The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
152
|
structure length |
152
|
Chain Sequence |
MQGIHFRRHYVRHLPKEVSQNDIIKALASPLINDGMVVSDFADHVITREQNFPTGLPVEPVGVAIPHTDSKYVRQNAISVGILAEPVNFEDAGGEPDPVPVRVVFMLALGNWFDITNVLWWIMDVIQDEDFMQQLLVMNDDEIYQSIYTRIS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb |
molecule tags |
Immune system
|
source organism |
Artificial gene
|
molecule keywords |
4E10 epitope scaffold T117
|
total genus |
38
|
structure length |
152
|
sequence length |
152
|
chains with identical sequence |
Y
|
ec nomenclature | |
pdb deposition date | 2014-01-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the Genus database with same CATH superfamily 3OXP A; 4M8Q C; 3BJV A; 1HYN P; 3URR A; 2OQ3 A; 1A6J A; 1XIZ A; 1J6T A; 2OQT A; 4M62 S; 2A0J A; 2FEW A; 4KY9 A; 4GQX A; 3LF6 A; 1A3A A; 4ODX X; 3T43 A; #chains in the Genus database with same CATH topology 3OXP A; 4M8Q C; 3BJV A; 1HYN P; 3URR A; 2OQ3 A; 1A6J A; 1XIZ A; 1J6T A; 2OQT A; 4M62 S; 2A0J A; 2FEW A; 4KY9 A; 4GQX A; 3LF6 A; 1A3A A; 4ODX X; 3T43 A; #chains in the Genus database with same CATH homology 3OXP A; 4M8Q C; 3BJV A; 1HYN P; 3URR A; 2OQ3 A; 1A6J A; 1XIZ A; 1J6T A; 2OQT A; 4M62 S; 2A0J A; 2FEW A; 4KY9 A; 4GQX A; 3LF6 A; 1A3A A; 4ODX X; 3T43 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...