The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
101
|
structure length |
101
|
Chain Sequence |
DGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Amyloid precursor protein dimerization and synaptogenic function depend on copper binding to the growth factor-like domain
pubmed doi rcsb |
| molecule tags |
Metal binding protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Amyloid beta A4 protein
|
| total genus |
18
|
| structure length |
101
|
| sequence length |
101
|
| ec nomenclature | |
| pdb deposition date | 2013-02-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02177 | APP_N | Amyloid A4 N-terminal heparin-binding |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Sugar Binding Protein, Amyloid A4 Protein; Chain A | Amyloidogenic glycoprotein, heparin-binding domain |
#chains in the Genus database with same CATH superfamily 1MWP A; 4PWQ A; 4JFN A; 4PQD A; 3KTM A; #chains in the Genus database with same CATH topology 1MWP A; 4PWQ A; 4JFN A; 4PQD A; 3KTM A; #chains in the Genus database with same CATH homology 1MWP A; 4PWQ A; 4JFN A; 4PQD A; 3KTM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
