3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
5SYLA 2EUOA 2VNXX 4JPUA 2E3BA 4A78A 2PCBA 4BLZA 1CCJA 1CMUA 5L05A 4NVIB 1YZRA 1KOKA 4NVBA 1H5LA 1W4WA 3E2OA 2VCFX 3VLHA 1SJ2A 5SX2A 1CPFA 2RBWX 1GZAA 3RIVA 2BCNA 1ARYA 2IA8A 4BM2A 5SX3A 3M5QA 1H58A 2Y6AA 1AC4A 1ML2A 5ALAA 1A2GA 1IYNA 4NVCA 3X16A 5ABQA 4NVEA 2AQDA 3Q3UA 3FM1A 5CJHA 4JQMA 2X08A 1BEJA 2CYPA 2EUQA 2CCDA 2VO2X 1DCCA 2YCGA 1MNPA 4CZNA 1A2FA 5SX6A 1B85A 5SXRA 3M29A 5CIBA 2PCCA 3ZCYA 2E39A 4XV6A 2W23A 1H5CA 1H5AA 2EUUA 4BM3A 4JM9A 1AEQA 3CCXA 4FEFA 4XV4A 4NVAA 3EXBA 1ATJA 1DJ5A 5KQKA 1CK6A 2B11A 1SOGA 3RRWA 4A7MA 2XJ6A 3R99A 1CPEA 5SXSA 1ARPA 1DSGA 4JM8A 1W4YA 4JM5A 1ITKA 1H5KA 4JMZA 1GW2A 5SX7A 2N18A 6ATJA 1CMQA 5SYKA 2RBZX 3M2GA 5SW4A 4XV5A 5JQRA 1EBEA 3M27A 1H3JA 5KQ3A 5D6MA 3FM4A 2B0ZA 5KQIA 1BEMA 5CCPA 1AEVA 4FCSA 5CIGA 3WXOA 1FHFA 1BEPA 4JN0A 5SX1A 1U2LA 1B80A 2AS2A 4A6ZA 1OAGA 4CZOA 4A71A 2GHDX 1QPAA 5CIHA 1BJ9A 1AEEA 3ZCHA 1ZBYA 2ANZA 1ARWA 2GHHX 2E3AA 2V2EA 1H5JA 3CCPA 1SCHA 5EJXA 3M26A 1KXNA 3HDLA 4NFGA 1PA2A 4BM1A 1H55A 4NVOB 4FDQA 1MKQA 6CCPA 1ZBZA 1MN1A 4NVJB 4A5GA 4NVMB 1OAFA 3M2DA 4CZRA 2B12A 5L86A 2XJ8A 5SYJA 1ARXA 1S73A 4JM6A 5SXTA 2BOQA 5EJTA 2EURA 5SYUA 1CCIA 4CVIA 1AEFA 1CPGA 3FJWA 5JHXA 1CCAA 1LY9A 4BLXA 5FNEA 4GEDA 2EUPA 1HSRA 2JTIA 4NVHB 2CL4X 5SYXA 3VLKA 4CZQA 4XV7A 1AA4A 4BLNA 1CCEA 2EUSA 1DSEA 3M2CA 5KQ0A 1H5FA 4JQNA 5KQ6A 5KQHA 1HCHA 4JQJA 1LLPA 2ICVA 4OQ7A 2EUTA 2XILA 4P4QA 4JMSA 2GGNX 4ATJA 4XVAA 1AEBA 5ABNA 1QO4A 1U75A 1CCPA 1KXMA 1SBMA 4NVKB 5AL9A 1LYKA 1GX2A 2RBYX 4JB4A 1CYFA 5SW6A 1H5MA 1SDQA 5SX0B 4C50A 5KSFA 4CCXA 5ABOA 4JMAA 1QGJA 1DJ1A 1AEHA 1APXA 1BEKA 1AC8A 4NVNB 2Y6BA 1AEDA 5SXWA 1AEOA 2X07A 2RBVX 5SYYA 4USCA 3M2AA 1KZMA 1STQA 2V23A 5L02A 2CCPA 4CUOA 2AS3A 1H5EA 1GWUA 1H5IA 2RC1X 3M8MA 2GB8A 3M23A 1LY8A 1V0HX 5CIFA 2XJ5A 2VCNA 5CIDA 4JMVA 1GWTA 1S6VA 4NVGB 5SXXA 1YZPA 3M2HA 1LGAA 1H5HA 2VCSA 1CCLA 1AENA 2GHKX 2YLJA 4JMTA 4CZPA 2AS1A 1MK8A 4JPLA 1AEUA 1CCCA 4NVLA 1MN2A 4FCNA 1KRJA 5SYWA 1H57A 2RC0X 1H5DA 3R98A 4BM0A 4BLKA 1U2JA 1U74A 5SXQA 4BM4A 1AEJA 2XI6A 3M2BA 1BGPA 2AS6A 3M2EA 1DSOA 1AETA 4G05A 5AOGA 2RBUX 4NVDA 5SW5A 1CPDA 3UT2A 2WD4A 1BEQA 2RBXX 1BESA 5CIEA 1ARUA 4BLLA 1BVAA 4CVJA 3FM6A 2RBTX 3M28A 5CICA 2VKAA 5JPRA 2GHEX 3M2FA 4JQKA 3FKGA 1GZBA 3E2NA 1YYDA 4BLYA 1AESA 4XV8A 5SX0A 1C8IA 1AEGA 3FMUA 1LYCA 3VLJA 3ZCGA 1CCBA 7CCPA 2CEPA 2AS4A 1AEKA 5KQ2A 3UW8A 5KSKA 3WNUA 1CMTA 2XIHA 4JMWA 1JDRA 1CCGA 1DSPA 1H5GA 2GHCX 4JMBA 3VLIA 3M25A 1AEMA 1MKRA 5JHZA 1JCIA 2CCAA 4CCPA 5FNBA 3ATJA 5SYHA 2RC2X 1Z53A 3M2IA 7ATJA 4NVFA 2B10A 4JPTA 1ARVA 1RYCA 4C51A 1B82A 2Y5AA 4PAEA 5AMMA 1CCKA 1DS4A 3VLMA 5SYVA 2XIFA 3VLLA 5JHYA 1UB2A 1CMPA 1GWOA 5SYIA 3RIWA 2VNZX 2ATJA 1YYGA 2EUNA 1U2KA
chains in the Genus database with same CATH superfamily
4NUUA 2E2AA 2LRLA 1HG2A 4TN7B 2IDOB 5L05A 3JADA 4UELA 3SS1A 4NVBA 4A98A 5JDFA 4G2AA 2IHR1 2YDSA 3E2OA 3EI0A 3UQ4A 3AE9A 3MACA 1SE7A 1GZAA 1ARYA 1MIYA 2VL0A 4A5XA 2ZMAA 3KINB 4GKJT 5LGNB 3I1AA 3RPUA 3UU4A 1H58A 1AC4A 3AE8A 1LVKA 5FYMA 3PUGA 3O1HA 1IYNA 2HPJA 2WSSS 2NP9A 5ABQA 1MMDA 4UVAB 4NPPA 4U74A 3Q3UA 2W62A 3D0TA 1CHUA 5EK3A 1KF6A 3IBPA 4P09A 3OTOT 3ONXA 2J47A 4I43B 5C8YE 4AKRB 3C4XA 4JBWF 2CYPA 4KI0F 2CCDA 1DCCA 2YCGA 4ZOLE 1A2FA 4LF9T 3Q5XA 4ANJA 3M29A 2HH7A 1FEWA 5KXJA 3HL6A 3ZCYA 3IEEA 2E39A 3VKHA 1IJ5A 3QUJA 2CEAA 1H5AA 2EUUA 4BM3A 1SHZC 2UXXB 3AE2A 1AEQA 3CCXA 2BS4A 4TV8E 1MMGA 4NVAA 3UT5E 3NWIA 4UF0A 3C50A 1DJ5A 4ZXLA 5FL0A 3ABVA 4HWHA 3RGLA 2M6BA 1KFYA 5C3JA 5FVLA 3UU5A 4GIWA 1CPEA 1W9RA 1DSGA 3SRZA 3AA6B 2I0MA 5L47A 3UTKA 2BZBA 2XQ9A 2CE7A 5AQVB 4AQYT 1CMQA 1KEYA 3PDYA 3M2GA 4QWNB 2VASA 2NOXA 1W09A 4XV5A 1EBEA 3M27A 1T98A 4KX6A 3FM4A 4Z91A 2B0ZA 2JQHA 2IAKA 1D1AA 3ONLC 5FXXA 1BEPA 3AXJB 4QXCB 3AXJA 4A6ZA 5L3EB 1OAGA 2MOZA 3RF1A 5CFBA 1WFDA 4KHZF 3FZMB 3AE3A 4TWHA 2E3AA 2V2EA 3ZKRA 2XAJB 4O4LE 3BQKA 3M26A 2BS2A 2E5VA 3N2OA 5FP3A 2BG9B 5FXZA 4IREA 2YINA 4U3CA 5JDQA 2WU5A 3CIRA 4YSXA 1Y01A 2LOSA 3A7MA 4IGUA 3RYHE 3PUZF 2FJAA 1YD8G 5L86A 4JYAT 2FUPA 2XJ8A 3Q2MA 1WR6A 3U3IA 2KSRA 4QYZB 1ZV4X 4IL9A 3AAIA 5J1GA 5L3BB 4H9NC 2BOQA 5EJTA 5SYUA 3IHRA 5H6RB 3E08A 4L0RA 1AEFA 4DBQA 1NEKA 4NIQA 4BLXA 4CI2B 1HX8A 5F5WA 1Y64B 4U2YA 2PFVA 2C5JA 2JTIA 3WA8A 2XQAA 3F2EA 5F8PA 2W00A 4FI5A 3K3OA 2VQET 4EOZB 3AEGA 2ACXA 4JQNA 2DI4A 4HGAA 3VR8A 1HCHA 4JQJA 4XZCA 5JR9B 2EUTA 2WY2A 3ZJ2A 4PJLA 1O3XA 4L5GA 4AXPA 4IDQA 2W66A 5ABNA 1QO4A 2NR4A 3LDQB 2XAFB 3LFMA 1YW0A 2RBYX 4JB4A 5SW6A 4U72A 3K1SA 4MLKA 4O4IE 3A5XA 5KSFA 2OEBA 1UURA 3ZYLA 4YY3T 3KBTA 1AEHA 3LK2B 3HKEE 4PAGA 1IBKT 4QH4A 4NVNB 5HEJA 2XQ5A 2X07A 5SYYA 4IE4A 2XM1A 3PU8A 3H3MA 3Q5WA 5L02A 2CCPA 2AS3A 1H5EA 1GWUA 2XASB 3TLVA 3M8MA 4UR9A 4HWFA 1LY8A 4ILCA 5L3CB 4ERRA 3O4XE 4DV1T 5L2LA 5FMNA 1S6VA 5JRCB 3PUWF 3DTOA 2LJLA 1D0XA 5LB7B 4AIUA 1UK5A 3N2KE 1MN2A 1LVFA 4FCNA 2LHNA 1KRJA 5SYWA 2RPAA 1D0ZA 3ZMZB 3RYCE 5AQPB 1YQ4A 2XPKA 5AQFB 3RIAA 4NXNT 4ASKA 5LHGB 3RYIE 4DV0T 1FMVA 2N9DA 4DV7T 3CKDA 4IE5A 1DSOA 5DABA 4HFCA 4HWDA 4Z8XA 1AETA 2CLYB 5JRCA 1HNXT 4DR7T 2X68A 5HAXA 1CPDA 2WD4A 4ZS3A 2RBXX 1E2AA 5CIEA 2CM0A 4X20E 1B7TA 3FZLB 4ZI7E 4CI1B 5EZYE 3M28A 3P7IA 5AQSB 5JPRA 3M2FA 3PJAJ 2OA5A 2JMKA 5JDLA 4IDNA 2L3LA 5IUXA 2C5IT 4JI7T 3EDUA 4OYKA 1FJGT 2EHOD 3MKDA 4CQIA 3N9LA 4MHCA 2CA5A 1AEGA 4E7SA 3VLJA 1CCBA 4DIDB 2CEPA 5HWXA 2AS4A 1AEKA 4AKGA 2EHOA 5KSKA 2I59A 1XDPA 3WNUA 4LF4T 2XIHA 1CCGA 1DSPA 2GHCX 4ILAA 4MBQA 4WNKA 3CX8B 2DHRA 5FNBA 5LOVE 2RC2X 4X1IE 4UVCB 1Z53A 3RRCA 2V7MA 3UU3A 2XQ6A 4DMVA 1XMOT 5ABFA 1B82A 3ZCJA 3IA3A 4JI0T 2FJEA 5LG3A 3JAEA 4DVDA 5SYVA 3T1HT 1UX5A 2BVLA 4LMJA 5LMUT 5HXRA 3ZEFB 3RIFA 3Q9DA 3ZN1B 3FBLA 3E0ZA 3C51A 5FXWA 2WWVA 4TV9E 3VHLA 1KOKA 1H5LA 4H9SE 4DV2T 1W0BA 3K8PC 4ZI2D 2VCFX 5SX2A 2WM9A 1IJ6A 3QNUA 3ZYKA 2WDQA 1YKHB 3RHWA 4BM2A 4B6XA 5SX3A 2BDEA 3M5QA 3NRYA 1ML2A 2KLQA 5ALAA 1A2GA 3HI2A 4NVCA 3X16A 2BG9C 2B1EA 2J1DG 1US7B 4HEAA 4CI3B 3V5UA 5CJHA 2XSBA 4JQMA 2MTQA 4WBNE 2X08A 3OYXA 1ZKEA 3RLFF 1AJ3A 2XM2A 2BBHA 3MA9A 2VO2X 5AQGB 2H7VC 4I55E 1MNPA 4CZNA 3P4WA 5SXRA 4PNIA 1KNRA 4IL4A 5AQRB 4XV6A 1HNZT 3HR0A 3VU7H 3RX6A 4ISSA 2NW9A 3B5MA 4JM9A 4OX9T 1QSDA 1CK6A 2B11A 3KVAA 3UQ7A 4A7MA 2XJ6A 3R99A 5SXSA 1ARPA 2QVAA 1WRDA 4X1KE 1W4YA 2WDRA 2V6XA 4JM5A 2IC9A 1H5KA 4TZ4C 3AAAB 4YTNA 4JMZA 2W63A 2ZM6T 3TLSA 2JJ9A 2JRKA 3B57A 2N18A 6ATJA 2CBIA 4GYSA 4I4TE 3L09A 3SFDA 2RBZX 3T8OA 2LT3A 1MIWA 4LMLA 5KQ3A 5D6MA 5KQIA 2LSYA 1VOMA 3DJBA 4FCSA 4JI6T 5KMGP 4GK5E 2E9XC 5ETWA 2HPLA 2XTLA 4AKHA 4B3TT 3CX6B 2AS2A 3N5LA 3GWHA 3ZSTA 3QC9A 2GHDX 2PJQA 5CIHA 1BJ9A 5JDHA 3ZCHA 4CXYA 4EEDA 1LRZA 2ANZA 1ARWA 3CQXC 3AAEB 2D5UA 5CA1E 2RP4A 2BKPA 1SA0E 1KNZA 3HA4A 1SCHA 5CJ5A 4YSZA 2BKOA 4DV3T 1BR1A 4Z90A 3A8YC 1PA2A 4AQGA 4BM1A 4K0KT 2VKDA 4NVOB 2E9XD 3FHNA 2LSIA 3CWZB 6CCPA 1MN1A 2V6YB 1HF8A 4PJMA 4A5GA 4L9IA 2BS3A 2UUBT 1Z0PA 2PG8A 1OAFA 2XQYA 3M2DA 5FL1A 4AI6A 2M67A 2VL8A 3ETVA 5C2TA 5HEUA 2NW7A 4DR2T 1ARXA 4GYRA 1T72A 5SXTA 5LBQB 3FZKB 1CCAA 4GEDA 4DV4T 4KHPT 3N9MA 1DU2A 1J5WA 2CL4X 1E7PA 1V9DA 2VKJA 4CZQA 2UXCT 5H9EB 4B3ST 1VRBA 4WZXA 3M2CA 5KQ0A 1H5FA 5KQ6A 1LLPA 4OQ7A 4PJNA 4YSYA 4QH5A 3CPZA 2W4XA 4P4QA 4JMSA 4YT0A 2WMOA 4ATJA 2DNXA 3ZSSA 2DLRA 1AEBA 2RA1A 3MK7C 3VR9A 1U75A 1WYCA 4YJ2E 3CK6A 1CCPA 4NVKB 1XDOA 2XQ3A 4H63H 5GONE 1CYFA 1U5PA 2UXNB 3BQLA 4JMAA 2V7LA 5EK4A 2MYSA 4O4JE 1APXA 2CXLA 3UFEA 4C91A 1QLBA 4GOUA 5SXWA 1AEOA 3M2AA 1KZMA 3KV6A 4UXNB 3P4PA 3LSVA 4CUOA 2RC1X 4WW0A 3RI5A 2GB8A 5CIFA 2XJ5A 2YU1A 2VCNA 2D0TA 2DWKA 3KV5A 2CWOA 3QOFA 3M2HA 1H5HA 3L39A 4UIGA 3PV0F 5CB4E 2YLJA 3PTRB 4JPLA 4HWCA 1WLXA 3Q5DA 4X5TA 1OEDE 4EV6A 3C4ZA 5AQJB 2X0YA 4XBFB 3ZN0B 3AE1A 3Q5EA 5J2UE 3SOLA 1H5DA 3R98A 2W2UA 2A2FX 4BM0A 2V5DA 1IBMT 2X0LB 3ZMSB 2YN6A 2W67A 3PUQA 1U2JA 1I94T 4A97A 2D0UA 1U74A 3VKGA 3EVYA 4QXBB 2VVNA 2X9HA 5FVKA 2KWIB 2EHOB 2XJ7A 4H79A 2CPTA 3GMIA 2XAQB 4H63V 2WBLA 4K0UA 5E0OA 2YDQA 2H88A 3ESLA 4N78D 3WAKA 3AECA 1BESA 3ZLIA 5AQQB 2A7UB 1ARUA 1NENA 3I9YA 4EAHA 3MJXA 2CWYA 2VB6A 5CICA 3ZT7A 3VRAA 3AEFA 5JDNA 1GZBA 4BLYA 1G8XA 4DUZT 2LKGA 3FBZA 4ZZCA 3ONJA 5SX0A 3L3PA 1C8IA 4Q25A 3ZT5A 5JR9C 2V26A 2BKNA 1D1CA 4KBMB 3C64A 7CCPA 2UUCT 2V7KA 3WI3A 5LGTB 3AA1B 4IE0A 4JEUB 1FIOA 4X1YE 4LMKA 1M62A 2B76A 1JDRA 1H5GA 4JMBA 4ZI3D 5HXSA 4P0BA 3M25A 1AEMA 3NRXA 2XSAA 4CXXA 2KT9A 3NZPA 4CCPA 3UULA 5F3JA 7ATJA 1VCTA 1XWMA 2CRBA 2Q9QB 2YEVC 4P0AA 1RYCA 3LJCA 2Y5AA 4PAEA 5AQTB 5AMMA 2X0HA 2WZHA 4JZAA 2R6GF 3VLMA 1IBLT 2XIFA 3ZC1A 2FJDA 4CN6A 4HFDA 3KBUA 1UB2A 4AISA 1CMPA 3FXDB 2VNZX 3PU3A 4HWIB 5LJNA 2EUNA 5HEHA 2XQ8A 2JMXA 3CX7B 3JAFA 3PJAA 2VNXX 1HX1B 4BLZA 2PCBA 1CCJA 1CMUA 4NVIB 1YZRA 4JI1T 1W4WA 4ZI2C 1OEDA 4MFRA 3AVSA 2K24A 3E22E 4TWFA 3RIVA 2LHRA 2Q9QA 1JNZA 3H3AA 1HNWT 5IWAT 5LHHB 2Y6AA 4M1PA 3AEAA 4IE7A 2K3WA 1J5ET 4HFIA 4NVEA 5LBMA 2E9XA 3WAJA 3ZC0A 4IIJE 3FM1A 2WP9A 3SFEA 4OFZA 1BEJA 2EUQA 2P9BA 3G06A 4QX7B 2K48A 1B85A 3ANWA 3I9WA 1MNEA 1T7SA 5CIBA 5LNKA 3RKOA 2W23A 3UUXB 3H37A 1H5CA 4JEHB 1N32T 2LKHA 4PK5A 5LYJE 4FEFA 3EXBA 2EHOC 1ATJA 2Z6EA 2LSJA 3KFWX 3RRWA 2MAWA 4UEMA 2A9UA 3RQUA 1IZNB 1YKEB 4OK0A 2UU9T 3AE5A 3RYFE 1ITKA 3C98B 4DV6T 3NKZA 4ILUA 4TUYE 5HXCA 1GW2A 5SX7A 1ZEEA 4YXDA 3KVBA 3MXZA 1H7CA 5SYKA 5JDGA 5LXTE 3L8RA 2E8IA 3M3ZB 1H3JA 2UXDT 2LEHA 1BEMA 5CCPA 1AEVA 2ZOPA 3PUAA 2NW8A 4EIWA 4JN0A 1U2LA 2CXDA 2X9WA 4TX5A 3UUNA 2ZM2A 3J7Yq 2HN2A 2XAHB 1BR2A 1ZBYA 1JNRA 2E9XB 2HN1A 3CVRA 5L4EA 2WAUA 5BMVE 4BA9A 4OHFA 1U4QA 1HFAA 3OKQA 4JV5T 2N1GA 2BG9E 1ABVA 2LLYA 4EYUA 1KXNA 3HDLA 4NFGA 1XNRT 2UXBT 1UCUA 3N9QA 3SWHA 4X66T 1ZBZA 2Q9QD 2V6YA 2BVMA 4O4HE 3X1DA 4NVJB 4NVMB 1OEDB 4OYJA 2Y48B 5AQLB 1HTJF 3FB2A 5KDMC 4DR6T 4CZRA 4PW8A 2B12A 3O1IA 5SYJA 2NTXA 3AEBA 1S73A 4JM6A 3RIUC 4H9QC 1BR4A 2NTYA 4AQFC 4CVIA 3FJWA 5JHXA 2AE9A 1LY9A 2KNDA 5DQWA 3AEDA 3CQGB 5DJQC 3EUHA 5LHIB 1HSRA 4BJMA 5LP6E 5FY7A 3EABA 1KNPA 2DCFA 3OYZA 5SYXA 4YLHA 1AA4A 5FNVE 2KXPB 4CN1A 1CCEA 2EUSA 1DSEA 1SUMB 1MIVA 3ZJ1A 3ZMTB 2IIUA 2CMRA 4U31A 5TAOA 2ICVA 3UU8A 4TNVA 4DR4T 2V8SV 2J62A 1D0YA 4O2BE 4XVAA 2WB5A 3X1LF 3P4QA 4AQFA 5CA0E 1S94A 5LGUB 4PFOA 1KXMA 4CXWA 5AL9A 1XZYA 3TKLB 1HG5A 3NVOA 2BBJA 3F31A 1SDQA 2E5LT 5ABOA 1QGJA 3QB5A 2WDVA 2XY8B 1UX4A 4F6RC 4QHOA 1BEKA 1UUSA 1AEDA 1MMAA 3B13A 5ABHA 4JI5T 2V23A 3HKDE 3UUMA 4AKIA 2FBWA 4ZEYA 3V5SA 4IE6A 2VWAA 4HN9A 1IAPA 5AQNB 5ABFB 3AE6A 4LF8T 5CIDA 4G63A 4JMVA 1GWTA 3ZYMA 4NVGB 2OLTA 3K3NA 1LKXA 3PUSA 5LJMA 4EYYR 2GHKX 2OV9A 4U33A 2AS1A 1CCCA 3AE4A 4NVLA 2MPKA 3LK42 4UVBB 3IF8B 2V7JA 4HFEA 4YTPA 4MALA 3EHZA 3GN5A 4HKAA 4BLKA 5L3FB 3NBXX 5FY0A 1XMQT 2N2NA 5J0ZA 2CBJA 2IMLA 4XAXB 4BM4A 1AEJA 3KDSE 2PBIA 3M2BA 4ZI3C 1BGPA 2AS6A 3M2EA 2D9DA 4WBOA 3EDVA 3AA0B 2RBUX 4NVDA 3UT2A 2WCAA 3LBXB 4U7UB 3RIUA 4A56A 1J1JA 3N9PA 3N9OA 4PJJA 4BLLA 2YU2A 2I6HA 5A1LA 3FM6A 2RBTX 5JTGA 3ZMUB 1M7KA 3RC3A 4CZZB 2VKAA 5HEOA 2GHEX 3FKGA 2JQQA 4GKKT 4HFHA 3E2NA 1YYDA 2PTFA 4X65T 1WR0A 5HWYA 3ANWB 1OEDC 3TLWA 2LRKA 3RKGA 4UV9B 2LSGA 4IDPA 4NUVA 3FMUA 1LYCA 3ZCGA 5BR8T 2KINB 2ZCAA 1L0VA 3PURA 3LBXA 3O9XA 1MNDA 2DWGA 3VLIA 5AQUB 5JHZA 3P50A 2QGSA 5SYHA 2XQ7A 4QKNA 2K9AA 4JPTA 1ARVA 4C51A 2YDRA 3TLTA 2IUBA 1HR0T 1CCKA 2C0SA 4YHJA 2VKHA 3P4SA 4EEBA 3ZT6A 2HHHT 3VLLA 5JHYA 4O2AE 1N33T 3OVUA 1ZHCA 5SYIA 1D1BA 3RIWA 2ODUA 5L4HA 3JC6C 2ATJA 5EK2A 4O8SA 4UF0B 5SYLA 2EUOA 4JUYA 4JPUA 2E3BA 4A78A 3QB5K 2W0GA 2LSKA 4IHJE 3VLHA 1SJ2A 5FXVA 4ADZA 5HXHA 1CPFA 2RBWX 3BQIA 3UFGA 5HCJA 4IDZA 1MMNA 2BCNA 3J9X1 2IA8A 2F4VT 3U78A 2Y6XA 3OBVE 3ETUA 5LA6E 4KMCA 4V1Av 4PK4A 5HXEA 2KMFA 2AQDA 2H89A 3W15B 2WQYA 1CUNA 2JMHA 4ZZBA 2WWUA 2D2SA 3TLUA 3VRBA 5SX6A 2XUEA 1YXRA 5AQMB 2PCCA 1X79A 3OJAA 2YKSA 4TWDA 5FY1A 5KX5E 2JQ9A 4QXHB 2V5CA 4XV4A 2JIWA 3PE0A 2X66A 4ISTA 5L3DB 2L8KA 2X9XA 4QX8B 5KQKA 1SOGA 3LG7A 2V1DB 3C4WA 3P8CD 5IYZE 4LF7T 3ZCIA 4BAYB 3AE7A 5AQHB 3KV9A 1R8IA 1E1HB 4JM8A 1T8BA 4DUYT 2QRXA 1HS7A 5H9FB 2BO5A 1NWMX 3FZFB 4PK6A 2L9QA 4F8HA 1EZ3A 5SW4A 3GA8A 4JLEA 5JQRA 1OXZA 5HEGA 1ZOYA 1GQEA 2CXFA 2YK0A 1BR0A 5FKYA 4NXMT 2ES0A 5CIGA 3WXOA 4H9RC 1FHFA 5SX1A 4H7AA 1B80A 4CZOA 4A71A 4H9OC 1QPAA 3EAMA 2CHNA 1AEEA 1KK7A 3GN5B 3T1YT 3LK3B 4JI8T 2GHHX 3K3QC 2M6IA 4U7IA 1H5JA 3CCPA 5AQIB 5EJXA 1XNQT 1Z8UA 4COFA 2XAGB 2CCQA 2BG9A 2KZ7B 5L3GB 2H3RA 4YHHT 4DR5T 1H55A 1WCRA 3F57A 4FDQA 2IC6A 3PUXF 3ZPOA 2GK9A 4CN4A 1MKQA 4P1NA 5ADXL 1YQ3A 2WSSV 1S35A 5ABEA 4DR1T 4DNDA 5ABGA 4DMWA 4WYVA 3HKCE 4DO0A 2WS3A 2XHEB 1G73A 5AQOB 2X67A 1N34T 1NAFA 2EURA 3CQCB 2Y8DA 5JR9A 1CCIA 1CPGA 2FJBA 3I0OA 4C90A 1QUUA 5FNEA 2EUPA 2ZM0A 5LG4A 4JI3T 5J2TE 3UUBA 3DP7A 4NVHB 4HTEA 2ZM8A 3VLKA 4YJ3E 4XV7A 4BLNA 3P4RA 2J4GA 2ZLYA 5KQHA 5H6QB 5DQVA 1HCIA 2XZEA 4JI2T 3AB3B 2XILA 2GGNX 2NWBA 5JVDE 4PFPA 1SBMA 1LYKA 1GX2A 2LM9A 4KP3C 2C5KT 1WYBA 2W61A 2XQ4A 4LFAT 5JDMA 1H5MA 2X51A 5SX0B 4C50A 4X64T 4CCXA 1W0AA 3RQWA 4KUMB 3UU6A 1DJ1A 4EGWA 2WMNA 2G0UA 1AC8A 2Y6BA 2AXDS 2RBVX 4USCA 4ZS2A 4H9PC 1STQA 3R84B 1FMWA 1ZP0A 2CHOA 1H5IA 2KWHA 2WU2A 3M23A 1V0HX 5IHYA 2LE8A 1N36T 5JH7E 5SXXA 2SPCA 5AFUL 1YZPA 1OWAA 4JI4T 4LF6T 1LGAA 2VCSA 1CCLA 1AENA 4TNWA 4CZPA 4JMTA 4E7ZA 3JC6D 3M65A 4UV8B 1MK8A 1AEUA 4HFVA 3AA7B 4J2CA 1VCSA 2X9YA 1H57A 2RC0X 3KV4A 5CGMA 2LOPA 4ILBA 5AQKB 2CLYC 3OPCA 2JQKA 5HCMA 5SXQA 2MBGA 5HYAA 2XI6A 4EZ4A 2VURA 2IW5B 2LM2A 4EB6E 4G05A 5AOGA 3RH3A 3PUYF 5SW5A 2A3DA 4BJNA 4EXTA 1BEQA 1X9BA 2YOEA 3FZHB 3R6NA 4YTMA 5JREA 5LMNT 1BVAA 4CVJA 3AEEA 3JCFA 1I6ZA 4U2ZA 4LFBT 3AVRA 4YFSA 4JQKA 3CMLA 4IDOA 2V7IA 2WZIA 3FXEB 1AESA 2JPFA 2VKOA 3PUVF 4XV8A 4ZHQE 4FJOA 2DL1A 4GK0E 3QK6A 3I0QA 4I0UA 4QH1A 4I50E 5KQ2A 3S4UA 3UW8A 1UGOA 2UUAT 3HKBE 2Q9QC 3O1JA 4DR3T 1CMTA 4JMWA 3N9NA 4HE8A 5LCYA 4B3RT 1MKRA 1JCIA 4EZHA 2CCAA 5JQGE 3ATJA 3BK9A 2QYWA 2ACZA 3M2IA 2H7OA 4NVFA 2B10A 2VVSA 4DV5T 4GKFA 2K5BB 3RC8A 3MZKB 4IT4A 4HFBA 4LF5T 3N2GE 1DS4A 5CD4J 5M4YA 3ZMVB 4LFCT 4DBRA 4AKLA 2QA7A 3NZQA 2ODVA 4X62T 2VK9A 1GWOA 4B3MT 2VQFT 1YYGA 2A72A 4U7YA 1U2KA
chains in the Genus database with same CATH topology
4UF0B 4NUUA 5SYLA 3E0ZA 2EUOA 3CX7B 1HG2A 3C51A 5FXWA 4JUYA 2VNXX 4JPUA 2E3BA 4A78A 2PCBA 4BLZA 1CCJA 1CMUA 4TN7B 4TV9E 5L05A 3VHLA 4NVIB 4UELA 1YZRA 1KOKA 4NVBA 3SS1A 1H5LA 4G2AA 4H9SE 5JDFA 1W4WA 4ZI2C 2W0GA 2LSKA 3K8PC 4ZI2D 3E2OA 4MFRA 3AVSA 4IHJE 2VCFX 2K24A 3E22E 3VLHA 1SJ2A 5SX2A 5FXVA 4ADZA 3MACA 5HXHA 1CPFA 2RBWX 2WM9A 1GZAA 1IJ6A 3BQIA 3RIVA 4IDZA 1MMNA 2BCNA 2LHRA 2Q9QA 1ARYA 3J9X1 3ZYKA 1MIYA 1YKHB 2IA8A 3H3AA 2ZMAA 3KINB 3U78A 4BM2A 4B6XA 5SX3A 2Y6XA 3I1AA 3RPUA 5LGNB 2BDEA 3M5QA 1H58A 2Y6AA 4M1PA 1AC4A 3NRYA 5LHHB 3OBVE 1LVKA 1ML2A 2KLQA 3ETUA 5FYMA 3PUGA 5LA6E 4KMCA 4V1Av 5ALAA 3O1HA 1A2GA 1IYNA 2HPJA 2NP9A 4IE7A 3HI2A 4NVCA 3X16A 5ABQA 4PK4A 1MMDA 2B1EA 4UVAB 2J1DG 5HXEA 1US7B 4NVEA 2AQDA 2KMFA 4HEAA 5LBMA 4U74A 3Q3UA 2E9XA 2W62A 3WAJA 3ZC0A 3D0TA 4IIJE 3W15B 1CUNA 4CI3B 5EK3A 3FM1A 3IBPA 4P09A 3ONXA 3V5UA 2JMHA 5CJHA 4I43B 5C8YE 4JQMA 4AKRB 2MTQA 3C4XA 4OFZA 4WBNE 2X08A 3OYXA 1BEJA 5F3JA 2CYPA 1ZKEA 2WWUA 2D2SA 2EUQA 2P9BA 3MA9A 1AJ3A 3Q9DA 2CCDA 2VO2X 2H7VC 1DCCA 2YCGA 2K48A 4I55E 1MNPA 4CZNA 1A2FA 5SX6A 2XUEA 4QX7B 4ZOLE 1B85A 3ANWA 3I9WA 5SXRA 1MNEA 3Q5XA 4ANJA 3M29A 5CIBA 2HH7A 1FEWA 4PNIA 5LNKA 2PCCA 1X79A 3ZCYA 3HL6A 2E39A 3IEEA 4XV6A 1IJ5A 2W23A 3OJAA 3RKOA 3UUXB 3VKHA 3HR0A 3H37A 3VU7H 1H5CA 3QUJA 4JEHB 2CEAA 1H5AA 5FY1A 3RX6A 4ISSA 2EUUA 4BM3A 1SHZC 2UXXB 2NW9A 5KX5E 4JM9A 4QXHB 4PK5A 1AEQA 3CCXA 5LYJE 4FEFA 4XV4A 3PE0A 2X66A 4ISTA 4TV8E 5L3DB 1MMGA 4NVAA 3UT5E 3EXBA 2EHOC 3C50A 4UF0A 1ATJA 2L8KA 1DJ5A 2X9XA 2Z6EA 1QSDA 4QX8B 5KQKA 1CK6A 2B11A 1SOGA 2LSJA 3KVAA 2V1DB 3C4WA 3RRWA 3KFWX 3LG7A 3P8CD 4A7MA 4UEMA 5IYZE 2XJ6A 3ZCIA 4BAYB 4GIWA 3KV9A 3R99A 1E1HB 1CPEA 1IZNB 1YKEB 5SXSA 4OK0A 1ARPA 1DSGA 4JM8A 1WRDA 3SRZA 3AA6B 4X1KE 1W4YA 1HS7A 3RYFE 4JM5A 1ITKA 5H9FB 2IC9A 1H5KA 3C98B 3AAAB 4TZ4C 1NWMX 3UTKA 4JMZA 2W63A 4ILUA 4PK6A 1GW2A 4TUYE 2BZBA 2JJ9A 5HXCA 2CE7A 2L9QA 5SX7A 2JRKA 3B57A 1ZEEA 2N18A 6ATJA 1CMQA 4GYSA 4I4TE 3KVBA 3MXZA 1H7CA 5SYKA 3L09A 3PDYA 2RBZX 3M2GA 4QWNB 5JDGA 2VASA 3T8OA 2NOXA 5LXTE 1EZ3A 5SW4A 2E8IA 3GA8A 4XV5A 5JQRA 1OXZA 2LT3A 1EBEA 4JLEA 1MIWA 3M27A 1H3JA 5KQ3A 1T98A 2CXFA 2LEHA 5D6MA 3FM4A 2YK0A 2B0ZA 5KQIA 1VOMA 2LSYA 1BEMA 5CCPA 3DJBA 2ES0A 1BR0A 2IAKA 1AEVA 4FCSA 1D1AA 5KMGP 5CIGA 3WXOA 4GK5E 4H9RC 1FHFA 2E9XC 5ETWA 3PUAA 1BEPA 2NW8A 5FXXA 4EIWA 4QXCB 2HPLA 2XTLA 4JN0A 4AKHA 5SX1A 3CX6B 1U2LA 1B80A 4H7AA 2AS2A 3N5LA 4A6ZA 2CXDA 5L3EB 1OAGA 4CZOA 4A71A 3GWHA 2MOZA 2X9WA 3QC9A 4H9OC 2GHDX 2PJQA 1QPAA 5CIHA 4TX5A 2ZM2A 3UUNA 1BJ9A 5JDHA 3J7Yq 1AEEA 2XAHB 1BR2A 3ZCHA 4CXYA 1KK7A 3GN5B 1ZBYA 1LRZA 2ANZA 1ARWA 3CQXC 3LK3B 3AAEB 2E9XB 2GHHX 3CVRA 2WAUA 3K3QC 5BMVE 4BA9A 4OHFA 2D5UA 1U4QA 1HFAA 2RP4A 2E3AA 3OKQA 5CA1E 2V2EA 1H5JA 2N1GA 3CCPA 2XAJB 1SA0E 4O4LE 3BQKA 1KNZA 3HA4A 1SCHA 5EJXA 3M26A 4EYUA 3N2OA 1KXNA 3HDLA 2XAGB 5FP3A 1BR1A 4NFGA 2CCQA 2KZ7B 5L3GB 1PA2A 2H3RA 4AQGA 4BM1A 5FXZA 2YINA 2VKDA 1H55A 4NVOB 5JDQA 2E9XD 4FDQA 3F57A 3FHNA 2IC6A 2LSIA 3ZPOA 1UCUA 3CWZB 2GK9A 3N9QA 1MKQA 5ADXL 6CCPA 3SWHA 1ZBZA 2Q9QD 2WSSV 1MN1A 1S35A 2BVMA 2LOSA 4O4HE 4IGUA 1HF8A 4NVJB 4PJMA 4DNDA 4A5GA 4NVMB 4L9IA 4OYJA 3RYHE 2Y48B 1Z0PA 2PG8A 1OAFA 1HTJF 4DMWA 3FB2A 5KDMC 2XQYA 3M2DA 1YD8G 4AI6A 4CZRA 4PW8A 2B12A 5L86A 2M67A 3HKCE 2XJ8A 3Q2MA 3O1IA 2VL8A 5SYJA 2NTXA 1WR6A 3ETVA 3U3IA 4DO0A 4QYZB 1ZV4X 2NW7A 1ARXA 1G73A 2XHEB 3AAIA 5J1GA 1S73A 4JM6A 4GYRA 4O8SA 4H9QC 5L3BB 5SXTA 4H9NC 2X67A 1NAFA 2BOQA 1BR4A 5EJTA 2EURA 5SYUA 3CQCB 2NTYA 3IHRA 5H6RB 2Y8DA 3E08A 5JR9A 4AQFC 1CCIA 4CVIA 4L0RA 1AEFA 1CPGA 5LBQB 4DBQA 3FJWA 5JHXA 1CCAA 1LY9A 2KNDA 5DQWA 3I0OA 4C90A 1QUUA 4BLXA 4CI2B 3CQGB 5DJQC 3EUHA 1HX8A 5FNEA 5LHIB 4GEDA 2EUPA 2ZM0A 5LG4A 1Y64B 1HSRA 2PFVA 3N9MA 4BJMA 5J2TE 2C5JA 5LP6E 2JTIA 3DP7A 5FY7A 3WA8A 4NVHB 4HTEA 3F2EA 2CL4X 1V9DA 2DCFA 2VKJA 5SYXA 3VLKA 4CZQA 2W00A 2ZM8A 3OYZA 4XV7A 4YJ3E 4FI5A 4YLHA 1AA4A 4BLNA 5FNVE 3K3OA 2KXPB 5H9EB 4EOZB 1CCEA 2EUSA 1VRBA 1DSEA 1MIVA 5F8PA 3ZJ1A 3ZMTB 3M2CA 5KQ0A 2ACXA 1H5FA 4JQNA 5KQ6A 2DI4A 5KQHA 2ZLYA 4HGAA 5H6QB 2CMRA 1HCHA 4JQJA 1LLPA 4XZCA 5DQVA 5TAOA 5JR9B 2ICVA 4OQ7A 4PJNA 1HCIA 5GONE 2EUTA 3CPZA 3AB3B 2XILA 4P4QA 4PJLA 4JMSA 3ZJ2A 1O3XA 2WMOA 2GGNX 1D0YA 4ATJA 4L5GA 4O2BE 4XVAA 2DNXA 2NWBA 4AQFA 5JVDE 4AXPA 2DLRA 5CA0E 1AEBA 2RA1A 3MK7C 5ABNA 1S94A 1QO4A 1U75A 1WYCA 4PFOA 4PFPA 4YJ2E 1CCPA 1KXMA 1SBMA 5LGUB 4NVKB 4CXWA 5AL9A 2XAFB 1LYKA 1GX2A 2LM9A 3LFMA 4H63H 1HG5A 1YW0A 2RBYX 4JB4A 1CYFA 5SW6A 1WYBA 2C5KT 2W61A 4KP3C 4U72A 4MLKA 5JDMA 4O4IE 1H5MA 1U5PA 2X51A 1SDQA 5SX0B 3F31A 4C50A 2UXNB 5KSFA 3A5XA 4CCXA 5ABOA 3BQLA 4JMAA 4KUMB 1QGJA 2V7LA 5EK4A 3ZYLA 1DJ1A 2MYSA 3KBTA 4O4JE 1AEHA 3LK2B 1UX4A 4F6RC 2WMNA 4QHOA 1APXA 2CXLA 3HKEE 2G0UA 4PAGA 3UFEA 4C91A 1BEKA 1AC8A 4NVNB 4GOUA 2Y6BA 1AEDA 5SXWA 1MMAA 1AEOA 2X07A 2RBVX 5SYYA 4USCA 3M2AA 4IE4A 1KZMA 3KV6A 3PU8A 4ZS2A 3B13A 4H9PC 4UXNB 1STQA 2V23A 3Q5WA 5L02A 3HKDE 3R84B 1FMWA 2CCPA 3UUMA 4AKIA 4CUOA 2AS3A 1H5EA 1GWUA 2XASB 3V5SA 1H5IA 2RC1X 3M8MA 2KWHA 2VWAA 2GB8A 4HN9A 4IE6A 4WW0A 1IAPA 3M23A 1LY8A 1V0HX 5CIFA 5L3CB 2XJ5A 2YU1A 5IHYA 2LE8A 2VCNA 5CIDA 4G63A 4ERRA 4JMVA 2D0TA 2DWKA 3O4XE 3KV5A 5JH7E 2CWOA 1GWTA 5L2LA 5FMNA 1S6VA 4NVGB 3ZYMA 5JRCB 5SXXA 3K3NA 2SPCA 5AFUL 1YZPA 1LKXA 1OWAA 2LJLA 3DTOA 3PUSA 5LJMA 3M2HA 1LGAA 1D0XA 1H5HA 2VCSA 1CCLA 1AENA 4UIGA 2GHKX 2YLJA 4JMTA 4CZPA 5CB4E 4EYYR 3JC6D 4E7ZA 3M65A 2AS1A 4UV8B 3PTRB 1MK8A 4JPLA 3N2KE 1AEUA 1CCCA 1WLXA 4HFVA 3AA7B 4NVLA 1MN2A 4J2CA 1LVFA 2X9YA 4FCNA 2LHNA 1KRJA 5SYWA 3C4ZA 4XBFB 3LK42 3ZN0B 1H57A 2RC0X 4UVBB 1D0ZA 3SOLA 5J2UE 1H5DA 3R98A 2V7JA 3IF8B 3KV4A 2A2FX 4BM0A 3ZMZB 2LOPA 3RYCE 2X0LB 3ZMSB 4MALA 3GN5A 4HKAA 4BLKA 5L3FB 3PUQA 2CLYC 1U2JA 3NBXX 5FY0A 2D0UA 2N2NA 1U74A 4ASKA 3VKGA 3EVYA 5SXQA 4XAXB 4BM4A 2MBGA 4QXBB 5LHGB 1AEJA 5HYAA 3RYIE 2XI6A 2X9HA 3KDSE 4EZ4A 2PBIA 3M2BA 4ZI3C 1FMVA 2N9DA 3CKDA 4IE5A 1BGPA 2EHOB 2AS6A 3M2EA 2KWIB 1DSOA 2IW5B 3ZN1B 4H79A 5DABA 3GMIA 4WBOA 4EB6E 4Z8XA 3EDVA 1AETA 4G05A 2XAQB 3AA0B 5AOGA 2CLYB 2WBLA 4H63V 4K0UA 3RH3A 2RBUX 5JRCA 2X68A 4NVDA 5HAXA 5E0OA 5SW5A 3ESLA 1CPDA 4N78D 3WAKA 3UT2A 3LBXB 4U7UB 2A3DA 2WD4A 4A56A 4ZS3A 3N9PA 4BJNA 1BEQA 3R6NA 4EXTA 2RBXX 1BESA 3N9OA 3ZLIA 5JREA 5CIEA 4PJJA 1ARUA 2CM0A 4BLLA 2YU2A 1BVAA 4X20E 3I9YA 4CVJA 1B7TA 5A1LA 4ZI7E 3FM6A 3MJXA 2CWYA 2RBTX 4EAHA 5EZYE 3ZMUB 4CI1B 3M28A 2VB6A 3P7IA 3RC3A 5CICA 4CZZB 2VKAA 5JPRA 2GHEX 3AVRA 4YFSA 3M2FA 4JQKA 3FKGA 5JDNA 3CMLA 2JQQA 1GZBA 3E2NA 2JMKA 2OA5A 2V7IA 5JDLA 1YYDA 4BLYA 1AESA 3FXEB 1G8XA 5HWYA 2JPFA 2VKOA 3ANWB 2L3LA 2C5IT 4XV8A 3FBZA 4ZHQE 3EDUA 4UV9B 4OYKA 4FJOA 5SX0A 2EHOD 3MKDA 3L3PA 4GK0E 4CQIA 1C8IA 3QK6A 3N9LA 5JR9C 2LSGA 2V26A 2CA5A 4MHCA 1AEGA 4NUVA 3I0QA 4E7SA 3FMUA 1D1CA 1LYCA 3VLJA 4KBMB 3ZCGA 1CCBA 3C64A 7CCPA 2CEPA 5HWXA 2AS4A 2V7KA 3WI3A 3AA1B 4I50E 1AEKA 5LGTB 4AKGA 5KQ2A 2EHOA 3S4UA 3UW8A 2KINB 5KSKA 2I59A 4IE0A 2ZCAA 4JEUB 1FIOA 2Q9QC 3HKBE 3O1JA 3WNUA 1CMTA 4X1YE 2XIHA 4JMWA 1JDRA 3PURA 1CCGA 1DSPA 1H5GA 2GHCX 3LBXA 3O9XA 4JMBA 1MNDA 3N9NA 4HE8A 4MBQA 4ZI3D 5HXSA 2DWGA 4P0BA 5LCYA 3VLIA 3M25A 1AEMA 1MKRA 5JHZA 1JCIA 4EZHA 2CCAA 3NRXA 4WNKA 4CXXA 5JQGE 2KT9A 3CX8B 4CCPA 2DHRA 5FNBA 2QGSA 3NZPA 3ATJA 5SYHA 2RC2X 4QKNA 5LOVE 4X1IE 4UVCB 3UULA 3BK9A 2K9AA 1Z53A 3M2IA 2H7OA 7ATJA 4NVFA 2Q9QB 2YEVC 2B10A 2V7MA 3RRCA 4JPTA 3TKLB 4P0AA 1ARVA 1RYCA 3LJCA 4DMVA 4C51A 1B82A 2Y5AA 2K5BB 4PAEA 3ZCJA 5AMMA 3MZKB 3RC8A 4JZAA 1CCKA 2C0SA 3N2GE 4YHJA 1DS4A 3VLMA 5CD4J 2VKHA 3ZMVB 5M4YA 4DBRA 4DVDA 5SYVA 2XIFA 3ZC1A 4AKLA 2QA7A 3NZQA 3VLLA 5JHYA 1UX5A 4O2AE 3KBUA 1UB2A 2ODVA 1CMPA 2VK9A 1ZHCA 2BVLA 3FXDB 1GWOA 5SYIA 3RIWA 1D1BA 2ODUA 2VNZX 3JC6C 3PU3A 5HXRA 2ATJA 5EK2A 3ZEFB 5LJNA 1YYGA 2A72A 2EUNA 3FBLA 1U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SYL A;  2EUO A;  2VNX X;  4JPU A;  2E3B A;  4A78 A;  2PCB A;  4BLZ A;  1CCJ A;  1CMU A;  5L05 A;  4NVI B;  1YZR A;  1KOK A;  4NVB A;  1H5L A;  1W4W A;  3E2O A;  2VCF X;  3VLH A;  1SJ2 A;  5SX2 A;  1CPF A;  2RBW X;  1GZA A;  3RIV A;  2BCN A;  1ARY A;  2IA8 A;  4BM2 A;  5SX3 A;  3M5Q A;  1H58 A;  2Y6A A;  1AC4 A;  1ML2 A;  5ALA A;  1A2G A;  1IYN A;  4NVC A;  3X16 A;  5ABQ A;  4NVE A;  2AQD A;  3Q3U A;  3FM1 A;  5CJH A;  4JQM A;  2X08 A;  1BEJ A;  2CYP A;  2EUQ A;  2CCD A;  2VO2 X;  1DCC A;  2YCG A;  1MNP A;  4CZN A;  1A2F A;  5SX6 A;  1B85 A;  5SXR A;  3M29 A;  5CIB A;  2PCC A;  3ZCY A;  2E39 A;  4XV6 A;  2W23 A;  1H5C A;  1H5A A;  2EUU A;  4BM3 A;  4JM9 A;  1AEQ A;  3CCX A;  4FEF A;  4XV4 A;  4NVA A;  3EXB A;  1ATJ A;  1DJ5 A;  5KQK A;  1CK6 A;  2B11 A;  1SOG A;  3RRW A;  4A7M A;  2XJ6 A;  3R99 A;  1CPE A;  5SXS A;  1ARP A;  1DSG A;  4JM8 A;  1W4Y A;  4JM5 A;  1ITK A;  1H5K A;  4JMZ A;  1GW2 A;  5SX7 A;  2N18 A;  6ATJ A;  1CMQ A;  5SYK A;  2RBZ X;  3M2G A;  5SW4 A;  4XV5 A;  5JQR A;  1EBE A;  3M27 A;  1H3J A;  5KQ3 A;  5D6M A;  3FM4 A;  2B0Z A;  5KQI A;  1BEM A;  5CCP A;  1AEV A;  4FCS A;  5CIG A;  3WXO A;  1FHF A;  1BEP A;  4JN0 A;  5SX1 A;  1U2L A;  1B80 A;  2AS2 A;  4A6Z A;  1OAG A;  4CZO A;  4A71 A;  2GHD X;  1QPA A;  5CIH A;  1BJ9 A;  1AEE A;  3ZCH A;  1ZBY A;  2ANZ A;  1ARW A;  2GHH X;  2E3A A;  2V2E A;  1H5J A;  3CCP A;  1SCH A;  5EJX A;  3M26 A;  1KXN A;  3HDL A;  4NFG A;  1PA2 A;  4BM1 A;  1H55 A;  4NVO B;  4FDQ A;  1MKQ A;  6CCP A;  1ZBZ A;  1MN1 A;  4NVJ B;  4A5G A;  4NVM B;  1OAF A;  3M2D A;  4CZR A;  2B12 A;  5L86 A;  2XJ8 A;  5SYJ A;  1ARX A;  1S73 A;  4JM6 A;  5SXT A;  2BOQ A;  5EJT A;  2EUR A;  5SYU A;  1CCI A;  4CVI A;  1AEF A;  1CPG A;  3FJW A;  5JHX A;  1CCA A;  1LY9 A;  4BLX A;  5FNE A;  4GED A;  2EUP A;  1HSR A;  2JTI A;  4NVH B;  2CL4 X;  5SYX A;  3VLK A;  4CZQ A;  4XV7 A;  1AA4 A;  4BLN A;  1CCE A;  2EUS A;  1DSE A;  3M2C A;  5KQ0 A;  1H5F A;  4JQN A;  5KQ6 A;  5KQH A;  1HCH A;  4JQJ A;  1LLP A;  2ICV A;  4OQ7 A;  2EUT A;  2XIL A;  4P4Q A;  4JMS A;  2GGN X;  4ATJ A;  4XVA A;  1AEB A;  5ABN A;  1QO4 A;  1U75 A;  1CCP A;  1KXM A;  1SBM A;  4NVK B;  5AL9 A;  1LYK A;  1GX2 A;  2RBY X;  4JB4 A;  1CYF A;  5SW6 A;  1H5M A;  1SDQ A;  5SX0 B;  4C50 A;  5KSF A;  4CCX A;  5ABO A;  4JMA A;  1QGJ A;  1DJ1 A;  1AEH A;  1APX A;  1BEK A;  1AC8 A;  4NVN B;  2Y6B A;  1AED A;  5SXW A;  1AEO A;  2X07 A;  2RBV X;  5SYY A;  4USC A;  3M2A A;  1KZM A;  1STQ A;  2V23 A;  5L02 A;  2CCP A;  4CUO A;  2AS3 A;  1H5E A;  1GWU A;  1H5I A;  2RC1 X;  3M8M A;  2GB8 A;  3M23 A;  1LY8 A;  1V0H X;  5CIF A;  2XJ5 A;  2VCN A;  5CID A;  4JMV A;  1GWT A;  1S6V A;  4NVG B;  5SXX A;  1YZP A;  3M2H A;  1LGA A;  1H5H A;  2VCS A;  1CCL A;  1AEN A;  2GHK X;  2YLJ A;  4JMT A;  4CZP A;  2AS1 A;  1MK8 A;  4JPL A;  1AEU A;  1CCC A;  4NVL A;  1MN2 A;  4FCN A;  1KRJ A;  5SYW A;  1H57 A;  2RC0 X;  1H5D A;  3R98 A;  4BM0 A;  4BLK A;  1U2J A;  1U74 A;  5SXQ A;  4BM4 A;  1AEJ A;  2XI6 A;  3M2B A;  1BGP A;  2AS6 A;  3M2E A;  1DSO A;  1AET A;  4G05 A;  5AOG A;  2RBU X;  4NVD A;  5SW5 A;  1CPD A;  3UT2 A;  2WD4 A;  1BEQ A;  2RBX X;  1BES A;  5CIE A;  1ARU A;  4BLL A;  1BVA A;  4CVJ A;  3FM6 A;  2RBT X;  3M28 A;  5CIC A;  2VKA A;  5JPR A;  2GHE X;  3M2F A;  4JQK A;  3FKG A;  1GZB A;  3E2N A;  1YYD A;  4BLY A;  1AES A;  4XV8 A;  5SX0 A;  1C8I A;  1AEG A;  3FMU A;  1LYC A;  3VLJ A;  3ZCG A;  1CCB A;  7CCP A;  2CEP A;  2AS4 A;  1AEK A;  5KQ2 A;  3UW8 A;  5KSK A;  3WNU A;  1CMT A;  2XIH A;  4JMW A;  1JDR A;  1CCG A;  1DSP A;  1H5G A;  2GHC X;  4JMB A;  3VLI A;  3M25 A;  1AEM A;  1MKR A;  5JHZ A;  1JCI A;  2CCA A;  4CCP A;  5FNB A;  3ATJ A;  5SYH A;  2RC2 X;  1Z53 A;  3M2I A;  7ATJ A;  4NVF A;  2B10 A;  4JPT A;  1ARV A;  1RYC A;  4C51 A;  1B82 A;  2Y5A A;  4PAE A;  5AMM A;  1CCK A;  1DS4 A;  3VLM A;  5SYV A;  2XIF A;  3VLL A;  5JHY A;  1UB2 A;  1CMP A;  1GWO A;  5SYI A;  3RIW A;  2VNZ X;  2ATJ A;  1YYG A;  2EUN A;  1U2K A; 
#chains in the Genus database with same CATH topology
 4NUU A;  2E2A A;  2LRL A;  1HG2 A;  4TN7 B;  2IDO B;  5L05 A;  3JAD A;  4UEL A;  3SS1 A;  4NVB A;  4A98 A;  5JDF A;  4G2A A;  2IHR 1;  2YDS A;  3E2O A;  3EI0 A;  3UQ4 A;  3AE9 A;  3MAC A;  1SE7 A;  1GZA A;  1ARY A;  1MIY A;  2VL0 A;  4A5X A;  2ZMA A;  3KIN B;  4GKJ T;  5LGN B;  3I1A A;  3RPU A;  3UU4 A;  1H58 A;  1AC4 A;  3AE8 A;  1LVK A;  5FYM A;  3PUG A;  3O1H A;  1IYN A;  2HPJ A;  2WSS S;  2NP9 A;  5ABQ A;  1MMD A;  4UVA B;  4NPP A;  4U74 A;  3Q3U A;  2W62 A;  3D0T A;  1CHU A;  5EK3 A;  1KF6 A;  3IBP A;  4P09 A;  3OTO T;  3ONX A;  2J47 A;  4I43 B;  5C8Y E;  4AKR B;  3C4X A;  4JBW F;  2CYP A;  4KI0 F;  2CCD A;  1DCC A;  2YCG A;  4ZOL E;  1A2F A;  4LF9 T;  3Q5X A;  4ANJ A;  3M29 A;  2HH7 A;  1FEW A;  5KXJ A;  3HL6 A;  3ZCY A;  3IEE A;  2E39 A;  3VKH A;  1IJ5 A;  3QUJ A;  2CEA A;  1H5A A;  2EUU A;  4BM3 A;  1SHZ C;  2UXX B;  3AE2 A;  1AEQ A;  3CCX A;  2BS4 A;  4TV8 E;  1MMG A;  4NVA A;  3UT5 E;  3NWI A;  4UF0 A;  3C50 A;  1DJ5 A;  4ZXL A;  5FL0 A;  3ABV A;  4HWH A;  3RGL A;  2M6B A;  1KFY A;  5C3J A;  5FVL A;  3UU5 A;  4GIW A;  1CPE A;  1W9R A;  1DSG A;  3SRZ A;  3AA6 B;  2I0M A;  5L47 A;  3UTK A;  2BZB A;  2XQ9 A;  2CE7 A;  5AQV B;  4AQY T;  1CMQ A;  1KEY A;  3PDY A;  3M2G A;  4QWN B;  2VAS A;  2NOX A;  1W09 A;  4XV5 A;  1EBE A;  3M27 A;  1T98 A;  4KX6 A;  3FM4 A;  4Z91 A;  2B0Z A;  2JQH A;  2IAK A;  1D1A A;  3ONL C;  5FXX A;  1BEP A;  3AXJ B;  4QXC B;  3AXJ A;  4A6Z A;  5L3E B;  1OAG A;  2MOZ A;  3RF1 A;  5CFB A;  1WFD A;  4KHZ F;  3FZM B;  3AE3 A;  4TWH A;  2E3A A;  2V2E A;  3ZKR A;  2XAJ B;  4O4L E;  3BQK A;  3M26 A;  2BS2 A;  2E5V A;  3N2O A;  5FP3 A;  2BG9 B;  5FXZ A;  4IRE A;  2YIN A;  4U3C A;  5JDQ A;  2WU5 A;  3CIR A;  4YSX A;  1Y01 A;  2LOS A;  3A7M A;  4IGU A;  3RYH E;  3PUZ F;  2FJA A;  1YD8 G;  5L86 A;  4JYA T;  2FUP A;  2XJ8 A;  3Q2M A;  1WR6 A;  3U3I A;  2KSR A;  4QYZ B;  1ZV4 X;  4IL9 A;  3AAI A;  5J1G A;  5L3B B;  4H9N C;  2BOQ A;  5EJT A;  5SYU A;  3IHR A;  5H6R B;  3E08 A;  4L0R A;  1AEF A;  4DBQ A;  1NEK A;  4NIQ A;  4BLX A;  4CI2 B;  1HX8 A;  5F5W A;  1Y64 B;  4U2Y A;  2PFV A;  2C5J A;  2JTI A;  3WA8 A;  2XQA A;  3F2E A;  5F8P A;  2W00 A;  4FI5 A;  3K3O A;  2VQE T;  4EOZ B;  3AEG A;  2ACX A;  4JQN A;  2DI4 A;  4HGA A;  3VR8 A;  1HCH A;  4JQJ A;  4XZC A;  5JR9 B;  2EUT A;  2WY2 A;  3ZJ2 A;  4PJL A;  1O3X A;  4L5G A;  4AXP A;  4IDQ A;  2W66 A;  5ABN A;  1QO4 A;  2NR4 A;  3LDQ B;  2XAF B;  3LFM A;  1YW0 A;  2RBY X;  4JB4 A;  5SW6 A;  4U72 A;  3K1S A;  4MLK A;  4O4I E;  3A5X A;  5KSF A;  2OEB A;  1UUR A;  3ZYL A;  4YY3 T;  3KBT A;  1AEH A;  3LK2 B;  3HKE E;  4PAG A;  1IBK T;  4QH4 A;  4NVN B;  5HEJ A;  2XQ5 A;  2X07 A;  5SYY A;  4IE4 A;  2XM1 A;  3PU8 A;  3H3M A;  3Q5W A;  5L02 A;  2CCP A;  2AS3 A;  1H5E A;  1GWU A;  2XAS B;  3TLV A;  3M8M A;  4UR9 A;  4HWF A;  1LY8 A;  4ILC A;  5L3C B;  4ERR A;  3O4X E;  4DV1 T;  5L2L A;  5FMN A;  1S6V A;  5JRC B;  3PUW F;  3DTO A;  2LJL A;  1D0X A;  5LB7 B;  4AIU A;  1UK5 A;  3N2K E;  1MN2 A;  1LVF A;  4FCN A;  2LHN A;  1KRJ A;  5SYW A;  2RPA A;  1D0Z A;  3ZMZ B;  3RYC E;  5AQP B;  1YQ4 A;  2XPK A;  5AQF B;  3RIA A;  4NXN T;  4ASK A;  5LHG B;  3RYI E;  4DV0 T;  1FMV A;  2N9D A;  4DV7 T;  3CKD A;  4IE5 A;  1DSO A;  5DAB A;  4HFC A;  4HWD A;  4Z8X A;  1AET A;  2CLY B;  5JRC A;  1HNX T;  4DR7 T;  2X68 A;  5HAX A;  1CPD A;  2WD4 A;  4ZS3 A;  2RBX X;  1E2A A;  5CIE A;  2CM0 A;  4X20 E;  1B7T A;  3FZL B;  4ZI7 E;  4CI1 B;  5EZY E;  3M28 A;  3P7I A;  5AQS B;  5JPR A;  3M2F A;  3PJA J;  2OA5 A;  2JMK A;  5JDL A;  4IDN A;  2L3L A;  5IUX A;  2C5I T;  4JI7 T;  3EDU A;  4OYK A;  1FJG T;  2EHO D;  3MKD A;  4CQI A;  3N9L A;  4MHC A;  2CA5 A;  1AEG A;  4E7S A;  3VLJ A;  1CCB A;  4DID B;  2CEP A;  5HWX A;  2AS4 A;  1AEK A;  4AKG A;  2EHO A;  5KSK A;  2I59 A;  1XDP A;  3WNU A;  4LF4 T;  2XIH A;  1CCG A;  1DSP A;  2GHC X;  4ILA A;  4MBQ A;  4WNK A;  3CX8 B;  2DHR A;  5FNB A;  5LOV E;  2RC2 X;  4X1I E;  4UVC B;  1Z53 A;  3RRC A;  2V7M A;  3UU3 A;  2XQ6 A;  4DMV A;  1XMO T;  5ABF A;  1B82 A;  3ZCJ A;  3IA3 A;  4JI0 T;  2FJE A;  5LG3 A;  3JAE A;  4DVD A;  5SYV A;  3T1H T;  1UX5 A;  2BVL A;  4LMJ A;  5LMU T;  5HXR A;  3ZEF B;  3RIF A;  3Q9D A;  3ZN1 B;  3FBL A;  3E0Z A;  3C51 A;  5FXW A;  2WWV A;  4TV9 E;  3VHL A;  1KOK A;  1H5L A;  4H9S E;  4DV2 T;  1W0B A;  3K8P C;  4ZI2 D;  2VCF X;  5SX2 A;  2WM9 A;  1IJ6 A;  3QNU A;  3ZYK A;  2WDQ A;  1YKH B;  3RHW A;  4BM2 A;  4B6X A;  5SX3 A;  2BDE A;  3M5Q A;  3NRY A;  1ML2 A;  2KLQ A;  5ALA A;  1A2G A;  3HI2 A;  4NVC A;  3X16 A;  2BG9 C;  2B1E A;  2J1D G;  1US7 B;  4HEA A;  4CI3 B;  3V5U A;  5CJH A;  2XSB A;  4JQM A;  2MTQ A;  4WBN E;  2X08 A;  3OYX A;  1ZKE A;  3RLF F;  1AJ3 A;  2XM2 A;  2BBH A;  3MA9 A;  2VO2 X;  5AQG B;  2H7V C;  4I55 E;  1MNP A;  4CZN A;  3P4W A;  5SXR A;  4PNI A;  1KNR A;  4IL4 A;  5AQR B;  4XV6 A;  1HNZ T;  3HR0 A;  3VU7 H;  3RX6 A;  4ISS A;  2NW9 A;  3B5M A;  4JM9 A;  4OX9 T;  1QSD A;  1CK6 A;  2B11 A;  3KVA A;  3UQ7 A;  4A7M A;  2XJ6 A;  3R99 A;  5SXS A;  1ARP A;  2QVA A;  1WRD A;  4X1K E;  1W4Y A;  2WDR A;  2V6X A;  4JM5 A;  2IC9 A;  1H5K A;  4TZ4 C;  3AAA B;  4YTN A;  4JMZ A;  2W63 A;  2ZM6 T;  3TLS A;  2JJ9 A;  2JRK A;  3B57 A;  2N18 A;  6ATJ A;  2CBI A;  4GYS A;  4I4T E;  3L09 A;  3SFD A;  2RBZ X;  3T8O A;  2LT3 A;  1MIW A;  4LML A;  5KQ3 A;  5D6M A;  5KQI A;  2LSY A;  1VOM A;  3DJB A;  4FCS A;  4JI6 T;  5KMG P;  4GK5 E;  2E9X C;  5ETW A;  2HPL A;  2XTL A;  4AKH A;  4B3T T;  3CX6 B;  2AS2 A;  3N5L A;  3GWH A;  3ZST A;  3QC9 A;  2GHD X;  2PJQ A;  5CIH A;  1BJ9 A;  5JDH A;  3ZCH A;  4CXY A;  4EED A;  1LRZ A;  2ANZ A;  1ARW A;  3CQX C;  3AAE B;  2D5U A;  5CA1 E;  2RP4 A;  2BKP A;  1SA0 E;  1KNZ A;  3HA4 A;  1SCH A;  5CJ5 A;  4YSZ A;  2BKO A;  4DV3 T;  1BR1 A;  4Z90 A;  3A8Y C;  1PA2 A;  4AQG A;  4BM1 A;  4K0K T;  2VKD A;  4NVO B;  2E9X D;  3FHN A;  2LSI A;  3CWZ B;  6CCP A;  1MN1 A;  2V6Y B;  1HF8 A;  4PJM A;  4A5G A;  4L9I A;  2BS3 A;  2UUB T;  1Z0P A;  2PG8 A;  1OAF A;  2XQY A;  3M2D A;  5FL1 A;  4AI6 A;  2M67 A;  2VL8 A;  3ETV A;  5C2T A;  5HEU A;  2NW7 A;  4DR2 T;  1ARX A;  4GYR A;  1T72 A;  5SXT A;  5LBQ B;  3FZK B;  1CCA A;  4GED A;  4DV4 T;  4KHP T;  3N9M A;  1DU2 A;  1J5W A;  2CL4 X;  1E7P A;  1V9D A;  2VKJ A;  4CZQ A;  2UXC T;  5H9E B;  4B3S T;  1VRB A;  4WZX A;  3M2C A;  5KQ0 A;  1H5F A;  5KQ6 A;  1LLP A;  4OQ7 A;  4PJN A;  4YSY A;  4QH5 A;  3CPZ A;  2W4X A;  4P4Q A;  4JMS A;  4YT0 A;  2WMO A;  4ATJ A;  2DNX A;  3ZSS A;  2DLR A;  1AEB A;  2RA1 A;  3MK7 C;  3VR9 A;  1U75 A;  1WYC A;  4YJ2 E;  3CK6 A;  1CCP A;  4NVK B;  1XDO A;  2XQ3 A;  4H63 H;  5GON E;  1CYF A;  1U5P A;  2UXN B;  3BQL A;  4JMA A;  2V7L A;  5EK4 A;  2MYS A;  4O4J E;  1APX A;  2CXL A;  3UFE A;  4C91 A;  1QLB A;  4GOU A;  5SXW A;  1AEO A;  3M2A A;  1KZM A;  3KV6 A;  4UXN B;  3P4P A;  3LSV A;  4CUO A;  2RC1 X;  4WW0 A;  3RI5 A;  2GB8 A;  5CIF A;  2XJ5 A;  2YU1 A;  2VCN A;  2D0T A;  2DWK A;  3KV5 A;  2CWO A;  3QOF A;  3M2H A;  1H5H A;  3L39 A;  4UIG A;  3PV0 F;  5CB4 E;  2YLJ A;  3PTR B;  4JPL A;  4HWC A;  1WLX A;  3Q5D A;  4X5T A;  1OED E;  4EV6 A;  3C4Z A;  5AQJ B;  2X0Y A;  4XBF B;  3ZN0 B;  3AE1 A;  3Q5E A;  5J2U E;  3SOL A;  1H5D A;  3R98 A;  2W2U A;  2A2F X;  4BM0 A;  2V5D A;  1IBM T;  2X0L B;  3ZMS B;  2YN6 A;  2W67 A;  3PUQ A;  1U2J A;  1I94 T;  4A97 A;  2D0U A;  1U74 A;  3VKG A;  3EVY A;  4QXB B;  2VVN A;  2X9H A;  5FVK A;  2KWI B;  2EHO B;  2XJ7 A;  4H79 A;  2CPT A;  3GMI A;  2XAQ B;  4H63 V;  2WBL A;  4K0U A;  5E0O A;  2YDQ A;  2H88 A;  3ESL A;  4N78 D;  3WAK A;  3AEC A;  1BES A;  3ZLI A;  5AQQ B;  2A7U B;  1ARU A;  1NEN A;  3I9Y A;  4EAH A;  3MJX A;  2CWY A;  2VB6 A;  5CIC A;  3ZT7 A;  3VRA A;  3AEF A;  5JDN A;  1GZB A;  4BLY A;  1G8X A;  4DUZ T;  2LKG A;  3FBZ A;  4ZZC A;  3ONJ A;  5SX0 A;  3L3P A;  1C8I A;  4Q25 A;  3ZT5 A;  5JR9 C;  2V26 A;  2BKN A;  1D1C A;  4KBM B;  3C64 A;  7CCP A;  2UUC T;  2V7K A;  3WI3 A;  5LGT B;  3AA1 B;  4IE0 A;  4JEU B;  1FIO A;  4X1Y E;  4LMK A;  1M62 A;  2B76 A;  1JDR A;  1H5G A;  4JMB A;  4ZI3 D;  5HXS A;  4P0B A;  3M25 A;  1AEM A;  3NRX A;  2XSA A;  4CXX A;  2KT9 A;  3NZP A;  4CCP A;  3UUL A;  5F3J A;  7ATJ A;  1VCT A;  1XWM A;  2CRB A;  2Q9Q B;  2YEV C;  4P0A A;  1RYC A;  3LJC A;  2Y5A A;  4PAE A;  5AQT B;  5AMM A;  2X0H A;  2WZH A;  4JZA A;  2R6G F;  3VLM A;  1IBL T;  2XIF A;  3ZC1 A;  2FJD A;  4CN6 A;  4HFD A;  3KBU A;  1UB2 A;  4AIS A;  1CMP A;  3FXD B;  2VNZ X;  3PU3 A;  4HWI B;  5LJN A;  2EUN A;  5HEH A;  2XQ8 A;  2JMX A;  3CX7 B;  3JAF A;  3PJA A;  2VNX X;  1HX1 B;  4BLZ A;  2PCB A;  1CCJ A;  1CMU A;  4NVI B;  1YZR A;  4JI1 T;  1W4W A;  4ZI2 C;  1OED A;  4MFR A;  3AVS A;  2K24 A;  3E22 E;  4TWF A;  3RIV A;  2LHR A;  2Q9Q A;  1JNZ A;  3H3A A;  1HNW T;  5IWA T;  5LHH B;  2Y6A A;  4M1P A;  3AEA A;  4IE7 A;  2K3W A;  1J5E T;  4HFI A;  4NVE A;  5LBM A;  2E9X A;  3WAJ A;  3ZC0 A;  4IIJ E;  3FM1 A;  2WP9 A;  3SFE A;  4OFZ A;  1BEJ A;  2EUQ A;  2P9B A;  3G06 A;  4QX7 B;  2K48 A;  1B85 A;  3ANW A;  3I9W A;  1MNE A;  1T7S A;  5CIB A;  5LNK A;  3RKO A;  2W23 A;  3UUX B;  3H37 A;  1H5C A;  4JEH B;  1N32 T;  2LKH A;  4PK5 A;  5LYJ E;  4FEF A;  3EXB A;  2EHO C;  1ATJ A;  2Z6E A;  2LSJ A;  3KFW X;  3RRW A;  2MAW A;  4UEM A;  2A9U A;  3RQU A;  1IZN B;  1YKE B;  4OK0 A;  2UU9 T;  3AE5 A;  3RYF E;  1ITK A;  3C98 B;  4DV6 T;  3NKZ A;  4ILU A;  4TUY E;  5HXC A;  1GW2 A;  5SX7 A;  1ZEE A;  4YXD A;  3KVB A;  3MXZ A;  1H7C A;  5SYK A;  5JDG A;  5LXT E;  3L8R A;  2E8I A;  3M3Z B;  1H3J A;  2UXD T;  2LEH A;  1BEM A;  5CCP A;  1AEV A;  2ZOP A;  3PUA A;  2NW8 A;  4EIW A;  4JN0 A;  1U2L A;  2CXD A;  2X9W A;  4TX5 A;  3UUN A;  2ZM2 A;  3J7Y q;  2HN2 A;  2XAH B;  1BR2 A;  1ZBY A;  1JNR A;  2E9X B;  2HN1 A;  3CVR A;  5L4E A;  2WAU A;  5BMV E;  4BA9 A;  4OHF A;  1U4Q A;  1HFA A;  3OKQ A;  4JV5 T;  2N1G A;  2BG9 E;  1ABV A;  2LLY A;  4EYU A;  1KXN A;  3HDL A;  4NFG A;  1XNR T;  2UXB T;  1UCU A;  3N9Q A;  3SWH A;  4X66 T;  1ZBZ A;  2Q9Q D;  2V6Y A;  2BVM A;  4O4H E;  3X1D A;  4NVJ B;  4NVM B;  1OED B;  4OYJ A;  2Y48 B;  5AQL B;  1HTJ F;  3FB2 A;  5KDM C;  4DR6 T;  4CZR A;  4PW8 A;  2B12 A;  3O1I A;  5SYJ A;  2NTX A;  3AEB A;  1S73 A;  4JM6 A;  3RIU C;  4H9Q C;  1BR4 A;  2NTY A;  4AQF C;  4CVI A;  3FJW A;  5JHX A;  2AE9 A;  1LY9 A;  2KND A;  5DQW A;  3AED A;  3CQG B;  5DJQ C;  3EUH A;  5LHI B;  1HSR A;  4BJM A;  5LP6 E;  5FY7 A;  3EAB A;  1KNP A;  2DCF A;  3OYZ A;  5SYX A;  4YLH A;  1AA4 A;  5FNV E;  2KXP B;  4CN1 A;  1CCE A;  2EUS A;  1DSE A;  1SUM B;  1MIV A;  3ZJ1 A;  3ZMT B;  2IIU A;  2CMR A;  4U31 A;  5TAO A;  2ICV A;  3UU8 A;  4TNV A;  4DR4 T;  2V8S V;  2J62 A;  1D0Y A;  4O2B E;  4XVA A;  2WB5 A;  3X1L F;  3P4Q A;  4AQF A;  5CA0 E;  1S94 A;  5LGU B;  4PFO A;  1KXM A;  4CXW A;  5AL9 A;  1XZY A;  3TKL B;  1HG5 A;  3NVO A;  2BBJ A;  3F31 A;  1SDQ A;  2E5L T;  5ABO A;  1QGJ A;  3QB5 A;  2WDV A;  2XY8 B;  1UX4 A;  4F6R C;  4QHO A;  1BEK A;  1UUS A;  1AED A;  1MMA A;  3B13 A;  5ABH A;  4JI5 T;  2V23 A;  3HKD E;  3UUM A;  4AKI A;  2FBW A;  4ZEY A;  3V5S A;  4IE6 A;  2VWA A;  4HN9 A;  1IAP A;  5AQN B;  5ABF B;  3AE6 A;  4LF8 T;  5CID A;  4G63 A;  4JMV A;  1GWT A;  3ZYM A;  4NVG B;  2OLT A;  3K3N A;  1LKX A;  3PUS A;  5LJM A;  4EYY R;  2GHK X;  2OV9 A;  4U33 A;  2AS1 A;  1CCC A;  3AE4 A;  4NVL A;  2MPK A;  3LK4 2;  4UVB B;  3IF8 B;  2V7J A;  4HFE A;  4YTP A;  4MAL A;  3EHZ A;  3GN5 A;  4HKA A;  4BLK A;  5L3F B;  3NBX X;  5FY0 A;  1XMQ T;  2N2N A;  5J0Z A;  2CBJ A;  2IML A;  4XAX B;  4BM4 A;  1AEJ A;  3KDS E;  2PBI A;  3M2B A;  4ZI3 C;  1BGP A;  2AS6 A;  3M2E A;  2D9D A;  4WBO A;  3EDV A;  3AA0 B;  2RBU X;  4NVD A;  3UT2 A;  2WCA A;  3LBX B;  4U7U B;  3RIU A;  4A56 A;  1J1J A;  3N9P A;  3N9O A;  4PJJ A;  4BLL A;  2YU2 A;  2I6H A;  5A1L A;  3FM6 A;  2RBT X;  5JTG A;  3ZMU B;  1M7K A;  3RC3 A;  4CZZ B;  2VKA A;  5HEO A;  2GHE X;  3FKG A;  2JQQ A;  4GKK T;  4HFH A;  3E2N A;  1YYD A;  2PTF A;  4X65 T;  1WR0 A;  5HWY A;  3ANW B;  1OED C;  3TLW A;  2LRK A;  3RKG A;  4UV9 B;  2LSG A;  4IDP A;  4NUV A;  3FMU A;  1LYC A;  3ZCG A;  5BR8 T;  2KIN B;  2ZCA A;  1L0V A;  3PUR A;  3LBX A;  3O9X A;  1MND A;  2DWG A;  3VLI A;  5AQU B;  5JHZ A;  3P50 A;  2QGS A;  5SYH A;  2XQ7 A;  4QKN A;  2K9A A;  4JPT A;  1ARV A;  4C51 A;  2YDR A;  3TLT A;  2IUB A;  1HR0 T;  1CCK A;  2C0S A;  4YHJ A;  2VKH A;  3P4S A;  4EEB A;  3ZT6 A;  2HHH T;  3VLL A;  5JHY A;  4O2A E;  1N33 T;  3OVU A;  1ZHC A;  5SYI A;  1D1B A;  3RIW A;  2ODU A;  5L4H A;  3JC6 C;  2ATJ A;  5EK2 A;  4O8S A;  4UF0 B;  5SYL A;  2EUO A;  4JUY A;  4JPU A;  2E3B A;  4A78 A;  3QB5 K;  2W0G A;  2LSK A;  4IHJ E;  3VLH A;  1SJ2 A;  5FXV A;  4ADZ A;  5HXH A;  1CPF A;  2RBW X;  3BQI A;  3UFG A;  5HCJ A;  4IDZ A;  1MMN A;  2BCN A;  3J9X 1;  2IA8 A;  2F4V T;  3U78 A;  2Y6X A;  3OBV E;  3ETU A;  5LA6 E;  4KMC A;  4V1A v;  4PK4 A;  5HXE A;  2KMF A;  2AQD A;  2H89 A;  3W15 B;  2WQY A;  1CUN A;  2JMH A;  4ZZB A;  2WWU A;  2D2S A;  3TLU A;  3VRB A;  5SX6 A;  2XUE A;  1YXR A;  5AQM B;  2PCC A;  1X79 A;  3OJA A;  2YKS A;  4TWD A;  5FY1 A;  5KX5 E;  2JQ9 A;  4QXH B;  2V5C A;  4XV4 A;  2JIW A;  3PE0 A;  2X66 A;  4IST A;  5L3D B;  2L8K A;  2X9X A;  4QX8 B;  5KQK A;  1SOG A;  3LG7 A;  2V1D B;  3C4W A;  3P8C D;  5IYZ E;  4LF7 T;  3ZCI A;  4BAY B;  3AE7 A;  5AQH B;  3KV9 A;  1R8I A;  1E1H B;  4JM8 A;  1T8B A;  4DUY T;  2QRX A;  1HS7 A;  5H9F B;  2BO5 A;  1NWM X;  3FZF B;  4PK6 A;  2L9Q A;  4F8H A;  1EZ3 A;  5SW4 A;  3GA8 A;  4JLE A;  5JQR A;  1OXZ A;  5HEG A;  1ZOY A;  1GQE A;  2CXF A;  2YK0 A;  1BR0 A;  5FKY A;  4NXM T;  2ES0 A;  5CIG A;  3WXO A;  4H9R C;  1FHF A;  5SX1 A;  4H7A A;  1B80 A;  4CZO A;  4A71 A;  4H9O C;  1QPA A;  3EAM A;  2CHN A;  1AEE A;  1KK7 A;  3GN5 B;  3T1Y T;  3LK3 B;  4JI8 T;  2GHH X;  3K3Q C;  2M6I A;  4U7I A;  1H5J A;  3CCP A;  5AQI B;  5EJX A;  1XNQ T;  1Z8U A;  4COF A;  2XAG B;  2CCQ A;  2BG9 A;  2KZ7 B;  5L3G B;  2H3R A;  4YHH T;  4DR5 T;  1H55 A;  1WCR A;  3F57 A;  4FDQ A;  2IC6 A;  3PUX F;  3ZPO A;  2GK9 A;  4CN4 A;  1MKQ A;  4P1N A;  5ADX L;  1YQ3 A;  2WSS V;  1S35 A;  5ABE A;  4DR1 T;  4DND A;  5ABG A;  4DMW A;  4WYV A;  3HKC E;  4DO0 A;  2WS3 A;  2XHE B;  1G73 A;  5AQO B;  2X67 A;  1N34 T;  1NAF A;  2EUR A;  3CQC B;  2Y8D A;  5JR9 A;  1CCI A;  1CPG A;  2FJB A;  3I0O A;  4C90 A;  1QUU A;  5FNE A;  2EUP A;  2ZM0 A;  5LG4 A;  4JI3 T;  5J2T E;  3UUB A;  3DP7 A;  4NVH B;  4HTE A;  2ZM8 A;  3VLK A;  4YJ3 E;  4XV7 A;  4BLN A;  3P4R A;  2J4G A;  2ZLY A;  5KQH A;  5H6Q B;  5DQV A;  1HCI A;  2XZE A;  4JI2 T;  3AB3 B;  2XIL A;  2GGN X;  2NWB A;  5JVD E;  4PFP A;  1SBM A;  1LYK A;  1GX2 A;  2LM9 A;  4KP3 C;  2C5K T;  1WYB A;  2W61 A;  2XQ4 A;  4LFA T;  5JDM A;  1H5M A;  2X51 A;  5SX0 B;  4C50 A;  4X64 T;  4CCX A;  1W0A A;  3RQW A;  4KUM B;  3UU6 A;  1DJ1 A;  4EGW A;  2WMN A;  2G0U A;  1AC8 A;  2Y6B A;  2AXD S;  2RBV X;  4USC A;  4ZS2 A;  4H9P C;  1STQ A;  3R84 B;  1FMW A;  1ZP0 A;  2CHO A;  1H5I A;  2KWH A;  2WU2 A;  3M23 A;  1V0H X;  5IHY A;  2LE8 A;  1N36 T;  5JH7 E;  5SXX A;  2SPC A;  5AFU L;  1YZP A;  1OWA A;  4JI4 T;  4LF6 T;  1LGA A;  2VCS A;  1CCL A;  1AEN A;  4TNW A;  4CZP A;  4JMT A;  4E7Z A;  3JC6 D;  3M65 A;  4UV8 B;  1MK8 A;  1AEU A;  4HFV A;  3AA7 B;  4J2C A;  1VCS A;  2X9Y A;  1H57 A;  2RC0 X;  3KV4 A;  5CGM A;  2LOP A;  4ILB A;  5AQK B;  2CLY C;  3OPC A;  2JQK A;  5HCM A;  5SXQ A;  2MBG A;  5HYA A;  2XI6 A;  4EZ4 A;  2VUR A;  2IW5 B;  2LM2 A;  4EB6 E;  4G05 A;  5AOG A;  3RH3 A;  3PUY F;  5SW5 A;  2A3D A;  4BJN A;  4EXT A;  1BEQ A;  1X9B A;  2YOE A;  3FZH B;  3R6N A;  4YTM A;  5JRE A;  5LMN T;  1BVA A;  4CVJ A;  3AEE A;  3JCF A;  1I6Z A;  4U2Z A;  4LFB T;  3AVR A;  4YFS A;  4JQK A;  3CML A;  4IDO A;  2V7I A;  2WZI A;  3FXE B;  1AES A;  2JPF A;  2VKO A;  3PUV F;  4XV8 A;  4ZHQ E;  4FJO A;  2DL1 A;  4GK0 E;  3QK6 A;  3I0Q A;  4I0U A;  4QH1 A;  4I50 E;  5KQ2 A;  3S4U A;  3UW8 A;  1UGO A;  2UUA T;  3HKB E;  2Q9Q C;  3O1J A;  4DR3 T;  1CMT A;  4JMW A;  3N9N A;  4HE8 A;  5LCY A;  4B3R T;  1MKR A;  1JCI A;  4EZH A;  2CCA A;  5JQG E;  3ATJ A;  3BK9 A;  2QYW A;  2ACZ A;  3M2I A;  2H7O A;  4NVF A;  2B10 A;  2VVS A;  4DV5 T;  4GKF A;  2K5B B;  3RC8 A;  3MZK B;  4IT4 A;  4HFB A;  4LF5 T;  3N2G E;  1DS4 A;  5CD4 J;  5M4Y A;  3ZMV B;  4LFC T;  4DBR A;  4AKL A;  2QA7 A;  3NZQ A;  2ODV A;  4X62 T;  2VK9 A;  1GWO A;  4B3M T;  2VQF T;  1YYG A;  2A72 A;  4U7Y A;  1U2K A; 
#chains in the Genus database with same CATH homology
 4UF0 B;  4NUU A;  5SYL A;  3E0Z A;  2EUO A;  3CX7 B;  1HG2 A;  3C51 A;  5FXW A;  4JUY A;  2VNX X;  4JPU A;  2E3B A;  4A78 A;  2PCB A;  4BLZ A;  1CCJ A;  1CMU A;  4TN7 B;  4TV9 E;  5L05 A;  3VHL A;  4NVI B;  4UEL A;  1YZR A;  1KOK A;  4NVB A;  3SS1 A;  1H5L A;  4G2A A;  4H9S E;  5JDF A;  1W4W A;  4ZI2 C;  2W0G A;  2LSK A;  3K8P C;  4ZI2 D;  3E2O A;  4MFR A;  3AVS A;  4IHJ E;  2VCF X;  2K24 A;  3E22 E;  3VLH A;  1SJ2 A;  5SX2 A;  5FXV A;  4ADZ A;  3MAC A;  5HXH A;  1CPF A;  2RBW X;  2WM9 A;  1GZA A;  1IJ6 A;  3BQI A;  3RIV A;  4IDZ A;  1MMN A;  2BCN A;  2LHR A;  2Q9Q A;  1ARY A;  3J9X 1;  3ZYK A;  1MIY A;  1YKH B;  2IA8 A;  3H3A A;  2ZMA A;  3KIN B;  3U78 A;  4BM2 A;  4B6X A;  5SX3 A;  2Y6X A;  3I1A A;  3RPU A;  5LGN B;  2BDE A;  3M5Q A;  1H58 A;  2Y6A A;  4M1P A;  1AC4 A;  3NRY A;  5LHH B;  3OBV E;  1LVK A;  1ML2 A;  2KLQ A;  3ETU A;  5FYM A;  3PUG A;  5LA6 E;  4KMC A;  4V1A v;  5ALA A;  3O1H A;  1A2G A;  1IYN A;  2HPJ A;  2NP9 A;  4IE7 A;  3HI2 A;  4NVC A;  3X16 A;  5ABQ A;  4PK4 A;  1MMD A;  2B1E A;  4UVA B;  2J1D G;  5HXE A;  1US7 B;  4NVE A;  2AQD A;  2KMF A;  4HEA A;  5LBM A;  4U74 A;  3Q3U A;  2E9X A;  2W62 A;  3WAJ A;  3ZC0 A;  3D0T A;  4IIJ E;  3W15 B;  1CUN A;  4CI3 B;  5EK3 A;  3FM1 A;  3IBP A;  4P09 A;  3ONX A;  3V5U A;  2JMH A;  5CJH A;  4I43 B;  5C8Y E;  4JQM A;  4AKR B;  2MTQ A;  3C4X A;  4OFZ A;  4WBN E;  2X08 A;  3OYX A;  1BEJ A;  5F3J A;  2CYP A;  1ZKE A;  2WWU A;  2D2S A;  2EUQ A;  2P9B A;  3MA9 A;  1AJ3 A;  3Q9D A;  2CCD A;  2VO2 X;  2H7V C;  1DCC A;  2YCG A;  2K48 A;  4I55 E;  1MNP A;  4CZN A;  1A2F A;  5SX6 A;  2XUE A;  4QX7 B;  4ZOL E;  1B85 A;  3ANW A;  3I9W A;  5SXR A;  1MNE A;  3Q5X A;  4ANJ A;  3M29 A;  5CIB A;  2HH7 A;  1FEW A;  4PNI A;  5LNK A;  2PCC A;  1X79 A;  3ZCY A;  3HL6 A;  2E39 A;  3IEE A;  4XV6 A;  1IJ5 A;  2W23 A;  3OJA A;  3RKO A;  3UUX B;  3VKH A;  3HR0 A;  3H37 A;  3VU7 H;  1H5C A;  3QUJ A;  4JEH B;  2CEA A;  1H5A A;  5FY1 A;  3RX6 A;  4ISS A;  2EUU A;  4BM3 A;  1SHZ C;  2UXX B;  2NW9 A;  5KX5 E;  4JM9 A;  4QXH B;  4PK5 A;  1AEQ A;  3CCX A;  5LYJ E;  4FEF A;  4XV4 A;  3PE0 A;  2X66 A;  4IST A;  4TV8 E;  5L3D B;  1MMG A;  4NVA A;  3UT5 E;  3EXB A;  2EHO C;  3C50 A;  4UF0 A;  1ATJ A;  2L8K A;  1DJ5 A;  2X9X A;  2Z6E A;  1QSD A;  4QX8 B;  5KQK A;  1CK6 A;  2B11 A;  1SOG A;  2LSJ A;  3KVA A;  2V1D B;  3C4W A;  3RRW A;  3KFW X;  3LG7 A;  3P8C D;  4A7M A;  4UEM A;  5IYZ E;  2XJ6 A;  3ZCI A;  4BAY B;  4GIW A;  3KV9 A;  3R99 A;  1E1H B;  1CPE A;  1IZN B;  1YKE B;  5SXS A;  4OK0 A;  1ARP A;  1DSG A;  4JM8 A;  1WRD A;  3SRZ A;  3AA6 B;  4X1K E;  1W4Y A;  1HS7 A;  3RYF E;  4JM5 A;  1ITK A;  5H9F B;  2IC9 A;  1H5K A;  3C98 B;  3AAA B;  4TZ4 C;  1NWM X;  3UTK A;  4JMZ A;  2W63 A;  4ILU A;  4PK6 A;  1GW2 A;  4TUY E;  2BZB A;  2JJ9 A;  5HXC A;  2CE7 A;  2L9Q A;  5SX7 A;  2JRK A;  3B57 A;  1ZEE A;  2N18 A;  6ATJ A;  1CMQ A;  4GYS A;  4I4T E;  3KVB A;  3MXZ A;  1H7C A;  5SYK A;  3L09 A;  3PDY A;  2RBZ X;  3M2G A;  4QWN B;  5JDG A;  2VAS A;  3T8O A;  2NOX A;  5LXT E;  1EZ3 A;  5SW4 A;  2E8I A;  3GA8 A;  4XV5 A;  5JQR A;  1OXZ A;  2LT3 A;  1EBE A;  4JLE A;  1MIW A;  3M27 A;  1H3J A;  5KQ3 A;  1T98 A;  2CXF A;  2LEH A;  5D6M A;  3FM4 A;  2YK0 A;  2B0Z A;  5KQI A;  1VOM A;  2LSY A;  1BEM A;  5CCP A;  3DJB A;  2ES0 A;  1BR0 A;  2IAK A;  1AEV A;  4FCS A;  1D1A A;  5KMG P;  5CIG A;  3WXO A;  4GK5 E;  4H9R C;  1FHF A;  2E9X C;  5ETW A;  3PUA A;  1BEP A;  2NW8 A;  5FXX A;  4EIW A;  4QXC B;  2HPL A;  2XTL A;  4JN0 A;  4AKH A;  5SX1 A;  3CX6 B;  1U2L A;  1B80 A;  4H7A A;  2AS2 A;  3N5L A;  4A6Z A;  2CXD A;  5L3E B;  1OAG A;  4CZO A;  4A71 A;  3GWH A;  2MOZ A;  2X9W A;  3QC9 A;  4H9O C;  2GHD X;  2PJQ A;  1QPA A;  5CIH A;  4TX5 A;  2ZM2 A;  3UUN A;  1BJ9 A;  5JDH A;  3J7Y q;  1AEE A;  2XAH B;  1BR2 A;  3ZCH A;  4CXY A;  1KK7 A;  3GN5 B;  1ZBY A;  1LRZ A;  2ANZ A;  1ARW A;  3CQX C;  3LK3 B;  3AAE B;  2E9X B;  2GHH X;  3CVR A;  2WAU A;  3K3Q C;  5BMV E;  4BA9 A;  4OHF A;  2D5U A;  1U4Q A;  1HFA A;  2RP4 A;  2E3A A;  3OKQ A;  5CA1 E;  2V2E A;  1H5J A;  2N1G A;  3CCP A;  2XAJ B;  1SA0 E;  4O4L E;  3BQK A;  1KNZ A;  3HA4 A;  1SCH A;  5EJX A;  3M26 A;  4EYU A;  3N2O A;  1KXN A;  3HDL A;  2XAG B;  5FP3 A;  1BR1 A;  4NFG A;  2CCQ A;  2KZ7 B;  5L3G B;  1PA2 A;  2H3R A;  4AQG A;  4BM1 A;  5FXZ A;  2YIN A;  2VKD A;  1H55 A;  4NVO B;  5JDQ A;  2E9X D;  4FDQ A;  3F57 A;  3FHN A;  2IC6 A;  2LSI A;  3ZPO A;  1UCU A;  3CWZ B;  2GK9 A;  3N9Q A;  1MKQ A;  5ADX L;  6CCP A;  3SWH A;  1ZBZ A;  2Q9Q D;  2WSS V;  1MN1 A;  1S35 A;  2BVM A;  2LOS A;  4O4H E;  4IGU A;  1HF8 A;  4NVJ B;  4PJM A;  4DND A;  4A5G A;  4NVM B;  4L9I A;  4OYJ A;  3RYH E;  2Y48 B;  1Z0P A;  2PG8 A;  1OAF A;  1HTJ F;  4DMW A;  3FB2 A;  5KDM C;  2XQY A;  3M2D A;  1YD8 G;  4AI6 A;  4CZR A;  4PW8 A;  2B12 A;  5L86 A;  2M67 A;  3HKC E;  2XJ8 A;  3Q2M A;  3O1I A;  2VL8 A;  5SYJ A;  2NTX A;  1WR6 A;  3ETV A;  3U3I A;  4DO0 A;  4QYZ B;  1ZV4 X;  2NW7 A;  1ARX A;  1G73 A;  2XHE B;  3AAI A;  5J1G A;  1S73 A;  4JM6 A;  4GYR A;  4O8S A;  4H9Q C;  5L3B B;  5SXT A;  4H9N C;  2X67 A;  1NAF A;  2BOQ A;  1BR4 A;  5EJT A;  2EUR A;  5SYU A;  3CQC B;  2NTY A;  3IHR A;  5H6R B;  2Y8D A;  3E08 A;  5JR9 A;  4AQF C;  1CCI A;  4CVI A;  4L0R A;  1AEF A;  1CPG A;  5LBQ B;  4DBQ A;  3FJW A;  5JHX A;  1CCA A;  1LY9 A;  2KND A;  5DQW A;  3I0O A;  4C90 A;  1QUU A;  4BLX A;  4CI2 B;  3CQG B;  5DJQ C;  3EUH A;  1HX8 A;  5FNE A;  5LHI B;  4GED A;  2EUP A;  2ZM0 A;  5LG4 A;  1Y64 B;  1HSR A;  2PFV A;  3N9M A;  4BJM A;  5J2T E;  2C5J A;  5LP6 E;  2JTI A;  3DP7 A;  5FY7 A;  3WA8 A;  4NVH B;  4HTE A;  3F2E A;  2CL4 X;  1V9D A;  2DCF A;  2VKJ A;  5SYX A;  3VLK A;  4CZQ A;  2W00 A;  2ZM8 A;  3OYZ A;  4XV7 A;  4YJ3 E;  4FI5 A;  4YLH A;  1AA4 A;  4BLN A;  5FNV E;  3K3O A;  2KXP B;  5H9E B;  4EOZ B;  1CCE A;  2EUS A;  1VRB A;  1DSE A;  1MIV A;  5F8P A;  3ZJ1 A;  3ZMT B;  3M2C A;  5KQ0 A;  2ACX A;  1H5F A;  4JQN A;  5KQ6 A;  2DI4 A;  5KQH A;  2ZLY A;  4HGA A;  5H6Q B;  2CMR A;  1HCH A;  4JQJ A;  1LLP A;  4XZC A;  5DQV A;  5TAO A;  5JR9 B;  2ICV A;  4OQ7 A;  4PJN A;  1HCI A;  5GON E;  2EUT A;  3CPZ A;  3AB3 B;  2XIL A;  4P4Q A;  4PJL A;  4JMS A;  3ZJ2 A;  1O3X A;  2WMO A;  2GGN X;  1D0Y A;  4ATJ A;  4L5G A;  4O2B E;  4XVA A;  2DNX A;  2NWB A;  4AQF A;  5JVD E;  4AXP A;  2DLR A;  5CA0 E;  1AEB A;  2RA1 A;  3MK7 C;  5ABN A;  1S94 A;  1QO4 A;  1U75 A;  1WYC A;  4PFO A;  4PFP A;  4YJ2 E;  1CCP A;  1KXM A;  1SBM A;  5LGU B;  4NVK B;  4CXW A;  5AL9 A;  2XAF B;  1LYK A;  1GX2 A;  2LM9 A;  3LFM A;  4H63 H;  1HG5 A;  1YW0 A;  2RBY X;  4JB4 A;  1CYF A;  5SW6 A;  1WYB A;  2C5K T;  2W61 A;  4KP3 C;  4U72 A;  4MLK A;  5JDM A;  4O4I E;  1H5M A;  1U5P A;  2X51 A;  1SDQ A;  5SX0 B;  3F31 A;  4C50 A;  2UXN B;  5KSF A;  3A5X A;  4CCX A;  5ABO A;  3BQL A;  4JMA A;  4KUM B;  1QGJ A;  2V7L A;  5EK4 A;  3ZYL A;  1DJ1 A;  2MYS A;  3KBT A;  4O4J E;  1AEH A;  3LK2 B;  1UX4 A;  4F6R C;  2WMN A;  4QHO A;  1APX A;  2CXL A;  3HKE E;  2G0U A;  4PAG A;  3UFE A;  4C91 A;  1BEK A;  1AC8 A;  4NVN B;  4GOU A;  2Y6B A;  1AED A;  5SXW A;  1MMA A;  1AEO A;  2X07 A;  2RBV X;  5SYY A;  4USC A;  3M2A A;  4IE4 A;  1KZM A;  3KV6 A;  3PU8 A;  4ZS2 A;  3B13 A;  4H9P C;  4UXN B;  1STQ A;  2V23 A;  3Q5W A;  5L02 A;  3HKD E;  3R84 B;  1FMW A;  2CCP A;  3UUM A;  4AKI A;  4CUO A;  2AS3 A;  1H5E A;  1GWU A;  2XAS B;  3V5S A;  1H5I A;  2RC1 X;  3M8M A;  2KWH A;  2VWA A;  2GB8 A;  4HN9 A;  4IE6 A;  4WW0 A;  1IAP A;  3M23 A;  1LY8 A;  1V0H X;  5CIF A;  5L3C B;  2XJ5 A;  2YU1 A;  5IHY A;  2LE8 A;  2VCN A;  5CID A;  4G63 A;  4ERR A;  4JMV A;  2D0T A;  2DWK A;  3O4X E;  3KV5 A;  5JH7 E;  2CWO A;  1GWT A;  5L2L A;  5FMN A;  1S6V A;  4NVG B;  3ZYM A;  5JRC B;  5SXX A;  3K3N A;  2SPC A;  5AFU L;  1YZP A;  1LKX A;  1OWA A;  2LJL A;  3DTO A;  3PUS A;  5LJM A;  3M2H A;  1LGA A;  1D0X A;  1H5H A;  2VCS A;  1CCL A;  1AEN A;  4UIG A;  2GHK X;  2YLJ A;  4JMT A;  4CZP A;  5CB4 E;  4EYY R;  3JC6 D;  4E7Z A;  3M65 A;  2AS1 A;  4UV8 B;  3PTR B;  1MK8 A;  4JPL A;  3N2K E;  1AEU A;  1CCC A;  1WLX A;  4HFV A;  3AA7 B;  4NVL A;  1MN2 A;  4J2C A;  1LVF A;  2X9Y A;  4FCN A;  2LHN A;  1KRJ A;  5SYW A;  3C4Z A;  4XBF B;  3LK4 2;  3ZN0 B;  1H57 A;  2RC0 X;  4UVB B;  1D0Z A;  3SOL A;  5J2U E;  1H5D A;  3R98 A;  2V7J A;  3IF8 B;  3KV4 A;  2A2F X;  4BM0 A;  3ZMZ B;  2LOP A;  3RYC E;  2X0L B;  3ZMS B;  4MAL A;  3GN5 A;  4HKA A;  4BLK A;  5L3F B;  3PUQ A;  2CLY C;  1U2J A;  3NBX X;  5FY0 A;  2D0U A;  2N2N A;  1U74 A;  4ASK A;  3VKG A;  3EVY A;  5SXQ A;  4XAX B;  4BM4 A;  2MBG A;  4QXB B;  5LHG B;  1AEJ A;  5HYA A;  3RYI E;  2XI6 A;  2X9H A;  3KDS E;  4EZ4 A;  2PBI A;  3M2B A;  4ZI3 C;  1FMV A;  2N9D A;  3CKD A;  4IE5 A;  1BGP A;  2EHO B;  2AS6 A;  3M2E A;  2KWI B;  1DSO A;  2IW5 B;  3ZN1 B;  4H79 A;  5DAB A;  3GMI A;  4WBO A;  4EB6 E;  4Z8X A;  3EDV A;  1AET A;  4G05 A;  2XAQ B;  3AA0 B;  5AOG A;  2CLY B;  2WBL A;  4H63 V;  4K0U A;  3RH3 A;  2RBU X;  5JRC A;  2X68 A;  4NVD A;  5HAX A;  5E0O A;  5SW5 A;  3ESL A;  1CPD A;  4N78 D;  3WAK A;  3UT2 A;  3LBX B;  4U7U B;  2A3D A;  2WD4 A;  4A56 A;  4ZS3 A;  3N9P A;  4BJN A;  1BEQ A;  3R6N A;  4EXT A;  2RBX X;  1BES A;  3N9O A;  3ZLI A;  5JRE A;  5CIE A;  4PJJ A;  1ARU A;  2CM0 A;  4BLL A;  2YU2 A;  1BVA A;  4X20 E;  3I9Y A;  4CVJ A;  1B7T A;  5A1L A;  4ZI7 E;  3FM6 A;  3MJX A;  2CWY A;  2RBT X;  4EAH A;  5EZY E;  3ZMU B;  4CI1 B;  3M28 A;  2VB6 A;  3P7I A;  3RC3 A;  5CIC A;  4CZZ B;  2VKA A;  5JPR A;  2GHE X;  3AVR A;  4YFS A;  3M2F A;  4JQK A;  3FKG A;  5JDN A;  3CML A;  2JQQ A;  1GZB A;  3E2N A;  2JMK A;  2OA5 A;  2V7I A;  5JDL A;  1YYD A;  4BLY A;  1AES A;  3FXE B;  1G8X A;  5HWY A;  2JPF A;  2VKO A;  3ANW B;  2L3L A;  2C5I T;  4XV8 A;  3FBZ A;  4ZHQ E;  3EDU A;  4UV9 B;  4OYK A;  4FJO A;  5SX0 A;  2EHO D;  3MKD A;  3L3P A;  4GK0 E;  4CQI A;  1C8I A;  3QK6 A;  3N9L A;  5JR9 C;  2LSG A;  2V26 A;  2CA5 A;  4MHC A;  1AEG A;  4NUV A;  3I0Q A;  4E7S A;  3FMU A;  1D1C A;  1LYC A;  3VLJ A;  4KBM B;  3ZCG A;  1CCB A;  3C64 A;  7CCP A;  2CEP A;  5HWX A;  2AS4 A;  2V7K A;  3WI3 A;  3AA1 B;  4I50 E;  1AEK A;  5LGT B;  4AKG A;  5KQ2 A;  2EHO A;  3S4U A;  3UW8 A;  2KIN B;  5KSK A;  2I59 A;  4IE0 A;  2ZCA A;  4JEU B;  1FIO A;  2Q9Q C;  3HKB E;  3O1J A;  3WNU A;  1CMT A;  4X1Y E;  2XIH A;  4JMW A;  1JDR A;  3PUR A;  1CCG A;  1DSP A;  1H5G A;  2GHC X;  3LBX A;  3O9X A;  4JMB A;  1MND A;  3N9N A;  4HE8 A;  4MBQ A;  4ZI3 D;  5HXS A;  2DWG A;  4P0B A;  5LCY A;  3VLI A;  3M25 A;  1AEM A;  1MKR A;  5JHZ A;  1JCI A;  4EZH A;  2CCA A;  3NRX A;  4WNK A;  4CXX A;  5JQG E;  2KT9 A;  3CX8 B;  4CCP A;  2DHR A;  5FNB A;  2QGS A;  3NZP A;  3ATJ A;  5SYH A;  2RC2 X;  4QKN A;  5LOV E;  4X1I E;  4UVC B;  3UUL A;  3BK9 A;  2K9A A;  1Z53 A;  3M2I A;  2H7O A;  7ATJ A;  4NVF A;  2Q9Q B;  2YEV C;  2B10 A;  2V7M A;  3RRC A;  4JPT A;  3TKL B;  4P0A A;  1ARV A;  1RYC A;  3LJC A;  4DMV A;  4C51 A;  1B82 A;  2Y5A A;  2K5B B;  4PAE A;  3ZCJ A;  5AMM A;  3MZK B;  3RC8 A;  4JZA A;  1CCK A;  2C0S A;  3N2G E;  4YHJ A;  1DS4 A;  3VLM A;  5CD4 J;  2VKH A;  3ZMV B;  5M4Y A;  4DBR A;  4DVD A;  5SYV A;  2XIF A;  3ZC1 A;  4AKL A;  2QA7 A;  3NZQ A;  3VLL A;  5JHY A;  1UX5 A;  4O2A E;  3KBU A;  1UB2 A;  2ODV A;  1CMP A;  2VK9 A;  1ZHC A;  2BVL A;  3FXD B;  1GWO A;  5SYI A;  3RIW A;  1D1B A;  2ODU A;  2VNZ X;  3JC6 C;  3PU3 A;  5HXR A;  2ATJ A;  5EK2 A;  3ZEF B;  5LJN A;  1YYG A;  2A72 A;  2EUN A;  3FBL A;  1U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...