4NTQA

Cdia-ct/cdii toxin and immunity complex from enterobacter cloacae
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
76
structure length
76
Chain Sequence
LKGKEAQEAASNLGFDRRIPPQKAPFNSHGQPVFYDGKNYITPDIDSHNVTNGWKMFNSKGKRIGTYDSGLNRIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
source organism Enterobacter cloacae subsp. cloacae
publication title CdiA from Enterobacter cloacae Delivers a Toxic Ribosomal RNase into Target Bacteria.
pubmed doi rcsb
molecule keywords Contact-dependent inhibitor A
total genus 9
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15526 Ntox21 Novel toxin 21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.380.20 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Ribonuclease domain of colicin e3 (Residues 456-551) 4ntqA00
4NTQA
chains in the Genus database with same CATH superfamily
1E44B 1JCHA 4NTQA 2B5UA 4UDMB
chains in the Genus database with same CATH topology
4NTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTQ A; 
#chains in the Genus database with same CATH topology
 1E44 B;  1JCH A;  4NTQ A;  2B5U A;  4UDM B; 
#chains in the Genus database with same CATH homology
 4NTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...