The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
76
|
structure length |
76
|
Chain Sequence |
LKGKEAQEAASNLGFDRRIPPQKAPFNSHGQPVFYDGKNYITPDIDSHNVTNGWKMFNSKGKRIGTYDSGLNRIKD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
CdiA from Enterobacter cloacae Delivers a Toxic Ribosomal RNase into Target Bacteria.
pubmed doi rcsb |
molecule tags |
Toxin
|
source organism |
Enterobacter cloacae subsp. cloacae
|
molecule keywords |
Contact-dependent inhibitor A
|
total genus |
9
|
structure length |
76
|
sequence length |
76
|
ec nomenclature | |
pdb deposition date | 2013-12-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF15526 | Ntox21 | Novel toxin 21 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Ribonuclease domain of colicin e3 (Residues 456-551) | Ribonuclease domain of colicin e3 (Residues 456-551) |
#chains in the Genus database with same CATH superfamily 4NTQ A; #chains in the Genus database with same CATH topology 1JCH A; 2B5U A; 4UDM B; 4NTQ A; 1E44 B; #chains in the Genus database with same CATH homology 4NTQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...