The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
206
|
structure length |
205
|
Chain Sequence |
DGDPITSTEEIPFDKKREFDPNMAPGTEKVVQKGEPGTKTITTPTTKNPMTGEKGEGEPTEKITKQPVDEIVHYGGEQIPQGHKDEFDPNAPVDSKTEVPGKPGVKNPDTGEVVTPPVDDVTKYGPVDGDSITSTEEIPFDKKREFDPNMAPGTEKVVQKGEPGTKTITTPTTKNPMTGEKVGEGKSTEKVTKQPVDEIVEYGPT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
molecule keywords |
Accumulation associated protein
|
publication title |
Structural basis for Zn2+-dependent intercellular adhesion in staphylococcal biofilms.
pubmed doi rcsb |
source organism |
Staphylococcus epidermidis
|
total genus |
33
|
structure length |
205
|
sequence length |
206
|
ec nomenclature | |
pdb deposition date | 2012-06-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07501 | G5 | G5 domain |
A | PF17041 | SasG_E | E domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Resuscitation-promoting factor rpfb fold | Resuscitation-promoting factor rpfb. | ||
Mainly Beta | Single Sheet | Resuscitation-promoting factor rpfb fold | Resuscitation-promoting factor rpfb. |
#chains in the Genus database with same CATH superfamily 4FUO A; 5DBL A; 3EO5 A; 2LTJ A; 4FUM A; 4FUP A; 4FUN A; 3TIP A; 4FZQ A; #chains in the Genus database with same CATH topology 4FUO A; 3TIQ A; 5DBL A; 3EO5 A; 2LTJ A; 4WVE A; 4FUM A; 4FUP A; 4FUN A; 3TIP A; 4FZQ A; #chains in the Genus database with same CATH homology 4FUO A; 5DBL A; 3EO5 A; 2LTJ A; 4FUM A; 4FUP A; 4FUN A; 3TIP A; 4FZQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...