The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
85
|
Knots found |
|
sequence length |
294
|
structure length |
276
|
Chain Sequence |
VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A substrate access tunnel in the cytosolic domain is not an essential feature of the solute carrier 4 (SLC4) family of bicarbonate transporters.
pubmed doi rcsb |
| molecule keywords |
Band 3 anion transport protein
|
| molecule tags |
Membrane protein
|
| source organism |
Homo sapiens
|
| total genus |
85
|
| structure length |
276
|
| sequence length |
294
|
| chains with identical sequence |
P
|
| other databases |
|
| ec nomenclature | |
| pdb deposition date | 2013-05-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07565 | Band_3_cyto | Band 3 cytoplasmic domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the Genus database with same CATH superfamily 4M62 S; 4ODX X; 1A6J A; 2FEW A; 1HYN P; 1A3A A; 3BJV A; 2OQT A; 4KY9 A; 3LF6 A; 4GQX A; 2OQ3 A; 1J6T A; 2A0J A; 4M8Q C; 3OXP A; 1XIZ A; 3T43 A; 3URR A; #chains in the Genus database with same CATH topology 4M62 S; 4ODX X; 1A6J A; 2FEW A; 1HYN P; 1A3A A; 3BJV A; 2OQT A; 4KY9 A; 3LF6 A; 4GQX A; 2OQ3 A; 1J6T A; 2A0J A; 4M8Q C; 3OXP A; 1XIZ A; 3T43 A; 3URR A; #chains in the Genus database with same CATH homology 4M62 S; 4ODX X; 1A6J A; 2FEW A; 1HYN P; 1A3A A; 3BJV A; 2OQT A; 4KY9 A; 3LF6 A; 4GQX A; 2OQ3 A; 1J6T A; 2A0J A; 4M8Q C; 3OXP A; 1XIZ A; 3T43 A; 3URR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...