4BM2A

Crystal structure of manganese peroxidase 4 from pleurotus ostreatus - crystal form ii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
AKCSKGRTASNDACCVWFDVLDDIQENLFDGGECGEEVHESLRLTFHDAIGFSPALTRQGKFGGGGADGSIMLFSDIETNFAANNGVDDIVEQQKPIAIKHQVSFGDFIQFAGAVGSSNCAGGPRIQFLAGRSNVTKPSPDHLVPEPFDSVTSILARMGDAGFKPDEVVALLASHSVAAQDTIDPKLAGHPFDSTPSDFDSQFFVETLLKGTLIPGDSLHKGQVKSPLPGEFRLQSDELLARDSRTSCEWQSFISNPNSMVPKFERAMAKMATLGQNPKKLIDCSEVIPVPRGRVKQPTLPAGKTIKDIEASCRKAPFPRLPTDKGTFTSILPVPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligninolytic Peroxidase Genes in the Oyster Mushroom Genome: Heterologous Expression, Molecular Structure, Catalytic and Stability Properties, and Lignin-Degrading Ability.
pubmed doi rcsb
molecule keywords MANGANESE PEROXIDASE 4
molecule tags Oxidoreductase
source organism Pleurotus ostreatus
total genus 112
structure length 337
sequence length 337
ec nomenclature ec 1.11.1.13: Manganese peroxidase.
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
A PF11895 Peroxidase_ext Fungal peroxidase extension region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4bm2A02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4bm2A01
2V2EA 5FNBA 2EUQA 2IA8A 1EBEA 1H5EA 1ARWA 1B82A 1A2FA 1AEJA 1ARYA 2Y6BA 1ZBZA 3FMUA 5FNEA 5CICA 3M25A 1BEMA 3M2IA 3EXBA 1DSGA 5KQ3A 5SW6A 3M27A 2CL4X 1QO4A 1SDQA 1H5GA 4JMBA 1AEBA 3Q3UA 3RIWA 2EUPA 2CYPA 1S6VA 1AC8A 3M26A 3M8MA 1SCHA 2YCGA 3VLLA 1CPDA 5SYIA 1UB2A 4JMSA 3ATJA 5SXTA 5ABQA 3VLJA 4BM0A 2WD4A 4C51A 1AEUA 4JMVA 1KZMA 3RRWA 5CIFA 1QGJA 1CCIA 3M29A 4XV8A 3HDLA 1GW2A 4JMWA 5SW5A 5L02A 3R98A 1CCAA 5SYUA 4NVOB 4JQNA 1AC4A 3FKGA 5SYXA 1BJ9A 3M2CA 7ATJA 4A6ZA 4CVJA 2B0ZA 4JM8A 1U2LA 2EUSA 2VNXX 3FM6A 1ARXA 1BEJA 2GB8A 2AS2A 3CCXA 1MKQA 5SXXA 3E2NA 1ARVA 4NVHB 1MN1A 1YYGA 5SXRA 4BLLA 4NVLA 1MK8A 2PCCA 5SYKA 1SJ2A 3WXOA 4JM5A 1AESA 2B10A 4BLKA 4CZOA 1BESA 1DS4A 2XJ6A 1ZBYA 4NVGB 5KSFA 1AEKA 3FJWA 4G05A 1DSOA 1CMQA 1CPGA 1B85A 2AS4A 1MN2A 2EUOA 3M2BA 5CJHA 1PA2A 1JCIA 2VO2X 1AEOA 3M2FA 2XJ8A 5SYWA 5JHZA 3CCPA 4CVIA 2VCFX 1ARPA 5SYJA 1GZAA 1IYNA 2V23A 2XIFA 1LLPA 2GHEX 1H5FA 2EUUA 5AMMA 4P4QA 1BEQA 1AEGA 2RBXX 1GWOA 1OAFA 1CK6A 2GHHX 5CIDA 4NVJB 1H55A 2VKAA 1AEMA 1AA4A 3M28A 5AL9A 2VCSA 1U75A 2BOQA 4NVDA 5CIEA 5ALAA 1CPFA 2E3AA 4XV6A 2XILA 5KQ6A 3ZCYA 2CCAA 1CCKA 1U2JA 4XVAA 1H5IA 4C50A 5D6MA 1C8IA 3RIVA 1CYFA 5CIBA 5ABNA 1DJ1A 4NVBA 1BEPA 5SXWA 5L05A 1DJ5A 4CZPA 3E2OA 2XJ5A 1H5DA 1SOGA 1DSEA 4JPTA 4JB4A 4NVKB 2AS3A 4NVAA 1B80A 2AS1A 5KQHA 4FEFA 2RBUX 4XV5A 3VLIA 3M2DA 1H57A 4JN0A 1KRJA 2RBYX 2CEPA 5KQKA 4NVNB 4BLZA 2Y5AA 4JM9A 4FCSA 5SXQA 2ATJA 1H58A 4BLNA 1GWTA 1LY9A 2ANZA 4OQ7A 1CCBA 1V0HX 2EUNA 3M2AA 1CMTA 2B11A 5JQRA 5KQ2A 4BM4A 5SXSA 1CCLA 4FDQA 1LGAA 3M5QA 1ARUA 1ML2A 5SX3A 2GHDX 2N18A 1CCEA 4PAEA 5SYYA 5CIGA 1W4WA 1AEDA 4A7MA 1CCGA 5KQIA 1AEHA 4ATJA 1CCPA 4NVFA 1AETA 2AS6A 3ZCHA 1KXMA 2XIHA 4JMTA 5EJXA 3WNUA 3M2EA 1ITKA 4BM1A 1YYDA 1HSRA 1Z53A 5JHXA 4CZQA 2CCDA 3VLMA 5CCPA 1HCHA 1CMPA 2PCBA 3VLKA 1KXNA 1LYKA 2GGNX 3FM1A 1AEVA 5SW4A 4A71A 2ICVA 5JHYA 2EURA 2VNZX 4USCA 5KSKA 1GZBA 1QPAA 2GHKX 1YZPA 4NVIB 2RBWX 1GX2A 1H5MA 5SX1A 3UW8A 1H5HA 4GEDA 4NVEA 4CZRA 1GWUA 3M23A 1DSPA 2RBZX 3X16A 1H5KA 5SYVA 5AOGA 4A78A 5SX6A 4CZNA 2W23A 1CPEA 1RYCA 4JMAA 4XV7A 5SX7A 5SX0B 4NFGA 4FCNA 4JMZA 1W4YA 2XI6A 1H3JA 6ATJA 1MKRA 5EJTA 1AENA 3R99A 1CMUA 2EUTA 2Y6AA 4JPUA 4NVCA 1JDRA 1S73A 2E39A 5CIHA 1LY8A 2GHCX 1STQA 3UT2A 4BLYA 1H5CA 5JPRA 1OAGA 5KQ0A 2CCPA 2RC1X 2BCNA 4JQMA 1AEEA 2YLJA 1APXA 4BM2A 1DCCA 1SBMA 2RC2X 1AEFA 1U2KA 2RBTX 1LYCA 3M2HA 4NVMB 4JPLA 5SX2A 3VLHA 1FHFA 1KOKA 1AEQA 1A2GA 6CCPA 4JQKA 4BLXA 2RBVX 3FM4A 1ATJA 1CCCA 1U74A 1H5JA 2B12A 1YZRA 1H5AA 5SYLA 1BGPA 3ZCGA 4CCPA 5ABOA 5L86A 3M2GA 1BEKA 4CCXA 2JTIA 1MNPA 2X07A 2X08A 1BVAA 4BM3A 4CUOA 7CCPA 4A5GA 4JQJA 5SX0A 1CCJA 2AQDA 2E3BA 4XV4A 5SYHA 1H5LA 4JM6A 2RC0X 2VCNA
chains in the Genus database with same CATH superfamily
2V2EA 5FNBA 2EUQA 2IA8A 1EBEA 1H5EA 1ARWA 1B82A 1A2FA 1AEJA 1ARYA 2Y6BA 1ZBZA 3FMUA 5FNEA 5CICA 3M25A 1BEMA 3M2IA 2BO5A 3EXBA 1DSGA 5KQ3A 5SW6A 1ABVA 4H7AA 3M27A 2CL4X 1QO4A 1SDQA 1H5GA 2OEBA 4JMBA 1AEBA 4JZAA 3Q3UA 3RIWA 2EUPA 2CYPA 1S6VA 1AC8A 3M26A 3M8MA 1SCHA 2YCGA 3VLLA 1CPDA 5SYIA 1UB2A 4JMSA 3ATJA 5SXTA 5ABQA 3VLJA 4BM0A 2WD4A 4C51A 4U7UB 1AEUA 4JMVA 1KZMA 3RRWA 5CIFA 1QGJA 1CCIA 3M29A 4XV8A 3HDLA 1GW2A 4JMWA 5SW5A 5L02A 4H79A 2JMXA 3R98A 1CCAA 5SYUA 4NVOB 4JQNA 1AC4A 3FKGA 5SYXA 1BJ9A 3M2CA 7ATJA 4A6ZA 4CVJA 2B0ZA 4JM8A 1U2LA 2EUSA 2VNXX 3FM6A 1ARXA 1BEJA 2GB8A 2AS2A 3CCXA 1MKQA 5SXXA 3E2NA 1ARVA 4NVHB 1MN1A 1YYGA 5SXRA 4BLLA 4NVLA 1MK8A 2PCCA 5SYKA 2ZOPA 1SJ2A 3WXOA 4JM5A 1AESA 2B10A 4BLKA 4CZOA 1BESA 1DS4A 2XJ6A 1ZBYA 4NVGB 5KSFA 1AEKA 3FJWA 4G05A 1DSOA 1CMQA 1CPGA 1B85A 2AS4A 1MN2A 2EUOA 3M2BA 5CJHA 1PA2A 1JCIA 2VO2X 1AEOA 3M2FA 2XJ8A 5SYWA 5JHZA 3CCPA 4CVIA 2VCFX 1ARPA 5SYJA 1GZAA 1IYNA 4GKFA 2V23A 2XIFA 1LLPA 2GHEX 1H5FA 2EUUA 5AMMA 4P4QA 1BEQA 1AEGA 5H9FB 2RBXX 1GWOA 1OAFA 1CK6A 2GHHX 5CIDA 4NVJB 1H55A 2VKAA 1AEMA 1AA4A 3M28A 5AL9A 2VCSA 1U75A 2BOQA 4NVDA 5CIEA 5ALAA 1CPFA 2E3AA 4XV6A 2XILA 5KQ6A 3ZCYA 2CCAA 1CCKA 1U2JA 4XVAA 1H5IA 4C50A 5D6MA 1C8IA 3RIVA 1CYFA 5CIBA 5ABNA 1DJ1A 4NVBA 1BEPA 5SXWA 5L05A 1DJ5A 4CZPA 3E2OA 2XJ5A 1H5DA 1SOGA 1DSEA 4JPTA 4JB4A 4NVKB 2AS3A 4NVAA 1B80A 2AS1A 5KQHA 4FEFA 2RBUX 4XV5A 3VLIA 3M2DA 1H57A 4JN0A 1KRJA 2RBYX 2CEPA 5KQKA 4NVNB 4BLZA 2Y5AA 4JM9A 4FCSA 5SXQA 2ATJA 1H58A 4BLNA 1GWTA 1LY9A 2ANZA 4OQ7A 1CCBA 1V0HX 2EUNA 3M2AA 1CMTA 2B11A 5JQRA 5KQ2A 4BM4A 5SXSA 1CCLA 4FDQA 1LGAA 3M5QA 1ARUA 1ML2A 5SX3A 2GHDX 2N18A 1CCEA 4PAEA 5SYYA 5CIGA 1W4WA 1AEDA 4A7MA 1CCGA 5KQIA 1AEHA 4ATJA 1CCPA 4NVFA 1AETA 2AS6A 3ZCHA 1KXMA 2XIHA 4JMTA 5EJXA 3WNUA 3WA8A 3M2EA 1ITKA 4BM1A 1YYDA 1HSRA 1Z53A 5JHXA 4CZQA 2CCDA 3VLMA 5CCPA 1HCHA 1CMPA 2PCBA 3VLKA 1KXNA 1LYKA 2GGNX 3FM1A 1AEVA 5SW4A 4A71A 2ICVA 5JHYA 2EURA 2VNZX 4USCA 5KSKA 1GZBA 1QPAA 2GHKX 1YZPA 4NVIB 2RBWX 1GX2A 1H5MA 5SX1A 3UW8A 1H5HA 4GEDA 4NVEA 4CZRA 1GWUA 3M23A 1DSPA 2RBZX 3X16A 1H5KA 5SYVA 5AOGA 4A78A 5SX6A 4CZNA 2W23A 1CPEA 1RYCA 4JMAA 4XV7A 5SX7A 5SX0B 4NFGA 4FCNA 4JMZA 1W4YA 2XI6A 1H3JA 6ATJA 1MKRA 5EJTA 1AENA 3R99A 1CMUA 2EUTA 2Y6AA 4JPUA 4NVCA 1JDRA 1S73A 2E39A 5CIHA 1LY8A 2GHCX 1STQA 3UT2A 4BLYA 1H5CA 5JPRA 1OAGA 5KQ0A 2A7UB 2CCPA 2RC1X 2BCNA 4JQMA 1AEEA 2YLJA 3X1LF 1APXA 4BM2A 1DCCA 1SBMA 2RC2X 1AEFA 5CD4J 1U2KA 2RBTX 1LYCA 3M2HA 4NVMB 4JPLA 5SX2A 3VLHA 1FHFA 1KOKA 1AEQA 1A2GA 6CCPA 4JQKA 4BLXA 2RBVX 3FM4A 1ATJA 1CCCA 1U74A 1H5JA 2WSSS 5H9EB 2B12A 1YZRA 1H5AA 5SYLA 1BGPA 3ZCGA 4CCPA 5ABOA 5L86A 3M2GA 1BEKA 4CCXA 2JTIA 1MNPA 2X07A 4QYZB 2X08A 1BVAA 4BM3A 4CUOA 7CCPA 4A5GA 4JQJA 2ZCAA 5SX0A 1CCJA 2AQDA 2E3BA 4XV4A 5SYHA 1H5LA 4JM6A 2RC0X 2VCNA
chains in the Genus database with same CATH topology
2V2EA 5FNBA 2EUQA 2IA8A 1EBEA 1H5EA 1ARWA 1B82A 1A2FA 1AEJA 1ARYA 2Y6BA 1ZBZA 3FMUA 5FNEA 5CICA 3M25A 1BEMA 3M2IA 3EXBA 1DSGA 5KQ3A 5SW6A 4H7AA 3M27A 2CL4X 1QO4A 1SDQA 1H5GA 4JMBA 1AEBA 4JZAA 3Q3UA 3RIWA 2EUPA 2CYPA 1S6VA 1AC8A 3M26A 3M8MA 1SCHA 2YCGA 3VLLA 1CPDA 5SYIA 1UB2A 4JMSA 3ATJA 5SXTA 5ABQA 3VLJA 4BM0A 2WD4A 4C51A 4U7UB 1AEUA 4JMVA 1KZMA 3RRWA 5CIFA 1QGJA 1CCIA 3M29A 4XV8A 3HDLA 1GW2A 4JMWA 5SW5A 5L02A 4H79A 3R98A 1CCAA 5SYUA 4NVOB 4JQNA 1AC4A 3FKGA 5SYXA 1BJ9A 3M2CA 7ATJA 4A6ZA 4CVJA 2B0ZA 4JM8A 1U2LA 2EUSA 2VNXX 3FM6A 1ARXA 1BEJA 2GB8A 2AS2A 3CCXA 1MKQA 5SXXA 3E2NA 1ARVA 4NVHB 1MN1A 1YYGA 5SXRA 4BLLA 4NVLA 1MK8A 2PCCA 5SYKA 1SJ2A 3WXOA 4JM5A 1AESA 2B10A 4BLKA 4CZOA 1BESA 1DS4A 2XJ6A 1ZBYA 4NVGB 5KSFA 1AEKA 3FJWA 4G05A 1DSOA 1CMQA 1CPGA 1B85A 2AS4A 1MN2A 2EUOA 3M2BA 5CJHA 1PA2A 1JCIA 2VO2X 1AEOA 3M2FA 2XJ8A 5SYWA 5JHZA 3CCPA 4CVIA 2VCFX 1ARPA 5SYJA 1GZAA 1IYNA 2V23A 2XIFA 1LLPA 2GHEX 1H5FA 2EUUA 5AMMA 4P4QA 1BEQA 1AEGA 5H9FB 2RBXX 1GWOA 1OAFA 1CK6A 2GHHX 5CIDA 4NVJB 1H55A 2VKAA 1AEMA 1AA4A 3M28A 5AL9A 2VCSA 1U75A 2BOQA 4NVDA 5CIEA 5ALAA 1CPFA 2E3AA 4XV6A 2XILA 5KQ6A 3ZCYA 2CCAA 1CCKA 1U2JA 4XVAA 1H5IA 4C50A 5D6MA 1C8IA 3RIVA 1CYFA 5CIBA 5ABNA 1DJ1A 4NVBA 1BEPA 5SXWA 5L05A 1DJ5A 4CZPA 3E2OA 2XJ5A 1H5DA 1SOGA 1DSEA 4JPTA 4JB4A 4NVKB 2AS3A 4NVAA 1B80A 2AS1A 5KQHA 4FEFA 2RBUX 4XV5A 3VLIA 3M2DA 1H57A 4JN0A 1KRJA 2RBYX 2CEPA 5KQKA 4NVNB 4BLZA 2Y5AA 4JM9A 4FCSA 5SXQA 2ATJA 1H58A 4BLNA 1GWTA 1LY9A 2ANZA 4OQ7A 1CCBA 1V0HX 2EUNA 3M2AA 1CMTA 2B11A 5JQRA 5KQ2A 4BM4A 5SXSA 1CCLA 4FDQA 1LGAA 3M5QA 1ARUA 1ML2A 5SX3A 2GHDX 2N18A 1CCEA 4PAEA 5SYYA 5CIGA 1W4WA 1AEDA 4A7MA 1CCGA 5KQIA 1AEHA 4ATJA 1CCPA 4NVFA 1AETA 2AS6A 3ZCHA 1KXMA 2XIHA 4JMTA 5EJXA 3WNUA 3WA8A 3M2EA 1ITKA 4BM1A 1YYDA 1HSRA 1Z53A 5JHXA 4CZQA 2CCDA 3VLMA 5CCPA 1HCHA 1CMPA 2PCBA 3VLKA 1KXNA 1LYKA 2GGNX 3FM1A 1AEVA 5SW4A 4A71A 2ICVA 5JHYA 2EURA 2VNZX 4USCA 5KSKA 1GZBA 1QPAA 2GHKX 1YZPA 4NVIB 2RBWX 1GX2A 1H5MA 5SX1A 3UW8A 1H5HA 4GEDA 4NVEA 4CZRA 1GWUA 3M23A 1DSPA 2RBZX 3X16A 1H5KA 5SYVA 5AOGA 4A78A 5SX6A 4CZNA 2W23A 1CPEA 1RYCA 4JMAA 4XV7A 5SX7A 5SX0B 4NFGA 4FCNA 4JMZA 1W4YA 2XI6A 1H3JA 6ATJA 1MKRA 5EJTA 1AENA 3R99A 1CMUA 2EUTA 2Y6AA 4JPUA 4NVCA 1JDRA 1S73A 2E39A 5CIHA 1LY8A 2GHCX 1STQA 3UT2A 4BLYA 1H5CA 5JPRA 1OAGA 5KQ0A 2CCPA 2RC1X 2BCNA 4JQMA 1AEEA 2YLJA 1APXA 4BM2A 1DCCA 1SBMA 2RC2X 1AEFA 5CD4J 1U2KA 2RBTX 1LYCA 3M2HA 4NVMB 4JPLA 5SX2A 3VLHA 1FHFA 1KOKA 1AEQA 1A2GA 6CCPA 4JQKA 4BLXA 2RBVX 3FM4A 1ATJA 1CCCA 1U74A 1H5JA 5H9EB 2B12A 1YZRA 1H5AA 5SYLA 1BGPA 3ZCGA 4CCPA 5ABOA 5L86A 3M2GA 1BEKA 4CCXA 2JTIA 1MNPA 2X07A 4QYZB 2X08A 1BVAA 4BM3A 4CUOA 7CCPA 4A5GA 4JQJA 2ZCAA 5SX0A 1CCJA 2AQDA 2E3BA 4XV4A 5SYHA 1H5LA 4JM6A 2RC0X 2VCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2E A;  5FNB A;  2EUQ A;  2IA8 A;  1EBE A;  1H5E A;  1ARW A;  1B82 A;  1A2F A;  1AEJ A;  1ARY A;  2Y6B A;  1ZBZ A;  3FMU A;  5FNE A;  5CIC A;  3M25 A;  1BEM A;  3M2I A;  3EXB A;  1DSG A;  5KQ3 A;  5SW6 A;  3M27 A;  2CL4 X;  1QO4 A;  1SDQ A;  1H5G A;  4JMB A;  1AEB A;  3Q3U A;  3RIW A;  2EUP A;  2CYP A;  1S6V A;  1AC8 A;  3M26 A;  3M8M A;  1SCH A;  2YCG A;  3VLL A;  1CPD A;  5SYI A;  1UB2 A;  4JMS A;  3ATJ A;  5SXT A;  5ABQ A;  3VLJ A;  4BM0 A;  2WD4 A;  4C51 A;  1AEU A;  4JMV A;  1KZM A;  3RRW A;  5CIF A;  1QGJ A;  1CCI A;  3M29 A;  4XV8 A;  3HDL A;  1GW2 A;  4JMW A;  5SW5 A;  5L02 A;  3R98 A;  1CCA A;  5SYU A;  4NVO B;  4JQN A;  1AC4 A;  3FKG A;  5SYX A;  1BJ9 A;  3M2C A;  7ATJ A;  4A6Z A;  4CVJ A;  2B0Z A;  4JM8 A;  1U2L A;  2EUS A;  2VNX X;  3FM6 A;  1ARX A;  1BEJ A;  2GB8 A;  2AS2 A;  3CCX A;  1MKQ A;  5SXX A;  3E2N A;  1ARV A;  4NVH B;  1MN1 A;  1YYG A;  5SXR A;  4BLL A;  4NVL A;  1MK8 A;  2PCC A;  5SYK A;  1SJ2 A;  3WXO A;  4JM5 A;  1AES A;  2B10 A;  4BLK A;  4CZO A;  1BES A;  1DS4 A;  2XJ6 A;  1ZBY A;  4NVG B;  5KSF A;  1AEK A;  3FJW A;  4G05 A;  1DSO A;  1CMQ A;  1CPG A;  1B85 A;  2AS4 A;  1MN2 A;  2EUO A;  3M2B A;  5CJH A;  1PA2 A;  1JCI A;  2VO2 X;  1AEO A;  3M2F A;  2XJ8 A;  5SYW A;  5JHZ A;  3CCP A;  4CVI A;  2VCF X;  1ARP A;  5SYJ A;  1GZA A;  1IYN A;  2V23 A;  2XIF A;  1LLP A;  2GHE X;  1H5F A;  2EUU A;  5AMM A;  4P4Q A;  1BEQ A;  1AEG A;  2RBX X;  1GWO A;  1OAF A;  1CK6 A;  2GHH X;  5CID A;  4NVJ B;  1H55 A;  2VKA A;  1AEM A;  1AA4 A;  3M28 A;  5AL9 A;  2VCS A;  1U75 A;  2BOQ A;  4NVD A;  5CIE A;  5ALA A;  1CPF A;  2E3A A;  4XV6 A;  2XIL A;  5KQ6 A;  3ZCY A;  2CCA A;  1CCK A;  1U2J A;  4XVA A;  1H5I A;  4C50 A;  5D6M A;  1C8I A;  3RIV A;  1CYF A;  5CIB A;  5ABN A;  1DJ1 A;  4NVB A;  1BEP A;  5SXW A;  5L05 A;  1DJ5 A;  4CZP A;  3E2O A;  2XJ5 A;  1H5D A;  1SOG A;  1DSE A;  4JPT A;  4JB4 A;  4NVK B;  2AS3 A;  4NVA A;  1B80 A;  2AS1 A;  5KQH A;  4FEF A;  2RBU X;  4XV5 A;  3VLI A;  3M2D A;  1H57 A;  4JN0 A;  1KRJ A;  2RBY X;  2CEP A;  5KQK A;  4NVN B;  4BLZ A;  2Y5A A;  4JM9 A;  4FCS A;  5SXQ A;  2ATJ A;  1H58 A;  4BLN A;  1GWT A;  1LY9 A;  2ANZ A;  4OQ7 A;  1CCB A;  1V0H X;  2EUN A;  3M2A A;  1CMT A;  2B11 A;  5JQR A;  5KQ2 A;  4BM4 A;  5SXS A;  1CCL A;  4FDQ A;  1LGA A;  3M5Q A;  1ARU A;  1ML2 A;  5SX3 A;  2GHD X;  2N18 A;  1CCE A;  4PAE A;  5SYY A;  5CIG A;  1W4W A;  1AED A;  4A7M A;  1CCG A;  5KQI A;  1AEH A;  4ATJ A;  1CCP A;  4NVF A;  1AET A;  2AS6 A;  3ZCH A;  1KXM A;  2XIH A;  4JMT A;  5EJX A;  3WNU A;  3M2E A;  1ITK A;  4BM1 A;  1YYD A;  1HSR A;  1Z53 A;  5JHX A;  4CZQ A;  2CCD A;  3VLM A;  5CCP A;  1HCH A;  1CMP A;  2PCB A;  3VLK A;  1KXN A;  1LYK A;  2GGN X;  3FM1 A;  1AEV A;  5SW4 A;  4A71 A;  2ICV A;  5JHY A;  2EUR A;  2VNZ X;  4USC A;  5KSK A;  1GZB A;  1QPA A;  2GHK X;  1YZP A;  4NVI B;  2RBW X;  1GX2 A;  1H5M A;  5SX1 A;  3UW8 A;  1H5H A;  4GED A;  4NVE A;  4CZR A;  1GWU A;  3M23 A;  1DSP A;  2RBZ X;  3X16 A;  1H5K A;  5SYV A;  5AOG A;  4A78 A;  5SX6 A;  4CZN A;  2W23 A;  1CPE A;  1RYC A;  4JMA A;  4XV7 A;  5SX7 A;  5SX0 B;  4NFG A;  4FCN A;  4JMZ A;  1W4Y A;  2XI6 A;  1H3J A;  6ATJ A;  1MKR A;  5EJT A;  1AEN A;  3R99 A;  1CMU A;  2EUT A;  2Y6A A;  4JPU A;  4NVC A;  1JDR A;  1S73 A;  2E39 A;  5CIH A;  1LY8 A;  2GHC X;  1STQ A;  3UT2 A;  4BLY A;  1H5C A;  5JPR A;  1OAG A;  5KQ0 A;  2CCP A;  2RC1 X;  2BCN A;  4JQM A;  1AEE A;  2YLJ A;  1APX A;  4BM2 A;  1DCC A;  1SBM A;  2RC2 X;  1AEF A;  1U2K A;  2RBT X;  1LYC A;  3M2H A;  4NVM B;  4JPL A;  5SX2 A;  3VLH A;  1FHF A;  1KOK A;  1AEQ A;  1A2G A;  6CCP A;  4JQK A;  4BLX A;  2RBV X;  3FM4 A;  1ATJ A;  1CCC A;  1U74 A;  1H5J A;  2B12 A;  1YZR A;  1H5A A;  5SYL A;  1BGP A;  3ZCG A;  4CCP A;  5ABO A;  5L86 A;  3M2G A;  1BEK A;  4CCX A;  2JTI A;  1MNP A;  2X07 A;  2X08 A;  1BVA A;  4BM3 A;  4CUO A;  7CCP A;  4A5G A;  4JQJ A;  5SX0 A;  1CCJ A;  2AQD A;  2E3B A;  4XV4 A;  5SYH A;  1H5L A;  4JM6 A;  2RC0 X;  2VCN A; 
#chains in the Genus database with same CATH topology
 2V2E A;  5FNB A;  2EUQ A;  2IA8 A;  1EBE A;  1H5E A;  1ARW A;  1B82 A;  1A2F A;  1AEJ A;  1ARY A;  2Y6B A;  1ZBZ A;  3FMU A;  5FNE A;  5CIC A;  3M25 A;  1BEM A;  3M2I A;  2BO5 A;  3EXB A;  1DSG A;  5KQ3 A;  5SW6 A;  1ABV A;  4H7A A;  3M27 A;  2CL4 X;  1QO4 A;  1SDQ A;  1H5G A;  2OEB A;  4JMB A;  1AEB A;  4JZA A;  3Q3U A;  3RIW A;  2EUP A;  2CYP A;  1S6V A;  1AC8 A;  3M26 A;  3M8M A;  1SCH A;  2YCG A;  3VLL A;  1CPD A;  5SYI A;  1UB2 A;  4JMS A;  3ATJ A;  5SXT A;  5ABQ A;  3VLJ A;  4BM0 A;  2WD4 A;  4C51 A;  4U7U B;  1AEU A;  4JMV A;  1KZM A;  3RRW A;  5CIF A;  1QGJ A;  1CCI A;  3M29 A;  4XV8 A;  3HDL A;  1GW2 A;  4JMW A;  5SW5 A;  5L02 A;  4H79 A;  2JMX A;  3R98 A;  1CCA A;  5SYU A;  4NVO B;  4JQN A;  1AC4 A;  3FKG A;  5SYX A;  1BJ9 A;  3M2C A;  7ATJ A;  4A6Z A;  4CVJ A;  2B0Z A;  4JM8 A;  1U2L A;  2EUS A;  2VNX X;  3FM6 A;  1ARX A;  1BEJ A;  2GB8 A;  2AS2 A;  3CCX A;  1MKQ A;  5SXX A;  3E2N A;  1ARV A;  4NVH B;  1MN1 A;  1YYG A;  5SXR A;  4BLL A;  4NVL A;  1MK8 A;  2PCC A;  5SYK A;  2ZOP A;  1SJ2 A;  3WXO A;  4JM5 A;  1AES A;  2B10 A;  4BLK A;  4CZO A;  1BES A;  1DS4 A;  2XJ6 A;  1ZBY A;  4NVG B;  5KSF A;  1AEK A;  3FJW A;  4G05 A;  1DSO A;  1CMQ A;  1CPG A;  1B85 A;  2AS4 A;  1MN2 A;  2EUO A;  3M2B A;  5CJH A;  1PA2 A;  1JCI A;  2VO2 X;  1AEO A;  3M2F A;  2XJ8 A;  5SYW A;  5JHZ A;  3CCP A;  4CVI A;  2VCF X;  1ARP A;  5SYJ A;  1GZA A;  1IYN A;  4GKF A;  2V23 A;  2XIF A;  1LLP A;  2GHE X;  1H5F A;  2EUU A;  5AMM A;  4P4Q A;  1BEQ A;  1AEG A;  5H9F B;  2RBX X;  1GWO A;  1OAF A;  1CK6 A;  2GHH X;  5CID A;  4NVJ B;  1H55 A;  2VKA A;  1AEM A;  1AA4 A;  3M28 A;  5AL9 A;  2VCS A;  1U75 A;  2BOQ A;  4NVD A;  5CIE A;  5ALA A;  1CPF A;  2E3A A;  4XV6 A;  2XIL A;  5KQ6 A;  3ZCY A;  2CCA A;  1CCK A;  1U2J A;  4XVA A;  1H5I A;  4C50 A;  5D6M A;  1C8I A;  3RIV A;  1CYF A;  5CIB A;  5ABN A;  1DJ1 A;  4NVB A;  1BEP A;  5SXW A;  5L05 A;  1DJ5 A;  4CZP A;  3E2O A;  2XJ5 A;  1H5D A;  1SOG A;  1DSE A;  4JPT A;  4JB4 A;  4NVK B;  2AS3 A;  4NVA A;  1B80 A;  2AS1 A;  5KQH A;  4FEF A;  2RBU X;  4XV5 A;  3VLI A;  3M2D A;  1H57 A;  4JN0 A;  1KRJ A;  2RBY X;  2CEP A;  5KQK A;  4NVN B;  4BLZ A;  2Y5A A;  4JM9 A;  4FCS A;  5SXQ A;  2ATJ A;  1H58 A;  4BLN A;  1GWT A;  1LY9 A;  2ANZ A;  4OQ7 A;  1CCB A;  1V0H X;  2EUN A;  3M2A A;  1CMT A;  2B11 A;  5JQR A;  5KQ2 A;  4BM4 A;  5SXS A;  1CCL A;  4FDQ A;  1LGA A;  3M5Q A;  1ARU A;  1ML2 A;  5SX3 A;  2GHD X;  2N18 A;  1CCE A;  4PAE A;  5SYY A;  5CIG A;  1W4W A;  1AED A;  4A7M A;  1CCG A;  5KQI A;  1AEH A;  4ATJ A;  1CCP A;  4NVF A;  1AET A;  2AS6 A;  3ZCH A;  1KXM A;  2XIH A;  4JMT A;  5EJX A;  3WNU A;  3WA8 A;  3M2E A;  1ITK A;  4BM1 A;  1YYD A;  1HSR A;  1Z53 A;  5JHX A;  4CZQ A;  2CCD A;  3VLM A;  5CCP A;  1HCH A;  1CMP A;  2PCB A;  3VLK A;  1KXN A;  1LYK A;  2GGN X;  3FM1 A;  1AEV A;  5SW4 A;  4A71 A;  2ICV A;  5JHY A;  2EUR A;  2VNZ X;  4USC A;  5KSK A;  1GZB A;  1QPA A;  2GHK X;  1YZP A;  4NVI B;  2RBW X;  1GX2 A;  1H5M A;  5SX1 A;  3UW8 A;  1H5H A;  4GED A;  4NVE A;  4CZR A;  1GWU A;  3M23 A;  1DSP A;  2RBZ X;  3X16 A;  1H5K A;  5SYV A;  5AOG A;  4A78 A;  5SX6 A;  4CZN A;  2W23 A;  1CPE A;  1RYC A;  4JMA A;  4XV7 A;  5SX7 A;  5SX0 B;  4NFG A;  4FCN A;  4JMZ A;  1W4Y A;  2XI6 A;  1H3J A;  6ATJ A;  1MKR A;  5EJT A;  1AEN A;  3R99 A;  1CMU A;  2EUT A;  2Y6A A;  4JPU A;  4NVC A;  1JDR A;  1S73 A;  2E39 A;  5CIH A;  1LY8 A;  2GHC X;  1STQ A;  3UT2 A;  4BLY A;  1H5C A;  5JPR A;  1OAG A;  5KQ0 A;  2A7U B;  2CCP A;  2RC1 X;  2BCN A;  4JQM A;  1AEE A;  2YLJ A;  3X1L F;  1APX A;  4BM2 A;  1DCC A;  1SBM A;  2RC2 X;  1AEF A;  5CD4 J;  1U2K A;  2RBT X;  1LYC A;  3M2H A;  4NVM B;  4JPL A;  5SX2 A;  3VLH A;  1FHF A;  1KOK A;  1AEQ A;  1A2G A;  6CCP A;  4JQK A;  4BLX A;  2RBV X;  3FM4 A;  1ATJ A;  1CCC A;  1U74 A;  1H5J A;  2WSS S;  5H9E B;  2B12 A;  1YZR A;  1H5A A;  5SYL A;  1BGP A;  3ZCG A;  4CCP A;  5ABO A;  5L86 A;  3M2G A;  1BEK A;  4CCX A;  2JTI A;  1MNP A;  2X07 A;  4QYZ B;  2X08 A;  1BVA A;  4BM3 A;  4CUO A;  7CCP A;  4A5G A;  4JQJ A;  2ZCA A;  5SX0 A;  1CCJ A;  2AQD A;  2E3B A;  4XV4 A;  5SYH A;  1H5L A;  4JM6 A;  2RC0 X;  2VCN A; 
#chains in the Genus database with same CATH homology
 2V2E A;  5FNB A;  2EUQ A;  2IA8 A;  1EBE A;  1H5E A;  1ARW A;  1B82 A;  1A2F A;  1AEJ A;  1ARY A;  2Y6B A;  1ZBZ A;  3FMU A;  5FNE A;  5CIC A;  3M25 A;  1BEM A;  3M2I A;  3EXB A;  1DSG A;  5KQ3 A;  5SW6 A;  4H7A A;  3M27 A;  2CL4 X;  1QO4 A;  1SDQ A;  1H5G A;  4JMB A;  1AEB A;  4JZA A;  3Q3U A;  3RIW A;  2EUP A;  2CYP A;  1S6V A;  1AC8 A;  3M26 A;  3M8M A;  1SCH A;  2YCG A;  3VLL A;  1CPD A;  5SYI A;  1UB2 A;  4JMS A;  3ATJ A;  5SXT A;  5ABQ A;  3VLJ A;  4BM0 A;  2WD4 A;  4C51 A;  4U7U B;  1AEU A;  4JMV A;  1KZM A;  3RRW A;  5CIF A;  1QGJ A;  1CCI A;  3M29 A;  4XV8 A;  3HDL A;  1GW2 A;  4JMW A;  5SW5 A;  5L02 A;  4H79 A;  3R98 A;  1CCA A;  5SYU A;  4NVO B;  4JQN A;  1AC4 A;  3FKG A;  5SYX A;  1BJ9 A;  3M2C A;  7ATJ A;  4A6Z A;  4CVJ A;  2B0Z A;  4JM8 A;  1U2L A;  2EUS A;  2VNX X;  3FM6 A;  1ARX A;  1BEJ A;  2GB8 A;  2AS2 A;  3CCX A;  1MKQ A;  5SXX A;  3E2N A;  1ARV A;  4NVH B;  1MN1 A;  1YYG A;  5SXR A;  4BLL A;  4NVL A;  1MK8 A;  2PCC A;  5SYK A;  1SJ2 A;  3WXO A;  4JM5 A;  1AES A;  2B10 A;  4BLK A;  4CZO A;  1BES A;  1DS4 A;  2XJ6 A;  1ZBY A;  4NVG B;  5KSF A;  1AEK A;  3FJW A;  4G05 A;  1DSO A;  1CMQ A;  1CPG A;  1B85 A;  2AS4 A;  1MN2 A;  2EUO A;  3M2B A;  5CJH A;  1PA2 A;  1JCI A;  2VO2 X;  1AEO A;  3M2F A;  2XJ8 A;  5SYW A;  5JHZ A;  3CCP A;  4CVI A;  2VCF X;  1ARP A;  5SYJ A;  1GZA A;  1IYN A;  2V23 A;  2XIF A;  1LLP A;  2GHE X;  1H5F A;  2EUU A;  5AMM A;  4P4Q A;  1BEQ A;  1AEG A;  5H9F B;  2RBX X;  1GWO A;  1OAF A;  1CK6 A;  2GHH X;  5CID A;  4NVJ B;  1H55 A;  2VKA A;  1AEM A;  1AA4 A;  3M28 A;  5AL9 A;  2VCS A;  1U75 A;  2BOQ A;  4NVD A;  5CIE A;  5ALA A;  1CPF A;  2E3A A;  4XV6 A;  2XIL A;  5KQ6 A;  3ZCY A;  2CCA A;  1CCK A;  1U2J A;  4XVA A;  1H5I A;  4C50 A;  5D6M A;  1C8I A;  3RIV A;  1CYF A;  5CIB A;  5ABN A;  1DJ1 A;  4NVB A;  1BEP A;  5SXW A;  5L05 A;  1DJ5 A;  4CZP A;  3E2O A;  2XJ5 A;  1H5D A;  1SOG A;  1DSE A;  4JPT A;  4JB4 A;  4NVK B;  2AS3 A;  4NVA A;  1B80 A;  2AS1 A;  5KQH A;  4FEF A;  2RBU X;  4XV5 A;  3VLI A;  3M2D A;  1H57 A;  4JN0 A;  1KRJ A;  2RBY X;  2CEP A;  5KQK A;  4NVN B;  4BLZ A;  2Y5A A;  4JM9 A;  4FCS A;  5SXQ A;  2ATJ A;  1H58 A;  4BLN A;  1GWT A;  1LY9 A;  2ANZ A;  4OQ7 A;  1CCB A;  1V0H X;  2EUN A;  3M2A A;  1CMT A;  2B11 A;  5JQR A;  5KQ2 A;  4BM4 A;  5SXS A;  1CCL A;  4FDQ A;  1LGA A;  3M5Q A;  1ARU A;  1ML2 A;  5SX3 A;  2GHD X;  2N18 A;  1CCE A;  4PAE A;  5SYY A;  5CIG A;  1W4W A;  1AED A;  4A7M A;  1CCG A;  5KQI A;  1AEH A;  4ATJ A;  1CCP A;  4NVF A;  1AET A;  2AS6 A;  3ZCH A;  1KXM A;  2XIH A;  4JMT A;  5EJX A;  3WNU A;  3WA8 A;  3M2E A;  1ITK A;  4BM1 A;  1YYD A;  1HSR A;  1Z53 A;  5JHX A;  4CZQ A;  2CCD A;  3VLM A;  5CCP A;  1HCH A;  1CMP A;  2PCB A;  3VLK A;  1KXN A;  1LYK A;  2GGN X;  3FM1 A;  1AEV A;  5SW4 A;  4A71 A;  2ICV A;  5JHY A;  2EUR A;  2VNZ X;  4USC A;  5KSK A;  1GZB A;  1QPA A;  2GHK X;  1YZP A;  4NVI B;  2RBW X;  1GX2 A;  1H5M A;  5SX1 A;  3UW8 A;  1H5H A;  4GED A;  4NVE A;  4CZR A;  1GWU A;  3M23 A;  1DSP A;  2RBZ X;  3X16 A;  1H5K A;  5SYV A;  5AOG A;  4A78 A;  5SX6 A;  4CZN A;  2W23 A;  1CPE A;  1RYC A;  4JMA A;  4XV7 A;  5SX7 A;  5SX0 B;  4NFG A;  4FCN A;  4JMZ A;  1W4Y A;  2XI6 A;  1H3J A;  6ATJ A;  1MKR A;  5EJT A;  1AEN A;  3R99 A;  1CMU A;  2EUT A;  2Y6A A;  4JPU A;  4NVC A;  1JDR A;  1S73 A;  2E39 A;  5CIH A;  1LY8 A;  2GHC X;  1STQ A;  3UT2 A;  4BLY A;  1H5C A;  5JPR A;  1OAG A;  5KQ0 A;  2CCP A;  2RC1 X;  2BCN A;  4JQM A;  1AEE A;  2YLJ A;  1APX A;  4BM2 A;  1DCC A;  1SBM A;  2RC2 X;  1AEF A;  5CD4 J;  1U2K A;  2RBT X;  1LYC A;  3M2H A;  4NVM B;  4JPL A;  5SX2 A;  3VLH A;  1FHF A;  1KOK A;  1AEQ A;  1A2G A;  6CCP A;  4JQK A;  4BLX A;  2RBV X;  3FM4 A;  1ATJ A;  1CCC A;  1U74 A;  1H5J A;  5H9E B;  2B12 A;  1YZR A;  1H5A A;  5SYL A;  1BGP A;  3ZCG A;  4CCP A;  5ABO A;  5L86 A;  3M2G A;  1BEK A;  4CCX A;  2JTI A;  1MNP A;  2X07 A;  4QYZ B;  2X08 A;  1BVA A;  4BM3 A;  4CUO A;  7CCP A;  4A5G A;  4JQJ A;  2ZCA A;  5SX0 A;  1CCJ A;  2AQD A;  2E3B A;  4XV4 A;  5SYH A;  1H5L A;  4JM6 A;  2RC0 X;  2VCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...