;  2X7R B;  3BY6 A;  4GT1 A;  3SYO A;  3CCM V;  3OUS A;  5L3E A;  4BIU A;  5H9C A;  3ZN1 A;  2JIZ G;  3K08 A;  1YJ9 V;  1N8R W;  4R8C A;  5LBQ A;  5CMU A;  3OEH G;  1GTO A;  3P30 A;  1K4D C;  4E2L A;  3W7S A;  3CD6 V;  3K03 A;  2QM8 A;  5LHG A;  3RVY A;  4ASU G;  4KP4 A;  1PD3 A;  2ZXW C;  3F7V C;  4QPK A;  4G2K A;  3G4S V;  3G71 V;  2X6C A;  4U7N A;  5C93 A;  2WLL A;  2C2A A;  2QEX V;  1YIJ V;  3ZCC A;  3B8M A;  1UJW B;  1R3I C;  1JPX A;  2HG5 C;  3QO8 A;  2P6J A;  1QVG U;  3M99 B;  3QNE A;  4Z1M G;  1NJI W;  4WFB V;  3IFX A;  3X2Q C;  3MHS C;  2YEV B;  3K06 A;  2ITD C;  4QE9 A;  4UVA A;  5IDJ A;  2R9R B;  3AG2 B;  1KD1 W;  1W0K G;  1G8M A;  2OTL V;  4QE7 A;  1F4M A;  3FB5 C;  2IU3 A;  1P4R A;  1GM8 A;  3ABL B;  1V54 B;  1AR1 B;  3W7U A;  1QVF U;  2V7Q G;  3ZRW B;  1RM1 C;  4XDK A;  4QIW F;  4JTC B;  1V55 C;  5B1B B;  2EIL C;  4CBC A;  4WFG A;  1QR8 A;  1Y4M A;  3ETG A;  4JF3 A;  3K0G A;  1R3J C;  4LBE C;  1QLN A;  1AI4 A;  4JYC A;  1K7D A;  2X6A A;  2K1E A;  4I5S A;  4UUJ C;  1YJN V;  4TSF G;  1H8E G;  3SYQ A;  1FXV A;  3G6E V;  4WFF A;  1I5X A;  3BEH A;  1M9N A;  1KKD A;  2Q67 A;  4MVS A;  2HR3 A;  1M90 W;  3CC4 V;  4FPP A;  4JGS A;  3WFV A;  5L3D A;  5L3F A;  1NH2 D;  3CME V;  1ARO P;  2PI5 A;  3AG4 B;  1K5S A;  3P32 A;  4WF9 V;  1BHB A;  4RO2 A;  3AG2 C;  1MSW D;  1W2B U;  2W0F C;  2B1I A;  2NNU A;  3OMA B;  1Q81 W;  3HPL C;  1GKF A;  4UXN A;  4N23 A;  5EBL C;  2IJK A;  1COW G;  3GWO A;  1R3K C;  1VQ5 V;  2D3O W;  3WG7 B;  1VQK V;  4MTG A;  4TWK A;  5B1A B;  1RM1 B;  2EIK B;  3LNM B;  3QO7 A;  4H33 A;  2Q68 A;  5LHI A;  2QA4 V;  1VQ8 V;  1F4N A;  3RVZ A;  2FTK A;  4DXW A;  1NR1 A;  4LC1 A;  3SJQ C;  1H38 A;  1OZ0 A;  3CCJ V;  4MVO A;  2XAQ A;  1K3E A;  3JCZ A;  3ZMT A;  4ZKI A;  5J9P C;  5L3G A;  3JD2 A;  4N21 A;  2WLL B;  2EBO A;  3JYC A;  1SES A;  5H6R A;  2GSM B;  2GHY A;  3ZRS A;  3OR6 C;  1K34 A;  5DM6 V;  1JX9 A;  1K4C C;  2EIJ B;  2YEV A;  2DYS B;  5LGT A;  2LP7 A;  4PA4 A;  1FXK A;  1MAB G;  2XAG A;  5EC2 C;  4PA3 A;  1YJW V;  4E29 A;  2M7W A;  2QKS A;  3K0D A;  2IJJ A;  2HLD G;  2B5U A;  2Z5U A;  2EIN C;  4ZBM A;  3SPH A;  3AEI A;  4PDL A;  2NLJ C;  1RPO A;  1OCZ B;  4E2C A;  1Q82 W;  4MW8 A;  1Y66 A;  1B6Q A;  1XL6 A;  3DTU B;  1K97 A;  2P67 A;  2ZD9 A;  3AG3 C;  3D3I A;  3OEE G;  5DN6 G;  1S77 D;  1VQM V;  3SYA A;  3E83 A;  3CP1 A;  4MTO A;  1RPR A;  4HZ3 A;  1GO3 F;  3SPC A;  1L1F A;  2IJI A;  4R7C A;  1K73 W;  1VQ7 V;  1BMF G;  1HWY A;  2A0L A;  2A79 B;  1M57 C;  3E86 A;  2WLI A;  4UV8 A;  1V54 C;  2CK3 G;  2YSU B;  4WFH A;  4PDV A;  1NKD A;  1PNL A;  4GX5 A;  1E1Q G;  3JD3 A;  2W6I G;  4GX2 A;  4RAI A;  4P30 A;  3W7X A;  3CPW U;  2DYS C;  3E8G A;  4GX1 A;  4QPJ A;  1J95 A;  1S3J A;  3DGE A;  4KUM A;  2H8P C;  4PA9 A;  3T2M A;  1FXK B;  2IW5 A;  1K33 A;  2LFR A;  2OCC C;  3OE7 G;  3F7Y C;  1BHA A;  3ABT A;  2HKO A;  4HAM A;  3D36 A;  3ASN B;  1KP2 A;  1VQ6 V;  1OCC C;  5CBF A;  3X2Q B;  4XDJ A;  2EZP A;  2Y69 C;  3HB3 B;  1EBO A;  2DYR B;  2MK3 A;  2UXX A;  3CCL V;  2XAH A;  3CXC U;  2JK5 C;  3LDD A;  4BW5 A;  1YTF B;  3B8O A;  1VQN V;  5KUK A;  1ROP A;  3FB6 C;  2XAJ A;  3LSS A;  1M57 B;  1G4Y B;  5L3B A;  2WPD G;  4PA6 A;  1FS0 G;  3I55 V;  1S72 V;  2JEU A;  3WG7 C;  4U7O A;  4LCU C;  1OCR B;  4MSW C;  3GB7 C;  1NH2 B;  4DO2 A;  3E8B A;  1DLB A;  3TCU A;  1SRY A;  2EIM C;  1DTO A;  3SPG A;  1CPY A;  2V1D A;  4UVC A;  3SPI A;  3AG1 C;  2WSS G;  3OFN G;  2JJ1 G;  3SYP A;  4JAU A;  3CMA V;  4PEL A;  4X89 A;  1AJQ A;  3IGA C;  1DF5 A;  1XL4 A;  4UV9 A;  1GM7 A;  2WAM A;  3OUF A;  1M1K W;  1IXM A;  1FXH A;  1WLE A;  2JDI G;  2UXN A;  2WLJ A;  2KB1 A;  5IYD O;  2ZXW B;  2WLN A;  2Y69 B;  4X8A A;  1OCO B;  3FB8 C;  2B1G A;  3AG4 C;  5L3C A;  3JD0 A;  3PJS K;  4P9O A;  2IH1 C;  3ZIA G;  4RQF A;  1NVP B;  1R73 A;  2ZDI A;  1M56 C;  3ABK B;  4EKW A;  4R6Z A;  5B1N A;  3OMI B;  1YHQ V;  1JQ0 A;  5KA5 A;  1P7B A;  1E1R G;  2XAS A;  1NBM G;  1AJP A;  1R6N A;  3I56 V;  2EZO A;  2ATK C;  3OW2 U;  3VBB A;  4JTD B;  3K3W A;  1GM9 A;  2HVJ C;  5CBH A;  3ABU A;  5E1A C;  1EFR G;  3CCU V;  1YSC A;  1SER A;  3H01 A;  3E8H A;  4L87 A;  2X0L A;  1K9M W;  4KFM A;  1K5Q A;  1CP9 A;  1ORQ C;  3ETD A;  2Y48 A;  5EBM C;  2ZR3 A;  2EIL B;  3TK1 A;  4WFA V;  5BZB A;  5HFM A;  1OHH G;  5FL7 G;  3CYO A;  2AHY A;  4RQE A;  3CCR V;  2WLK A;  2A9H A;  2P7T C;  4FJC C;  3E89 A;  3ZMZ A;  1K92 A;  2IJH A;  1WPX A;  4G28 B;  1R3L C;  5IY5 C;  1S0V A;  2IH3 C;  2ZDI C;  2OCC B;  4OXS A;  1E79 G;  1H8H G;  1M56 B;  4QNH B;  3ZJZ A;  2ZQM A;  3ZMS A;  3ZN0 A;  1PL0 A;  1CEZ A;  1EZJ A;  5LGU A;  1SET A;  3LDC A;  2OTJ V;  2QM7 A;  3ZRW A;  3E2E A;  3UM7 A;  1VQP V;  1OCC B;  3NXS A;  3B8N A;  1YIT V;  2PI4 A;  5B3S C;  1FFT B;  1LNQ A;  2W6J G;  1YI2 V;  1H2G A;  2Q6A A;  3OR7 C;  3ASO C;  3LSQ A;  3ETE A;  5B1A C;  4J9Y B;  2EIK C;  4TT3 G;  1AJN A;  3MD0 A;  3EHB B;  4ZM5 A;  2H94 A;  2ZR2 A;  1AI6 A;  2R9I A;  3CCV V;  1K8A W;  1QR9 A;  3MHH C;  4MVR A;  3KG2 A;  1JOY A;  4MT8 A;  1ZWI C;  3ZMV A;  1QLE C;  2XOK G;  1KQS U;  1DF4 A;  2EIM B;  4PA7 A;  1GK9 A;  4GCZ A;  2EJR A;  4I9W A;  5IYC O;  3AG1 B;  1ENV A;  4MS2 A;  3UKM A;  1VQO V;  5IYB O;  2OT5 A;  2WLM A;  3ML0 A;  3OAA G;  1V55 B;  5B1B C;  2DWE C;  5B1O A;  2AHZ A;  2F43 G;  3ASN C;  3VOU A;  5GW7 A;  3FKS G;  1AI7 A;  3CC7 V;  1F51 A;  1PNM A;  2EIJ C;  2LFS A;  3EFF K;  3FYI B;  2DQ3 A;  3W7W A;  5CA3 A;  4F4L A;  2X6B A;  2DYR C;  2DWD C;  1THZ A;  4H37 A;  1QCE A;  3OMN B;  4MW3 A;  5B3S B;  1I5Y A;  1OCO C;  4UVB A;  5CBG A;  1R6K A;  3W7T A;  4WCE V;  3E8F A;  2EIN B;  3OM3 B;  1VQL V;  2ITC C;  2XAF A;  1KEC A;  4MVQ A;  4BIZ A;  1TUE B;  3F5W C;  5EK0 A;  3AG3 B;  2JJ2 G;  5LGN A;  1NQT A;  1OCZ C;  5H6Q A;  1PNK A;  3QO5 A;  4YXW G;  1F23 A;  3SPJ A;  3E35 A;  3STZ C;  4JAV A;  1AI5 A;  4X88 A;  3CC2 V;  4MTX A;  4MVM A;  3T4Z A;  3B8P A;  1KP3 A;  2JEX A;  2QTO A;  4XDL A;  3FB7 C;  2XND G;  3FYE B;  4JTA B;  3RW0 A;  3ZRV A;  1YTF D;  2WWW A;  3LUT B;  1JCH A;  3R65 A;  5EBW C;  4RUE A;  4J9Z B;  4JPR A;  4G27 B;  5KUM A;  3ABM B;  3ZMU A;  1QBZ A;  1SZT A;  3CCE V;  4FIP C;  4P2Z A;  1GMG A;  2DW4 A;  3K79 A;  3JD1 A;  2BOB C;  4R50 A;  4MVU A;  1FXK C;  1VQ4 V;  1PKX A;  3STL C;  5CN0 A;  2HVK C;  5IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...