3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
b'LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
1LY8A 3R98A 1AEVA 1DJ1A 1B85A 2CCAA 1U74A 2AS1A 2RC2X 4NVOB 1DJ5A 1SJ2A 4GEDA 2GHKX 1U2LA 4NVKB 4C50A 2XI6A 5SW4A 4CZQA 3CCXA 4NVDA 2GHEX 5ALAA 5SXQA 3VLJA 2RBWX 3UT2A 1BJ9A 5KQKA 4BLKA 5ABOA 1ITKA 1H5EA 1H5LA 4P4QA 1SOGA 1V0HX 1H55A 1CCCA 4JM8A 1ZBYA 3M23A 2RBZX 1CCJA 1H5JA 1AEFA 2EUQA 3M27A 5SXXA 2W23A 3VLMA 1CCAA 3RIWA 3M2DA 3UW8A 5KQ2A 5CICA 1APXA 1H5KA 5KQ0A 1AEOA 1LY9A 2EUNA 4FCSA 1CMUA 5AL9A 2E3AA 2ATJA 1AEEA 4CCPA 1QO4A 3EXBA 1SDQA 1LYCA 2X08A 1YYGA 1AEQA 3E2OA 1AEHA 1CMPA 1QGJA 1H5CA 1KXMA 5CCPA 3M2IA 2AQDA 2EURA 5SX7A 1MN1A 2XJ6A 1AA4A 1AC4A 3M2FA 5CJHA 1AEGA 1H57A 5JQRA 1SBMA 4BM0A 1AEMA 1PA2A 1H5MA 1UB2A 4FDQA 2EUSA 3M5QA 4BM4A 1AC8A 2JTIA 4USCA 2RBTX 1KRJA 7ATJA 5SX6A 5ABQA 1AEBA 4BM1A 1H58A 3M29A 1IYNA 3RIVA 4JQNA 2ICVA 1EBEA 1ARXA 1A2FA 2V23A 1H5DA 2AS2A 2VNXX 2VCFX 5SW5A 1CCPA 3M2GA 3M2EA 1CMTA 1MKRA 1BEPA 2XIHA 3RRWA 4BLXA 1GX2A 2N18A 1BEJA 6CCPA 1GW2A 5SXRA 3M8MA 4FCNA 2XIFA 1H3JA 3M2HA 5JPRA 1HSRA 1GWOA 1LYKA 3M25A 3ZCGA 1CCGA 1DSEA 2RC0X 2VKAA 1AEKA 5SYLA 1STQA 2CEPA 5CIBA 5SX1A 5SYXA 2B12A 1AESA 4JMZA 2V2EA 3VLHA 1ARWA 1W4WA 4OQ7A 1KOKA 3M2CA 1CCEA 3FMUA 1Z53A 1LLPA 5SYKA 5SX0A 2CCDA 2GHHX 3FKGA 5L05A 5SYJA 5D6MA 1BEKA 5CIFA 4BM3A 3M2AA 1DCCA 4G05A 5SW6A 5JHYA 3M28A 2YLJA 2E3BA 3E2NA 1GZBA 4NVEA 4JQJA 2XJ8A 3M2BA 1DSOA 1ML2A 4A5GA 2B11A 1GWTA 1H5HA 2EUOA 2VCNA 1HCHA 4JQMA 4NVIB 4JM6A 5JHZA 2IA8A 1YZPA 1H5GA 2CCPA 3CCPA 1H5IA 3WNUA 1ATJA 2AS4A 1U75A 4JM9A 4NFGA 1CPGA 4A6ZA 1SCHA 2RC1X 5SYYA 2XILA 2RBXX 4BLLA 4NVCA 3WXOA 2GHDX 1MK8A 4CZPA 1FHFA 1ARYA 4CZRA 1MKQA 4JB4A 1AEJA 1ARVA 5SX3A 1CCIA 1MN2A 1OAGA 4XV7A 5KSKA 3X16A 1KZMA 1GWUA 4BLYA 4NVAA 3R99A 2B0ZA 4BLNA 4CZOA 1U2KA 3FM4A 6ATJA 4CUOA 1CPEA 1MNPA 2XJ5A 3ZCHA 1AEDA 4NVNB 1AEUA 5SYHA 1U2JA 2AS3A 2CYPA 4XV6A 5FNBA 4JN0A 4CCXA 4NVLA 3FJWA 4C51A 5SYUA 1DSGA 3M26A 4JMWA 4CVJA 5ABNA 4JMBA 3ZCYA 7CCPA 2RBYX 3VLLA 1C8IA 5FNEA 2Y5AA 1A2GA 4XV8A 3ATJA 5EJXA 5CIEA 5AMMA 2BCNA 1CMQA 1GZAA 5CIDA 4JMTA 2ANZA 3VLIA 1ARUA 2EUUA 4NVFA 4JQKA 1CPDA 5KQHA 4BM2A 4XVAA 4ATJA 4JPUA 5L86A 1ZBZA 1RYCA 4CZNA 1DS4A 1W4YA 4JM5A 2RBVX 1BEMA 5KQ6A 1H5FA 5SYIA 2GGNX 4PAEA 4JMSA 3Q3UA 1BGPA 2GHCX 2PCCA 1AETA 4NVBA 4JMVA 1BEQA 1CCLA 4NVGB 1KXNA 4JMAA 1CK6A 2GB8A 1CYFA 4XV5A 2AS6A 2Y6BA 5SX2A 3FM1A 3HDLA 4BLZA 1JDRA 2BOQA 2Y6AA 1LGAA 1H5AA 1QPAA 3VLKA 2RBUX 4CVIA 4JPLA 5KSFA 1CCKA 2PCBA 5AOGA 5JHXA 4NVHB 1S6VA 1ARPA 5CIGA 4NVJB 5L02A 1BESA 1CCBA 5KQ3A 1S73A 5SXTA 2X07A 5KQIA 4FEFA 5SXWA 1CPFA 4JPTA 1OAFA 1B82A 5SYWA 2EUPA 4A71A 1AENA 4A7MA 1YZRA 2B10A 2EUTA 5SXSA 5EJTA 2YCGA 1B80A 2VNZX 1JCIA 2VCSA 2WD4A 4XV4A 2CL4X 2E39A 4A78A 5CIHA 3FM6A 4NVMB 2VO2X 1DSPA 5SYVA 1YYDA 1BVAA 5SX0B
chains in the Genus database with same CATH superfamily
1B85A 3UT5E 2D9DA 1BR2A 2AS1A 4PK4A 5AQLB 1SJ2A 4JI1T 3AECA 2GHKX 3RIAA 3ESLA 4AI6A 4NVKB 2XI6A 4C91A 4B3MT 2YKSA 1WRDA 2X0HA 4XBFB 5ALAA 3FZHB 5SXQA 5KMGP 2W67A 3P4WA 5KQKA 2IAKA 4QXBB 4UVAB 3UUNA 1T98A 5L3CB 1W0AA 4JLEA 4MLKA 4QH4A 2JQKA 3NRYA 2ZM6T 5LHGB 3CX8B 3G06A 4EV6A 2LRKA 5F3JA 1U5PA 4ISSA 3AE1A 3VKGA 4IL9A 5SXXA 2XQ5A 1FIOA 3RIWA 3TLUA 1KNRA 2KZ7B 2E9XA 4UXNB 2HH7A 2BVLA 5HXEA 4YJ3E 2FJEA 3CX7B 1AEEA 2LOPA 4CQIA 3ZYLA 3EXBA 1SDQA 3ZT7A 2OV9A 3HKBE 3E2OA 3EAMA 5L3DB 4TV9E 1MN1A 2LM2A 4HWHA 2KNDA 3CVRA 3L3PA 4AXPA 4F6RC 4CN6A 4L5GA 5CJHA 1EZ3A 3ONJA 2YK0A 2H88A 2VKJA 1AEMA 2WMOA 2DLRA 2Q9QD 2X67A 4FDQA 2EUSA 4MBQA 2JTIA 3J9X1 3ZMTB 1KRJA 3UUBA 4KX6A 2IMLA 2JQQA 1S35A 5ETWA 4X1KE 4KI0F 5L3EB 2ZOPA 3M29A 4NIQA 3RIVA 1I6ZA 5KDMC 2ICVA 3P4PA 1EBEA 2QYWA 2CMRA 5EZYE 5AQSB 3LBXA 5FXVA 2CHNA 4IDOA 3OTOT 2AS2A 2VNXX 5KX5E 3EDVA 3C64A 2XIHA 3RRWA 3I0OA 4ANJA 2N18A 1GW2A 3M8MA 3L39A 3N9PA 5FY1A 1HSRA 1GWOA 5JVDE 1LYKA 2WMNA 3M25A 3SFEA 2XASB 2RC0X 4ZXLA 3RYHE 3U3IA 2CEPA 4H63H 5CIBA 5SX1A 4PJLA 2XM1A 2ZM0A 3F31A 4H63V 1IBMT 2B12A 1AESA 3RC3A 3DJBA 3PJAJ 5C8YE 4JI8T 2XQAA 3M2CA 4HFBA 1CCEA 3FMUA 5ABFA 3RIUC 4ISTA 5SYKA 4HN9A 1HG5A 3NZQA 3FKGA 5L05A 4PFOA 3PTRB 1DCCA 4G05A 3MACA 2XQ7A 4MFRA 4DV0T 1QLBA 1H7CA 4EB6E 4JQJA 4ILCA 2GK9A 4DV6T 4LF4T 2YDRA 2OLTA 4HEAA 1GWTA 2NOXA 5L3FB 4EZHA 2VWAA 2IA8A 3N5LA 1YZPA 4IREA 3PUWF 3ZPOA 2G0UA 1ATJA 5AQUB 1XNRT 4NFGA 1CPGA 2D0TA 2WU5A 3MKDA 2RBXX 5F5WA 2CCQA 4NVCA 3WXOA 3KINB 2GHDX 3FZLB 3AEEA 1FHFA 4Z91A 1ARVA 3PV0F 5HEUA 1CCIA 1OAGA 3LJCA 5HCJA 4GKKT 2V7JA 1U2KA 5AQQB 2JMHA 3JC6D 2VKHA 4IE7A 4K0KT 3TLSA 3ZCHA 2D2SA 3OBVE 1R8IA 4UELA 5SYHA 4X1IE 2AS3A 4OYKA 4NXNT 4J2CA 1IBLT 5SYUA 3B13A 3JADA 5IWAT 1E1HB 2B1EA 4GIWA 4LF8T 7CCPA 4HKAA 1OEDC 2WZIA 5FY0A 4JI2T 3PUSA 3ANWB 1C8IA 4XV8A 3ATJA 4YXDA 2DNXA 4FI5A 5HEOA 2CRBA 5FMNA 1GZAA 3HR0A 3NVOA 4PFPA 3N9LA 1O3XA 3PJAA 2ANZA 2EUUA 1YD8G 2QGSA 1M7KA 4NVFA 3LK3B 5L2LA 4HWDA 3AEGA 2FBWA 4XVAA 3DP7A 4P0BA 5AQIB 1ZBZA 2H89A 1MMGA 4I50E 1KFYA 3ONXA 1J5ET 2CLYC 1BEMA 4DV1T 5KQ6A 2YDQA 3V5SA 5SYIA 3X1DA 4PAEA 5HCMA 1W9RA 3AVRA 2WCAA 5IHYA 2DI4A 1YQ3A 3LK42 1AETA 2CBJA 5C3JA 1Y01A 4BJMA 5AFUL 5DABA 1CK6A 4GOUA 5ABHA 5KXJA 1CYFA 1ABVA 2Y6BA 3C51A 5SX2A 3FM1A 3HDLA 4ZHQE 4M1PA 3RQUA 4IDPA 4GKFA 3CKDA 3RI5A 2XAFB 2QA7A 3P4RA 4A98A 4PW8A 3PURA 2Q9QC 5JR9A 1QPAA 4HFCA 3UFGA 4JPLA 4Q25A 4AQFC 1CCKA 5AQPB 5AOGA 2BS4A 1S6VA 4DR5T 1N34T 5CIGA 4NVJB 5L02A 4I4TE 4NUUA 1MIVA 1S73A 3AA1B 2V5CA 4LF9T 4JPTA 2X51A 1VRBA 5LJMA 2EUPA 2MTQA 1AENA 2BKPA 5EK3A 2B10A 4IIJE 4ILUA 1YW0A 3VKHA 4ASKA 1E2AA 2CL4X 2E39A 2BO5A 4A78A 2CXFA 3FM6A 2VO2X 4X64T 1FMWA 5AQOB 1DJ1A 4TNWA 2JIWA 3TKLB 1U74A 3ZC0A 1DJ5A 4KBMB 1V9DA 4JI3T 1BR0A 4UIGA 4AKLA 4C50A 2LM9A 3AA7B 4ZEYA 3CCXA 4DR6T 1LKXA 3S4UA 3V5UA 5A1LA 3VLJA 3UT2A 4O4HE 3EABA 2VVSA 3PUYF 2V6YB 4DR7T 5HAXA 2RPAA 2DL1A 4KMCA 1D1CA 2CWOA 3N2GE 4LMJA 2JRKA 1ITKA 1H5EA 1CCCA 4MHCA 4DUZT 3M23A 2E5VA 3RGLA 4G2AA 2UUCT 4EOZB 1HX1B 3QB5K 2W23A 4UF0B 3VLMA 1U4QA 2Y6XA 4JZAA 3UW8A 1ZOYA 2N9DA 3EUHA 5KQ0A 4DR4T 1VOMA 2BS2A 2KXPB 3CQCB 4HWIB 1LY9A 4ADZA 4FCSA 1CMUA 2YINA 2X08A 3UQ4A 1NENA 3PE0A 1VCSA 1CMPA 1UX5A 3AE8A 4CXYA 1KXMA 5CCPA 4GK0E 4KP3C 3OYXA 2WP9A 4H7AA 1AA4A 4P0AA 1AC4A 3A5XA 1H57A 2X9XA 4BM0A 2K5BB 3UFEA 3N9QA 5JREA 1PA2A 1H5MA 1UB2A 2V8SV 3JC6C 3QC9A 4X65T 3M5QA 4BM4A 3PU8A 2A9UA 2PBIA 2WSSV 2ZM8A 1KF6A 2X9YA 3UU4A 4QXCB 4DV7T 7ATJA 5SX6A 3P4SA 5DJQC 2W63A 4AKGA 5ABQA 4U33A 1AEBA 4BM1A 1SUMB 4I43B 1H58A 4H9PC 3EHZA 2N1GA 4I55E 3FXEB 2BG9E 3VRBA 1ARXA 4AKIA 2X66A 1A2FA 3CQXC 5AQHB 3O1JA 3RIFA 1SA0E 3TLVA 4X5TA 5LP6E 4OFZA 2VCFX 4DR3T 1CCPA 3M2GA 3M2EA 1XNQT 1CMTA 2UU9T 2M67A 5H9EB 2X9HA 6CCPA 2I6HA 5JDFA 3NKZA 2LE8A 5JPRA 2BKOA 3WAKA 4EYYR 3ZCGA 3A8YC 2I59A 1CCGA 1DSEA 2VKAA 4TWHA 4JV5T 2DWGA 3KV9A 2WB5A 3VLHA 3MA9A 5LCYA 3AE2A 3P4QA 4AQFA 2A72A 1KOKA 2IW5B 4IHJE 4I0UA 2J4GA 1Z53A 3Q5WA 1LLPA 2W66A 1B7TA 3AA0B 5SX0A 1QSDA 4A5XA 3A7MA 1HS7A 2CCDA 3KVBA 4A97A 3ZYMA 1BEKA 5HWYA 3P50A 5JHYA 2XAGB 3H3AA 3HKDE 3M28A 5ABEA 5JQGE 2ODVA 3AXJA 2XJ8A 1MIWA 3M2BA 1DSOA 1ML2A 4A5GA 2B11A 4PK6A 2EUOA 4IGUA 4HFDA 1HCHA 2JQ9A 2QVAA 3LBXB 2BG9A 2HHHT 4P09A 3CCPA 1H5IA 3WNUA 3HA4A 1U75A 3AEAA 4JM9A 3OPCA 3JAFA 1SCHA 5L4EA 4TWDA 2VQET 4ZI3D 2NTYA 2XSAA 1OXZA 3MJXA 3BQIA 4YHJA 5AQKB 1MKQA 4AIUA 4JI6T 3RYIE 1MN2A 2WWVA 4NXMT 3X16A 2W62A 2KINB 3OVUA 3B57A 5L47A 4DV3T 4BLNA 4QXHB 3AEFA 3OKQA 2UXNB 4YSYA 2C5JA 2XAQB 2XQ3A 5LG4A 4CXWA 4U7IA 1CPEA 2LSJA 4NVNB 2XTLA 3QB5A 1HX8A 1AEUA 2UXCT 1JNZA 3ZYKA 3P7IA 3M26A 5JH7E 2P9BA 3T8OA 3FBZA 4JMWA 1ZEEA 4CVJA 1WLXA 5FNVE 2DCFA 4YTMA 4HFEA 2C0SA 4KHZF 5FL0A 2RBYX 3VLLA 4TNVA 5FNEA 1JNRA 2JPFA 2XPKA 3KFWX 1WCRA 5AMMA 2XY8B 5LYJE 3Q5DA 2VKOA 3C4WA 2CXLA 5CIDA 2L9QA 2X68A 1XWMA 3N2OA 3VLIA 1ARUA 2BDEA 2QRXA 3CPZA 1UGOA 3ZJ1A 1CUNA 4DV2T 2EHOA 1CPDA 1NWMX 1ZV4X 5KQHA 4DNDA 1MNEA 5LGNB 1HNXT 4HFHA 4AKRB 2WZHA 1Z8UA 1RYCA 4UV8B 1HFAA 1W4YA 3IHRA 3SRZA 3I0QA 2CPTA 2VL0A 5HEHA 4CI1B 4O2AE 2N2NA 3PUXF 4LFBT 3T1YT 4EEBA 4JMSA 3QUJA 3Q3UA 1BGPA 2V6XA 2BBJA 3RX6A 3EI0A 1CCLA 1KXNA 2GB8A 1T72A 5DQVA 2WM9A 4XV5A 3PUZF 4CZZB 4JI5T 3ZCJA 5LHHB 4QX8B 3J7Yq 4U31A 5JDMA 1DU2A 5E0OA 1H5AA 4DMWA 1J1JA 3VLKA 2RBUX 3B5MA 5KSFA 1OWAA 5JHXA 4NVHB 4GYRA 1WFDA 4LMKA 4YHHT 3BQKA 2VB6A 1IBKT 2WAUA 4F8HA 3N9OA 1CPFA 2LRLA 3CMLA 5SYWA 2LJLA 3HKCE 4ZZBA 4YTNA 3AEBA 4AQYT 2VURA 1YZRA 1N36T 1B80A 4HE8A 2WD4A 3H3MA 1VCTA 2KLQA 2XAHB 2A3DA 2VVNA 1W0BA 3QNUA 5JDHA 1BVAA 2Y8DA 4UR9A 2WWUA 1YXRA 3AAEB 1SHZC 2CCAA 2CXDA 2XQYA 2BS3A 2RC2X 5EK4A 2UXDT 1U2LA 3NZPA 3C4XA 3FB2A 3I9WA 4P1NA 5DQWA 4CZQA 4QH1A 4NVDA 2KSRA 3KBUA 5EK2A 2GHEX 4OX9T 2JMXA 4COFA 3NRXA 4U74A 2HPJA 4JUYA 5ABOA 4H9NC 4P4QA 1V0HX 2WDVA 4HTEA 1Z0PA 4JM8A 1ZBYA 2JJ9A 1HTJF 5JR9B 3BK9A 4O4IE 4OYJA 1AEFA 2ZLYA 5C2TA 2HN1A 1CCAA 4B3TT 2WU2A 3RYFE 3M2DA 3OJAA 2C5KT 5CICA 1H5KA 3RC8A 3N9NA 5LNKA 3Q5EA 1AEOA 3LSVA 2IHR1 2EUNA 3UU6A 5AL9A 2E3AA 2ATJA 4BA9A 4KUMB 1US7B 4CN1A 1S94A 1LYCA 3UU5A 1YYGA 3CIRA 3UU3A 1H5CA 4ZI3C 4PAGA 4JYAT 2AQDA 3ZMZB 3Q9DA 3F2EA 3I1AA 2YU1A 4Z90A 1D0XA 3GA8A 3RYCE 5JDNA 2JQHA 4WBNE 2A2FX 5JQRA 1SBMA 4GYSA 4U7YA 1L0VA 2UUBT 3AE7A 4EXTA 2SPCA 5CJ5A 4DR1T 2OEBA 4JI0T 1XDOA 1AC8A 4USCA 2RBTX 4ZS2A 5FXXA 2WDRA 3IEEA 5AQGB 3NWIA 4X1YE 1UX4A 3AE6A 2KT9A 2E9XC 3RF1A 3LK2B 3VR8A 3KV5A 1IYNA 4JQNA 2LKHA 4DUYT 4X62T 2LOSA 3RIUA 1X9BA 5IUXA 5CD4J 4UVCB 2LLYA 2AE9A 2V23A 3HL6A 1HF8A 2V7LA 5JRCB 1H5DA 4WBOA 1BR1A 1OEDE 1MKRA 1NAFA 1BEPA 3ETVA 2VL8A 1GX2A 1BEJA 5SXRA 2NW8A 5AQVB 4FCNA 3M3ZB 5AQTB 2XIFA 1H3JA 3ZN0B 2LSIA 2NR4A 2ZM2A 3RLFF 3AEDA 1HNWT 3Q2MA 4YFSA 3DTOA 4G63A 3K1SA 2NP9A 3UQ7A 4A56A 1MMDA 4QX7B 5HEGA 2NWBA 3QK6A 4ZI7E 5SYXA 4E7SA 5AQFB 2IDOB 3K3OA 1ARWA 2HN2A 2XQ4A 1W4WA 2X0LB 4CN4A 4OQ7A 3KDSE 4EAHA 4B3RT 3ZMVB 1KK7A 2GHHX 4ERRA 5D6MA 1UK5A 5CIFA 3RHWA 4EYUA 5FL1A 5SW6A 2YLJA 3E2NA 4YJ2E 4NVEA 2VQFT 4JEHB 1H5HA 2VCNA 2BZBA 5JDLA 4NVIB 5JHZA 1UURA 3VHLA 4QWNB 3CQGB 2CCPA 2V6YA 3GN5A 2KWHA 3O9XA 3BQLA 2AS4A 5LB7B 4TN7B 4A6ZA 3QOFA 1OEDA 5SYYA 4BLLA 5JDQA 3HI2A 3X1LF 1MK8A 4CZPA 5LMUT 1ARYA 4CZRA 3ZJ2A 4JB4A 1AEJA 4UF0A 2HPLA 4XV7A 5KSKA 1GWUA 4BLYA 4NVAA 3R99A 4CXXA 4U72A 5BR8T 5J0ZA 3R6NA 2WS3A 2NW7A 4ZI2D 2ACZA 1CHUA 4HWFA 3O1IA 1WYBA 5FYMA 5FVLA 1FJGT 5CA1E 1X79A 2XJ5A 4LF7T 1AEDA 4AKHA 1U2JA 5CB4E 4X20E 2FJAA 4HGAA 5FNBA 4JN0A 2K9AA 4NVLA 3WI3A 4UV9B 4H9OC 5LGUB 1DSGA 2MAWA 4LMLA 4BAYB 2E9XB 4JMBA 2E8IA 3ZCYA 1J5WA 3FZMB 3KBTA 1A2GA 4TUYE 3AXJB 1N32T 5EJXA 1G8XA 5CIEA 3MXZA 1CMQA 4DV4T 3N2KE 4EGWA 3FXDB 3E08A 3FZKB 4JMTA 4O8SA 2Q9QA 5L3GB 2BG9B 4ILAA 3HKEE 4BM2A 2YDSA 2LHRA 3ZMUB 4H9QC 3K3QC 3TLTA 2WSSS 4ATJA 5LJNA 4JI7T 1BR4A 4JPUA 3O1HA 1N33T 2XHEB 2E5LT 4CZNA 4EEDA 2DWKA 4JM5A 4E7ZA 2RBVX 1H5FA 4LFAT 2W00A 4IE4A 4NPPA 4PJMA 5L3BB 5LG3A 2FJDA 3Q5XA 3IBPA 2PCCA 3PUGA 2XQ8A 4DR2T 1WR0A 4JMVA 5AQNB 3CK6A 4DBRA 2BBHA 4NVGB 1D0YA 5JTGA 4JMAA 1MIYA 2RP4A 2E2AA 1XMQT 4PK5A 1D1BA 3RRCA 3AE4A 1JDRA 1E7PA 2NW9A 2Y6AA 1LGAA 2XJ7A 2XQ6A 4QYZB 2W4XA 4L9IA 2PCBA 4C90A 1KNZA 1HR0T 4IT4A 1IAPA 4IDNA 1BESA 4CI2B 1T7SA 4PJNA 2H7VC 2W0GA 3ZT5A 4YSXA 3ZN1B 3WAJA 5AQJB 5SXTA 2X07A 3UUMA 5JDGA 3LDQB 5SXWA 1G73A 1OAFA 3NBXX 1B82A 2YU2A 4IE5A 4A71A 4X66T 4JI4T 2EUTA 1MNDA 2VNZX 3R84B 2L8KA 2E9XD 4IE0A 2EHOB 2MYSA 5ABFB 3N9MA 2Z6EA 4YSZA 1DSPA 5SYVA 4DBQA 2X9WA 1YYDA 4DMVA 4PNIA 1LY8A 3H37A 3R98A 1AEVA 5FXWA 2CE7A 2LSYA 3ZSTA 2W61A 2I0MA 4U2ZA 1MMNA 4NVOB 5HXHA 4H9SE 3M65A 4NUVA 5AQRB 4GEDA 5CA0E 2PFVA 5F8PA 5JR9C 1Y64B 2WBLA 4WZXA 4ZZCA 5SW4A 4QHOA 1YQ4A 2H7OA 3ZC1A 1XMOT 1YKHB 2RBWX 1BJ9A 2WDQA 2DHRA 4BLKA 1ZHCA 1IZNB 2LSKA 1H5LA 2WQYA 1SOGA 4TWFA 4WW0A 1H55A 4UVBB 2CA5A 4ILBA 2RBZX 3WA8A 4U7UB 1CCJA 1H5JA 2EUQA 1WR6A 3M27A 2XM2A 5FKYA 4TZ4C 5LHIB 3VR9A 4EIWA 5KQ2A 3MK7C 5H6QB 1APXA 3KV4A 3K8PC 4QKNA 4U2YA 2V1DB 3F57A 4H79A 4OHFA 4IDQA 3RH3A 4CCPA 1QO4A 2F4VT 1UUSA 2K48A 2Y48B 1AEQA 1AEHA 5LA6E 1QGJA 2PJQA 2V7IA 3M2IA 2EURA 5SX7A 4HWCA 2L3LA 4LF5T 1ZKEA 2XJ6A 2LHNA 2CWYA 3SS1A 3M2FA 1AEGA 2NTXA 2AXDS 2CBIA 3ZEFB 4XZCA 4O4LE 4ZI2C 5H9FB 2JMKA 3CX6B 4GKJT 1WYCA 3RPUA 5CGMA 2EHOD 2B76A 5HXSA 4B6XA 2R6GF 3L09A 2PTFA 5ABGA 1XDPA 4YTPA 1NEKA 1KEYA 1LVFA 3UUXB 3CWZB 3PUAA 1AJ3A 2A7UB 3EDUA 3UULA 2YEVC 5FXZA 2X0YA 5SW5A 3SWHA 2V7MA 5LGTB 5J1GA 4BLXA 3C50A 4O2BE 3M2HA 2W2UA 4N78D 3C98B 4CI3B 3E0ZA 4UEMA 2CEAA 2MPKA 1AEKA 1D0ZA 5SYLA 2IUBA 3AE9A 5CFBA 1STQA 2OA5A 3E22E 4JMZA 1D1AA 2V2EA 2V5DA 3AVSA 2XSBA 4XAXB 4HFIA 1YKEB 2KMFA 4YT0A 1I94T 3L8RA 3PU3A 3ZCIA 1IJ6A 3LFMA 3ZKRA 5J2TE 4MALA 3IF8B 5SYJA 3C4ZA 4U3CA 3ONLC 4BM3A 3M2AA 5ADXL 3ANWA 2RA1A 2E3BA 1GZBA 2FUPA 3U78A 4L0RA 1ZP0A 4GK5E 4AISA 4JBWF 4ZS3A 4LF6T 4H9RC 4JQMA 4JM6A 2UXBT 3VRAA 1H5GA 3P8CD 3MZKB 3AE5A 2VKDA 1KNPA 2WY2A 1HCIA 3IA3A 4Z8XA 2RC1X 2XILA 3K3NA 3KV6A 4AQGA 3D0TA 2ES0A 2V7KA 4ZOLE 3AAAB 3LG7A 4JEUB 5LBMA 1T8BA 5J2UE 5IYZE 1HNZT 2XUEA 5SX3A 3PDYA 2J47A 1XZYA 3JAEA 1KZMA 2UXXB 3ZT6A 2B0ZA 3RQWA 4CZOA 3AE3A 3ETUA 5HYAA 3FM4A 2BVMA 6ATJA 4CUOA 4HFVA 2K3WA 4OK0A 1MNPA 5GONE 3ZLIA 3TLWA 4YLHA 2CYPA 4XV6A 2XAJB 2IC9A 4CCXA 3FJWA 4C51A 5BMVE 2LSGA 5HEJA 2BG9C 3UU8A 4IL4A 5FY7A 2D0UA 5ABNA 4PJJA 3RKGA 3O4XE 5AQMB 3FHNA 2KWIB 3UTKA 4YY3T 2M6BA 1GQEA 4KHPT 1SE7A 2ODUA 2Y5AA 4O4JE 2V26A 2XZEA 5LOVE 3ABVA 2YOEA 4IE6A 2BCNA 5LXTE 1MMAA 2LT3A 4TV8E 5FVKA 5TAOA 2VK9A 2ZMAA 3PUQA 5FP3A 3GMIA 2MOZA 3GN5B 4JQKA 4DV5T 2UUAT 1IJ5A 3T1HT 4EZ4A 1OEDB 5HXCA 5L86A 3SOLA 1DS4A 5JRCA 2CM0A 2H3RA 2LKGA 1LRZA 5H6RB 4WNKA 2PG8A 3PUVF 3EVYA 4BJNA 2IIUA 2GGNX 2IC6A 3KVAA 5L4HA 1QUUA 3I9YA 2GHCX 2XQ9A 4B3ST 4NVBA 1M62A 1BEQA 3JCFA 2LEHA 4IDZA 2AS6A 5LBQB 3AAIA 4FJOA 2D5UA 4K0UA 3W15B 4BLZA 2ACXA 3SFDA 2CLYB 1LVKA 4LFCT 2BKNA 2BOQA 5HXRA 1FMVA 3ZMSB 4CVIA 2EHOC 4DVDA 4DO0A 4WYVA 1HG2A 2YN6A 3VU7H 1ARPA 3FZFB 4QH5A 3AA6B 3ZSSA 1CCBA 5KQ3A 5HWXA 5LMNT 1FEWA 5KQIA 4FEFA 2J62A 4TX5A 1W09A 3GWHA 3OYZA 3AB3B 4A7MA 4V1Av 2Q9QB 5SXSA 5EJTA 2YCGA 1UCUA 1JCIA 2J1DG 2MBGA 2VCSA 3FBLA 2VASA 2ZCAA 2FJBA 5M4YA 4XV4A 2C5IT 2CHOA 5CIHA 2M6IA 3RKOA 4NVMB 2K24A 4DIDB 5SX0B
chains in the Genus database with same CATH topology
4PNIA 2Y8DA 1LY8A 3H37A 3R98A 1AEVA 5FXWA 2CE7A 2LSYA 3ZC0A 1DJ1A 2W61A 1B85A 2WWUA 3AAEB 3UT5E 3TKLB 1SHZC 2CCAA 1MMNA 1U74A 1BR2A 2CXDA 2AS1A 2RC2X 4NVOB 2XQYA 3M65A 4H9SE 4NUVA 5HXHA 4PK4A 1DJ5A 1SJ2A 4KBMB 4GEDA 1V9DA 2GHKX 5CA0E 2PFVA 1BR0A 5F8PA 3ESLA 4UIGA 5EK4A 4AKLA 5JR9C 1U2LA 1Y64B 3C4XA 2WBLA 4NVKB 3FB2A 3I9WA 4C50A 2LM9A 2XI6A 5SW4A 3AA7B 4QHOA 4CZQA 2H7OA 5DQWA 3CCXA 4C91A 1LKXA 4NVDA 3ZC1A 3S4UA 3V5UA 3KBUA 1WRDA 5A1LA 5EK2A 2GHEX 4XBFB 5ALAA 1YKHB 5SXQA 3VLJA 2RBWX 3UT2A 4O4HE 3NRXA 1BJ9A 5KMGP 4U74A 2HPJA 5KQKA 2DHRA 4JUYA 2IAKA 4KMCA 4QXBB 5HAXA 4UVAB 1D1CA 4BLKA 5ABOA 2CWOA 4H9NC 3UUNA 1ZHCA 1T98A 3N2GE 5L3CB 4JLEA 1IZNB 2JRKA 1ITKA 4MLKA 2LSKA 1H5EA 1H5LA 4P4QA 1SOGA 4WW0A 1V0HX 1H55A 4HTEA 3NRYA 4UVBB 1CCCA 4MHCA 1Z0PA 4JM8A 5LHGB 1ZBYA 2JJ9A 2CA5A 1HTJF 5JR9B 3M23A 3CX8B 2RBZX 3BK9A 4G2AA 4O4IE 3WA8A 4U7UB 1U5PA 1CCJA 4ISSA 4EOZB 5F3JA 1H5JA 4OYJA 1AEFA 2EUQA 3VKGA 2ZLYA 1WR6A 3M27A 5SXXA 2W23A 4UF0B 3NZPA 3VLMA 1U4QA 1CCAA 4TZ4C 2Y6XA 1FIOA 5LHIB 4JZAA 3RIWA 3RYFE 3M2DA 3UW8A 4EIWA 5KQ2A 2N9DA 3OJAA 3EUHA 2C5KT 2KZ7B 3MK7C 5CICA 5H6QB 2E9XA 1APXA 1H5KA 4UXNB 3KV4A 3RC8A 5KQ0A 3N9NA 5LNKA 2HH7A 2BVLA 3K8PC 4QKNA 1AEOA 1VOMA 2V1DB 2KXPB 5HXEA 3CQCB 3F57A 1LY9A 2EUNA 4FCSA 4H79A 1CMUA 5AL9A 2E3AA 2ATJA 4OHFA 4YJ3E 4BA9A 3CX7B 1AEEA 4KUMB 2LOPA 1US7B 4CCPA 2YINA 3RH3A 1QO4A 3ZYLA 3EXBA 4CQIA 1SDQA 1S94A 1LYCA 2X08A 2K48A 2Y48B 3HKBE 1YYGA 1AEQA 3E2OA 3PE0A 1AEHA 5LA6E 1CMPA 1QGJA 1UX5A 2PJQA 1H5CA 5L3DB 4ZI3C 4CXYA 4PAGA 1KXMA 5CCPA 2V7IA 4GK0E 3OYXA 4KP3C 3M2IA 2AQDA 3ZMZB 3Q9DA 2EURA 5SX7A 3F2EA 2L3LA 4TV9E 1MN1A 2YU1A 1ZKEA 2XJ6A 3I1AA 1D0XA 2KNDA 2LHNA 3GA8A 3RYCE 3CVRA 4H7AA 3L3PA 1AA4A 2CWYA 4AXPA 1AC4A 3SS1A 4F6RC 5JDNA 3M2FA 4L5GA 4P0AA 5CJHA 1AEGA 2A2FX 2NTXA 3A5XA 4WBNE 1EZ3A 1H57A 5JQRA 1SBMA 2X9XA 2YK0A 2VKJA 4BM0A 4GYSA 2K5BB 3ZEFB 1AEMA 3UFEA 3N9QA 4XZCA 4O4LE 5JREA 4ZI2C 2WMOA 2DLRA 2Q9QD 1PA2A 5H9FB 2JMKA 2SPCA 2X67A 3CX6B 1H5MA 1UB2A 4FDQA 4EXTA 3JC6C 2EUSA 3QC9A 3M5QA 4BM4A 1AC8A 1WYCA 3PU8A 4MBQA 3RPUA 2JTIA 2PBIA 2EHOD 2WSSV 2ZM8A 4USCA 3J9X1 3ZMTB 2RBTX 4ZS2A 1KRJA 5FXXA 2X9YA 5HXSA 4QXCB 3IEEA 4B6XA 7ATJA 5SX6A 5DJQC 3L09A 4X1YE 1UX4A 2W63A 5ABQA 2JQQA 4AKGA 1AEBA 4BM1A 1S35A 2E9XC 2KT9A 4I43B 3LK2B 4X1KE 5ETWA 5L3EB 1H58A 3M29A 4H9PC 3KV5A 2N1GA 1IYNA 3RIVA 4JQNA 5KDMC 2ICVA 4I55E 1LVFA 1EBEA 2LOSA 3FXEB 3UUXB 3CWZB 2CMRA 5EZYE 3PUAA 5CD4J 3LBXA 1ARXA 4UVCB 4AKIA 2X66A 5FXVA 1AJ3A 1A2FA 2V23A 3CQXC 3HL6A 3O1JA 1HF8A 2V7LA 1SA0E 5JRCB 3EDUA 3UULA 1H5DA 2YEVC 4WBOA 5FXZA 2AS2A 4OFZA 2VNXX 5LP6E 1BR1A 2VCFX 5SW5A 1CCPA 3M2GA 3M2EA 5KX5E 1CMTA 3SWHA 3EDVA 2M67A 1MKRA 5H9EB 1NAFA 1BEPA 2X9HA 2V7MA 3C64A 3ETVA 5J1GA 2XIHA 3RRWA 3I0OA 4BLXA 2VL8A 1GX2A 4ANJA 2N18A 1BEJA 6CCPA 1GW2A 5SXRA 2NW8A 3M8MA 4FCNA 3C50A 5JDFA 2XIFA 4O2BE 1H3JA 3M2HA 3N9PA 2LE8A 4N78D 5FY1A 3ZN0B 5JPRA 2LSIA 2ZM2A 1HSRA 1GWOA 5JVDE 1LYKA 3C98B 3WAKA 2WMNA 4CI3B 4EYYR 3M25A 3ZCGA 3Q2MA 3E0ZA 2I59A 1CCGA 4YFSA 3DTOA 4UEMA 2XASB 2CEAA 4G63A 1DSEA 2RC0X 2VKAA 2NP9A 1AEKA 1D0ZA 5SYLA 4A56A 1MMDA 2DWGA 3RYHE 1STQA 3U3IA 2CEPA 4QX7B 4H63H 3KV9A 2OA5A 5CIBA 5SX1A 2NWBA 4PJLA 3QK6A 2ZM0A 3E22E 3F31A 4ZI7E 5SYXA 4H63V 4E7SA 2B12A 1AESA 4JMZA 1D1AA 3K3OA 2V2EA 3RC3A 3VLHA 1ARWA 3MA9A 3AVSA 5LCYA 1W4WA 2X0LB 3DJBA 5ADXL 4XAXB 5C8YE 1YKEB 4OQ7A 4AQFA 2A72A 1KOKA 2IW5B 3M2CA 2KMFA 4IHJE 1CCEA 3FMUA 1Z53A 3Q5WA 4ISTA 1LLPA 3ZLIA 1B7TA 3AA0B 5SYKA 3PU3A 1HG5A 4HN9A 3ZCIA 3NZQA 5SX0A 1IJ6A 1QSDA 3LFMA 3KDSE 4EAHA 3ZMVB 5J2TE 4MALA 1HS7A 2CCDA 2GHHX 3FKGA 5L05A 1KK7A 3KVBA 3IF8B 5SYJA 5D6MA 4ERRA 4PFOA 3ZYMA 1BEKA 3C4ZA 3PTRB 5CIFA 5HWYA 4EYUA 4BM3A 3M2AA 1DCCA 4G05A 5SW6A 5JHYA 2XAGB 3H3AA 3HKDE 3M28A 3MACA 5JQGE 2YLJA 3ANWA 2RA1A 4MFRA 2E3BA 3E2NA 1H7CA 1GZBA 4EB6E 4NVEA 4YJ2E 2ODVA 4JQJA 2XJ8A 1MIWA 3U78A 3M2BA 2GK9A 4L0RA 4JEHB 4GK5E 1DSOA 1ML2A 4A5GA 2B11A 4HEAA 1GWTA 1H5HA 2EUOA 4PK6A 2VCNA 4IGUA 2NOXA 4ZS3A 5L3FB 2BZBA 1HCHA 4H9RC 4EZHA 5JDLA 4JQMA 4NVIB 4JM6A 5JHZA 2VWAA 2IA8A 3N5LA 3VHLA 4QWNB 1YZPA 1H5GA 3LBXB 3CQGB 3P8CD 3MZKB 2CCPA 3GN5A 4P09A 3ZPOA 2KWHA 3CCPA 1H5IA 2VKDA 3WNUA 3O9XA 3HA4A 2G0UA 3BQLA 1ATJA 2AS4A 1U75A 4JM9A 4NFGA 1CPGA 4TN7B 2D0TA 1HCIA 4A6ZA 4Z8XA 4TV8E 1SCHA 2RC1X 3MKDA 5SYYA 2XILA 2RBXX 4BLLA 5JDQA 3HI2A 3K3NA 3KV6A 4AQGA 4AI6A 2CCQA 2NTYA 4ZI3D 4NVCA 3D0TA 3WXOA 2ES0A 2GHDX 2V7KA 3KINB 4ZOLE 1MK8A 3AAAB 1OXZA 3LG7A 4CZPA 4JEUB 5LBMA 3MJXA 5J2UE 3BQIA 1FHFA 4YHJA 1ARYA 4CZRA 5IYZE 1MKQA 4JB4A 3ZJ2A 1AEJA 1ARVA 2XUEA 5SX3A 4UF0A 1CCIA 1MN2A 1OAGA 3RYIE 3PDYA 2HPLA 4XV7A 5KSKA 3X16A 3LJCA 1KZMA 1GWUA 4BLYA 4NVAA 3R99A 2UXXB 2W62A 4U72A 4CXXA 2KINB 2B0ZA 3B57A 3R6NA 2V7JA 4BLNA 4CZOA 4QXHB 2NW7A 3ETUA 1U2KA 2UXNB 3OKQA 5FP3A 4ZI2D 5HYAA 3O1IA 3FM4A 2BVMA 1WYBA 2JMHA 3JC6D 2C5JA 2VKHA 2XAQB 4IE7A 5LG4A 6ATJA 4CUOA 4HFVA 5FYMA 4CXWA 4OK0A 5CA1E 1CPEA 1MNPA 2XJ5A 3ZCHA 1X79A 2D2SA 2LSJA 1AEDA 3OBVE 4NVNB 2XTLA 4UELA 1HX8A 4AKHA 1AEUA 5SYHA 4YLHA 4X1IE 1U2JA 2AS3A 2CYPA 4XV6A 4OYKA 4X20E 2XAJB 5CB4E 4HGAA 5FNBA 4JN0A 4CCXA 2IC9A 2K9AA 4NVLA 3FJWA 4J2CA 4C51A 3WI3A 5BMVE 5SYUA 3B13A 4UV9B 3ZYKA 2LSGA 3P7IA 4H9OC 5LGUB 1DSGA 3M26A 5JH7E 1E1HB 2P9BA 3T8OA 4BAYB 3FBZA 4JMWA 2E9XB 1ZEEA 4CVJA 1WLXA 5ABNA 2B1EA 2D0UA 4JMBA 4PJJA 5FNVE 5FY7A 4GIWA 2DCFA 3ZCYA 2E8IA 3O4XE 2C0SA 3FHNA 2KWIB 7CCPA 3UTKA 3KBTA 2RBYX 4HKAA 5FY0A 3VLLA 3PUSA 2ODUA 3ANWB 5L3GB 1C8IA 5FNEA 2Y5AA 1A2GA 4O4JE 2V26A 5LOVE 2JPFA 4TUYE 4XV8A 3ATJA 3KFWX 5LGTB 5EJXA 1G8XA 5CIEA 5AMMA 3MXZA 2DNXA 4IE6A 4FI5A 2BCNA 5LXTE 1MMAA 1CMQA 5LYJE 2LT3A 1GZAA 2VKOA 3C4WA 2CXLA 3FXDB 3HR0A 3N2KE 5CIDA 3E08A 2L9QA 4JMTA 2X68A 4PFPA 5TAOA 3N9LA 2VK9A 1O3XA 4O8SA 2Q9QA 3N2OA 2ANZA 2ZMAA 3VLIA 1ARUA 2BDEA 2EUUA 1YD8G 2QGSA 3CPZA 3GMIA 3PUQA 4NVFA 2MOZA 3GN5B 4JQKA 3LK3B 3ZJ1A 5L2LA 1CUNA 2EHOA 1CPDA 1NWMX 1ZV4X 5KQHA 3HKEE 4BM2A 1IJ5A 4DNDA 4EZ4A 1MNEA 2LHRA 3ZMUB 4H9QC 5LGNB 3K3QC 4ADZA 4XVAA 3DP7A 5HXCA 4P0BA 4ATJA 5LJNA 1BR4A 4AKRB 4JPUA 5L86A 1ZBZA 3O1HA 2XHEB 1RYCA 4UV8B 3SOLA 4CZNA 1DS4A 1MMGA 2CM0A 2H3RA 1HFAA 2DWKA 4I50E 1W4YA 5JRCA 3IHRA 4JM5A 1LRZA 3ONXA 3SRZA 4E7ZA 2RBVX 2CLYC 1BEMA 3I0QA 5H6RB 4CI1B 4O2AE 4WNKA 5LHHB 5KQ6A 2PG8A 3EVYA 4BJNA 1H5FA 2N2NA 3V5SA 5SYIA 2GGNX 4PAEA 2W00A 4IE4A 4PJMA 4JMSA 3AVRA 3QUJA 5L3BB 2IC6A 3Q3UA 3KVAA 5IHYA 5GONE 1BGPA 1QUUA 3Q5XA 2DI4A 2GHCX 3I9YA 3IBPA 3LK42 2PCCA 1AETA 3PUGA 4NVBA 3RX6A 4JMVA 1BEQA 1CCLA 4DBRA 4BJMA 4NVGB 1D0YA 1KXNA 4JMAA 2LEHA 5AFUL 5DABA 1CK6A 4GOUA 2GB8A 4IDZA 5DQVA 1MIYA 2WM9A 2RP4A 1CYFA 4XV5A 2AS6A 4CZZB 5LBQB 3AAIA 2Y6BA 2D5UA 4FJOA 4K0UA 3W15B 3ZCJA 3C51A 5SX2A 3FM1A 3HDLA 4BLZA 4M1PA 4PK5A 1D1BA 2ACXA 3CKDA 3RRCA 4ZHQE 2CLYB 1JDRA 1LVKA 2QA7A 2XAFB 4QX8B 2BOQA 3J7Yq 5HXRA 1FMVA 3ZMSB 2NW9A 4PW8A 2Y6AA 1LGAA 3PURA 2Q9QC 5E0OA 1H5AA 5JR9A 5JDMA 4DMWA 1QPAA 3VLKA 2RBUX 4CVIA 4JPLA 4QYZB 5KSFA 4AQFC 1CCKA 4L9IA 1OWAA 2PCBA 2EHOC 4DVDA 5AOGA 4C90A 4DO0A 5JHXA 4NVHB 4GYRA 1HG2A 1S6VA 3VU7H 1KNZA 1ARPA 5CIGA 4NVJB 5L02A 1IAPA 4I4TE 4NUUA 1BESA 1MIVA 3AA6B 4CI2B 4PJNA 2H7VC 2W0GA 3WAJA 3BQKA 3ZN1B 1CCBA 5KQ3A 2VB6A 5HWXA 1S73A 5SXTA 2X07A 5KQIA 1FEWA 4FEFA 3AA1B 2WAUA 3UUMA 5JDGA 5SXWA 3N9OA 1CPFA 4JPTA 1G73A 4TX5A 1OAFA 2X51A 3CMLA 3NBXX 4DMVA 1B82A 1VRBA 2YU2A 4IE5A 5LJMA 5SYWA 2EUPA 2LJLA 2MTQA 3GWHA 4A71A 3HKCE 1AENA 3OYZA 3AB3B 5FMNA 4A7MA 5EK3A 4V1Av 1YZRA 2B10A 2EUTA 5SXSA 5EJTA 2YCGA 1MNDA 1B80A 2VNZX 1UCUA 2Q9QB 4IIJE 1JCIA 4ILUA 2J1DG 1YW0A 2MBGA 3R84B 4HE8A 2L8KA 2VCSA 3FBLA 2E9XD 2VASA 4IE0A 3VKHA 2ZCAA 2WD4A 2EHOB 4ASKA 2MYSA 2KLQA 2XAHB 2A3DA 5M4YA 4XV4A 2CL4X 2C5IT 2E39A 4A78A 2CXFA 5CIHA 3N9MA 3FM6A 4NVMB 2VO2X 2Z6EA 3RKOA 1FMWA 1DSPA 5SYVA 2K24A 4DBQA 2X9WA 1YYDA 5JDHA 1BVAA 5SX0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LY8 A;  3R98 A;  1AEV A;  1DJ1 A;  1B85 A;  2CCA A;  1U74 A;  2AS1 A;  2RC2 X;  4NVO B;  1DJ5 A;  1SJ2 A;  4GED A;  2GHK X;  1U2L A;  4NVK B;  4C50 A;  2XI6 A;  5SW4 A;  4CZQ A;  3CCX A;  4NVD A;  2GHE X;  5ALA A;  5SXQ A;  3VLJ A;  2RBW X;  3UT2 A;  1BJ9 A;  5KQK A;  4BLK A;  5ABO A;  1ITK A;  1H5E A;  1H5L A;  4P4Q A;  1SOG A;  1V0H X;  1H55 A;  1CCC A;  4JM8 A;  1ZBY A;  3M23 A;  2RBZ X;  1CCJ A;  1H5J A;  1AEF A;  2EUQ A;  3M27 A;  5SXX A;  2W23 A;  3VLM A;  1CCA A;  3RIW A;  3M2D A;  3UW8 A;  5KQ2 A;  5CIC A;  1APX A;  1H5K A;  5KQ0 A;  1AEO A;  1LY9 A;  2EUN A;  4FCS A;  1CMU A;  5AL9 A;  2E3A A;  2ATJ A;  1AEE A;  4CCP A;  1QO4 A;  3EXB A;  1SDQ A;  1LYC A;  2X08 A;  1YYG A;  1AEQ A;  3E2O A;  1AEH A;  1CMP A;  1QGJ A;  1H5C A;  1KXM A;  5CCP A;  3M2I A;  2AQD A;  2EUR A;  5SX7 A;  1MN1 A;  2XJ6 A;  1AA4 A;  1AC4 A;  3M2F A;  5CJH A;  1AEG A;  1H57 A;  5JQR A;  1SBM A;  4BM0 A;  1AEM A;  1PA2 A;  1H5M A;  1UB2 A;  4FDQ A;  2EUS A;  3M5Q A;  4BM4 A;  1AC8 A;  2JTI A;  4USC A;  2RBT X;  1KRJ A;  7ATJ A;  5SX6 A;  5ABQ A;  1AEB A;  4BM1 A;  1H58 A;  3M29 A;  1IYN A;  3RIV A;  4JQN A;  2ICV A;  1EBE A;  1ARX A;  1A2F A;  2V23 A;  1H5D A;  2AS2 A;  2VNX X;  2VCF X;  5SW5 A;  1CCP A;  3M2G A;  3M2E A;  1CMT A;  1MKR A;  1BEP A;  2XIH A;  3RRW A;  4BLX A;  1GX2 A;  2N18 A;  1BEJ A;  6CCP A;  1GW2 A;  5SXR A;  3M8M A;  4FCN A;  2XIF A;  1H3J A;  3M2H A;  5JPR A;  1HSR A;  1GWO A;  1LYK A;  3M25 A;  3ZCG A;  1CCG A;  1DSE A;  2RC0 X;  2VKA A;  1AEK A;  5SYL A;  1STQ A;  2CEP A;  5CIB A;  5SX1 A;  5SYX A;  2B12 A;  1AES A;  4JMZ A;  2V2E A;  3VLH A;  1ARW A;  1W4W A;  4OQ7 A;  1KOK A;  3M2C A;  1CCE A;  3FMU A;  1Z53 A;  1LLP A;  5SYK A;  5SX0 A;  2CCD A;  2GHH X;  3FKG A;  5L05 A;  5SYJ A;  5D6M A;  1BEK A;  5CIF A;  4BM3 A;  3M2A A;  1DCC A;  4G05 A;  5SW6 A;  5JHY A;  3M28 A;  2YLJ A;  2E3B A;  3E2N A;  1GZB A;  4NVE A;  4JQJ A;  2XJ8 A;  3M2B A;  1DSO A;  1ML2 A;  4A5G A;  2B11 A;  1GWT A;  1H5H A;  2EUO A;  2VCN A;  1HCH A;  4JQM A;  4NVI B;  4JM6 A;  5JHZ A;  2IA8 A;  1YZP A;  1H5G A;  2CCP A;  3CCP A;  1H5I A;  3WNU A;  1ATJ A;  2AS4 A;  1U75 A;  4JM9 A;  4NFG A;  1CPG A;  4A6Z A;  1SCH A;  2RC1 X;  5SYY A;  2XIL A;  2RBX X;  4BLL A;  4NVC A;  3WXO A;  2GHD X;  1MK8 A;  4CZP A;  1FHF A;  1ARY A;  4CZR A;  1MKQ A;  4JB4 A;  1AEJ A;  1ARV A;  5SX3 A;  1CCI A;  1MN2 A;  1OAG A;  4XV7 A;  5KSK A;  3X16 A;  1KZM A;  1GWU A;  4BLY A;  4NVA A;  3R99 A;  2B0Z A;  4BLN A;  4CZO A;  1U2K A;  3FM4 A;  6ATJ A;  4CUO A;  1CPE A;  1MNP A;  2XJ5 A;  3ZCH A;  1AED A;  4NVN B;  1AEU A;  5SYH A;  1U2J A;  2AS3 A;  2CYP A;  4XV6 A;  5FNB A;  4JN0 A;  4CCX A;  4NVL A;  3FJW A;  4C51 A;  5SYU A;  1DSG A;  3M26 A;  4JMW A;  4CVJ A;  5ABN A;  4JMB A;  3ZCY A;  7CCP A;  2RBY X;  3VLL A;  1C8I A;  5FNE A;  2Y5A A;  1A2G A;  4XV8 A;  3ATJ A;  5EJX A;  5CIE A;  5AMM A;  2BCN A;  1CMQ A;  1GZA A;  5CID A;  4JMT A;  2ANZ A;  3VLI A;  1ARU A;  2EUU A;  4NVF A;  4JQK A;  1CPD A;  5KQH A;  4BM2 A;  4XVA A;  4ATJ A;  4JPU A;  5L86 A;  1ZBZ A;  1RYC A;  4CZN A;  1DS4 A;  1W4Y A;  4JM5 A;  2RBV X;  1BEM A;  5KQ6 A;  1H5F A;  5SYI A;  2GGN X;  4PAE A;  4JMS A;  3Q3U A;  1BGP A;  2GHC X;  2PCC A;  1AET A;  4NVB A;  4JMV A;  1BEQ A;  1CCL A;  4NVG B;  1KXN A;  4JMA A;  1CK6 A;  2GB8 A;  1CYF A;  4XV5 A;  2AS6 A;  2Y6B A;  5SX2 A;  3FM1 A;  3HDL A;  4BLZ A;  1JDR A;  2BOQ A;  2Y6A A;  1LGA A;  1H5A A;  1QPA A;  3VLK A;  2RBU X;  4CVI A;  4JPL A;  5KSF A;  1CCK A;  2PCB A;  5AOG A;  5JHX A;  4NVH B;  1S6V A;  1ARP A;  5CIG A;  4NVJ B;  5L02 A;  1BES A;  1CCB A;  5KQ3 A;  1S73 A;  5SXT A;  2X07 A;  5KQI A;  4FEF A;  5SXW A;  1CPF A;  4JPT A;  1OAF A;  1B82 A;  5SYW A;  2EUP A;  4A71 A;  1AEN A;  4A7M A;  1YZR A;  2B10 A;  2EUT A;  5SXS A;  5EJT A;  2YCG A;  1B80 A;  2VNZ X;  1JCI A;  2VCS A;  2WD4 A;  4XV4 A;  2CL4 X;  2E39 A;  4A78 A;  5CIH A;  3FM6 A;  4NVM B;  2VO2 X;  1DSP A;  5SYV A;  1YYD A;  1BVA A;  5SX0 B; 
#chains in the Genus database with same CATH topology
 1B85 A;  3UT5 E;  2D9D A;  1BR2 A;  2AS1 A;  4PK4 A;  5AQL B;  1SJ2 A;  4JI1 T;  3AEC A;  2GHK X;  3RIA A;  3ESL A;  4AI6 A;  4NVK B;  2XI6 A;  4C91 A;  4B3M T;  2YKS A;  1WRD A;  2X0H A;  4XBF B;  5ALA A;  3FZH B;  5SXQ A;  5KMG P;  2W67 A;  3P4W A;  5KQK A;  2IAK A;  4QXB B;  4UVA B;  3UUN A;  1T98 A;  5L3C B;  1W0A A;  4JLE A;  4MLK A;  4QH4 A;  2JQK A;  3NRY A;  2ZM6 T;  5LHG B;  3CX8 B;  3G06 A;  4EV6 A;  2LRK A;  5F3J A;  1U5P A;  4ISS A;  3AE1 A;  3VKG A;  4IL9 A;  5SXX A;  2XQ5 A;  1FIO A;  3RIW A;  3TLU A;  1KNR A;  2KZ7 B;  2E9X A;  4UXN B;  2HH7 A;  2BVL A;  5HXE A;  4YJ3 E;  2FJE A;  3CX7 B;  1AEE A;  2LOP A;  4CQI A;  3ZYL A;  3EXB A;  1SDQ A;  3ZT7 A;  2OV9 A;  3HKB E;  3E2O A;  3EAM A;  5L3D B;  4TV9 E;  1MN1 A;  2LM2 A;  4HWH A;  2KND A;  3CVR A;  3L3P A;  4AXP A;  4F6R C;  4CN6 A;  4L5G A;  5CJH A;  1EZ3 A;  3ONJ A;  2YK0 A;  2H88 A;  2VKJ A;  1AEM A;  2WMO A;  2DLR A;  2Q9Q D;  2X67 A;  4FDQ A;  2EUS A;  4MBQ A;  2JTI A;  3J9X 1;  3ZMT B;  1KRJ A;  3UUB A;  4KX6 A;  2IML A;  2JQQ A;  1S35 A;  5ETW A;  4X1K E;  4KI0 F;  5L3E B;  2ZOP A;  3M29 A;  4NIQ A;  3RIV A;  1I6Z A;  5KDM C;  2ICV A;  3P4P A;  1EBE A;  2QYW A;  2CMR A;  5EZY E;  5AQS B;  3LBX A;  5FXV A;  2CHN A;  4IDO A;  3OTO T;  2AS2 A;  2VNX X;  5KX5 E;  3EDV A;  3C64 A;  2XIH A;  3RRW A;  3I0O A;  4ANJ A;  2N18 A;  1GW2 A;  3M8M A;  3L39 A;  3N9P A;  5FY1 A;  1HSR A;  1GWO A;  5JVD E;  1LYK A;  2WMN A;  3M25 A;  3SFE A;  2XAS B;  2RC0 X;  4ZXL A;  3RYH E;  3U3I A;  2CEP A;  4H63 H;  5CIB A;  5SX1 A;  4PJL A;  2XM1 A;  2ZM0 A;  3F31 A;  4H63 V;  1IBM T;  2B12 A;  1AES A;  3RC3 A;  3DJB A;  3PJA J;  5C8Y E;  4JI8 T;  2XQA A;  3M2C A;  4HFB A;  1CCE A;  3FMU A;  5ABF A;  3RIU C;  4IST A;  5SYK A;  4HN9 A;  1HG5 A;  3NZQ A;  3FKG A;  5L05 A;  4PFO A;  3PTR B;  1DCC A;  4G05 A;  3MAC A;  2XQ7 A;  4MFR A;  4DV0 T;  1QLB A;  1H7C A;  4EB6 E;  4JQJ A;  4ILC A;  2GK9 A;  4DV6 T;  4LF4 T;  2YDR A;  2OLT A;  4HEA A;  1GWT A;  2NOX A;  5L3F B;  4EZH A;  2VWA A;  2IA8 A;  3N5L A;  1YZP A;  4IRE A;  3PUW F;  3ZPO A;  2G0U A;  1ATJ A;  5AQU B;  1XNR T;  4NFG A;  1CPG A;  2D0T A;  2WU5 A;  3MKD A;  2RBX X;  5F5W A;  2CCQ A;  4NVC A;  3WXO A;  3KIN B;  2GHD X;  3FZL B;  3AEE A;  1FHF A;  4Z91 A;  1ARV A;  3PV0 F;  5HEU A;  1CCI A;  1OAG A;  3LJC A;  5HCJ A;  4GKK T;  2V7J A;  1U2K A;  5AQQ B;  2JMH A;  3JC6 D;  2VKH A;  4IE7 A;  4K0K T;  3TLS A;  3ZCH A;  2D2S A;  3OBV E;  1R8I A;  4UEL A;  5SYH A;  4X1I E;  2AS3 A;  4OYK A;  4NXN T;  4J2C A;  1IBL T;  5SYU A;  3B13 A;  3JAD A;  5IWA T;  1E1H B;  2B1E A;  4GIW A;  4LF8 T;  7CCP A;  4HKA A;  1OED C;  2WZI A;  5FY0 A;  4JI2 T;  3PUS A;  3ANW B;  1C8I A;  4XV8 A;  3ATJ A;  4YXD A;  2DNX A;  4FI5 A;  5HEO A;  2CRB A;  5FMN A;  1GZA A;  3HR0 A;  3NVO A;  4PFP A;  3N9L A;  1O3X A;  3PJA A;  2ANZ A;  2EUU A;  1YD8 G;  2QGS A;  1M7K A;  4NVF A;  3LK3 B;  5L2L A;  4HWD A;  3AEG A;  2FBW A;  4XVA A;  3DP7 A;  4P0B A;  5AQI B;  1ZBZ A;  2H89 A;  1MMG A;  4I50 E;  1KFY A;  3ONX A;  1J5E T;  2CLY C;  1BEM A;  4DV1 T;  5KQ6 A;  2YDQ A;  3V5S A;  5SYI A;  3X1D A;  4PAE A;  5HCM A;  1W9R A;  3AVR A;  2WCA A;  5IHY A;  2DI4 A;  1YQ3 A;  3LK4 2;  1AET A;  2CBJ A;  5C3J A;  1Y01 A;  4BJM A;  5AFU L;  5DAB A;  1CK6 A;  4GOU A;  5ABH A;  5KXJ A;  1CYF A;  1ABV A;  2Y6B A;  3C51 A;  5SX2 A;  3FM1 A;  3HDL A;  4ZHQ E;  4M1P A;  3RQU A;  4IDP A;  4GKF A;  3CKD A;  3RI5 A;  2XAF B;  2QA7 A;  3P4R A;  4A98 A;  4PW8 A;  3PUR A;  2Q9Q C;  5JR9 A;  1QPA A;  4HFC A;  3UFG A;  4JPL A;  4Q25 A;  4AQF C;  1CCK A;  5AQP B;  5AOG A;  2BS4 A;  1S6V A;  4DR5 T;  1N34 T;  5CIG A;  4NVJ B;  5L02 A;  4I4T E;  4NUU A;  1MIV A;  1S73 A;  3AA1 B;  2V5C A;  4LF9 T;  4JPT A;  2X51 A;  1VRB A;  5LJM A;  2EUP A;  2MTQ A;  1AEN A;  2BKP A;  5EK3 A;  2B10 A;  4IIJ E;  4ILU A;  1YW0 A;  3VKH A;  4ASK A;  1E2A A;  2CL4 X;  2E39 A;  2BO5 A;  4A78 A;  2CXF A;  3FM6 A;  2VO2 X;  4X64 T;  1FMW A;  5AQO B;  1DJ1 A;  4TNW A;  2JIW A;  3TKL B;  1U74 A;  3ZC0 A;  1DJ5 A;  4KBM B;  1V9D A;  4JI3 T;  1BR0 A;  4UIG A;  4AKL A;  4C50 A;  2LM9 A;  3AA7 B;  4ZEY A;  3CCX A;  4DR6 T;  1LKX A;  3S4U A;  3V5U A;  5A1L A;  3VLJ A;  3UT2 A;  4O4H E;  3EAB A;  2VVS A;  3PUY F;  2V6Y B;  4DR7 T;  5HAX A;  2RPA A;  2DL1 A;  4KMC A;  1D1C A;  2CWO A;  3N2G E;  4LMJ A;  2JRK A;  1ITK A;  1H5E A;  1CCC A;  4MHC A;  4DUZ T;  3M23 A;  2E5V A;  3RGL A;  4G2A A;  2UUC T;  4EOZ B;  1HX1 B;  3QB5 K;  2W23 A;  4UF0 B;  3VLM A;  1U4Q A;  2Y6X A;  4JZA A;  3UW8 A;  1ZOY A;  2N9D A;  3EUH A;  5KQ0 A;  4DR4 T;  1VOM A;  2BS2 A;  2KXP B;  3CQC B;  4HWI B;  1LY9 A;  4ADZ A;  4FCS A;  1CMU A;  2YIN A;  2X08 A;  3UQ4 A;  1NEN A;  3PE0 A;  1VCS A;  1CMP A;  1UX5 A;  3AE8 A;  4CXY A;  1KXM A;  5CCP A;  4GK0 E;  4KP3 C;  3OYX A;  2WP9 A;  4H7A A;  1AA4 A;  4P0A A;  1AC4 A;  3A5X A;  1H57 A;  2X9X A;  4BM0 A;  2K5B B;  3UFE A;  3N9Q A;  5JRE A;  1PA2 A;  1H5M A;  1UB2 A;  2V8S V;  3JC6 C;  3QC9 A;  4X65 T;  3M5Q A;  4BM4 A;  3PU8 A;  2A9U A;  2PBI A;  2WSS V;  2ZM8 A;  1KF6 A;  2X9Y A;  3UU4 A;  4QXC B;  4DV7 T;  7ATJ A;  5SX6 A;  3P4S A;  5DJQ C;  2W63 A;  4AKG A;  5ABQ A;  4U33 A;  1AEB A;  4BM1 A;  1SUM B;  4I43 B;  1H58 A;  4H9P C;  3EHZ A;  2N1G A;  4I55 E;  3FXE B;  2BG9 E;  3VRB A;  1ARX A;  4AKI A;  2X66 A;  1A2F A;  3CQX C;  5AQH B;  3O1J A;  3RIF A;  1SA0 E;  3TLV A;  4X5T A;  5LP6 E;  4OFZ A;  2VCF X;  4DR3 T;  1CCP A;  3M2G A;  3M2E A;  1XNQ T;  1CMT A;  2UU9 T;  2M67 A;  5H9E B;  2X9H A;  6CCP A;  2I6H A;  5JDF A;  3NKZ A;  2LE8 A;  5JPR A;  2BKO A;  3WAK A;  4EYY R;  3ZCG A;  3A8Y C;  2I59 A;  1CCG A;  1DSE A;  2VKA A;  4TWH A;  4JV5 T;  2DWG A;  3KV9 A;  2WB5 A;  3VLH A;  3MA9 A;  5LCY A;  3AE2 A;  3P4Q A;  4AQF A;  2A72 A;  1KOK A;  2IW5 B;  4IHJ E;  4I0U A;  2J4G A;  1Z53 A;  3Q5W A;  1LLP A;  2W66 A;  1B7T A;  3AA0 B;  5SX0 A;  1QSD A;  4A5X A;  3A7M A;  1HS7 A;  2CCD A;  3KVB A;  4A97 A;  3ZYM A;  1BEK A;  5HWY A;  3P50 A;  5JHY A;  2XAG B;  3H3A A;  3HKD E;  3M28 A;  5ABE A;  5JQG E;  2ODV A;  3AXJ A;  2XJ8 A;  1MIW A;  3M2B A;  1DSO A;  1ML2 A;  4A5G A;  2B11 A;  4PK6 A;  2EUO A;  4IGU A;  4HFD A;  1HCH A;  2JQ9 A;  2QVA A;  3LBX B;  2BG9 A;  2HHH T;  4P09 A;  3CCP A;  1H5I A;  3WNU A;  3HA4 A;  1U75 A;  3AEA A;  4JM9 A;  3OPC A;  3JAF A;  1SCH A;  5L4E A;  4TWD A;  2VQE T;  4ZI3 D;  2NTY A;  2XSA A;  1OXZ A;  3MJX A;  3BQI A;  4YHJ A;  5AQK B;  1MKQ A;  4AIU A;  4JI6 T;  3RYI E;  1MN2 A;  2WWV A;  4NXM T;  3X16 A;  2W62 A;  2KIN B;  3OVU A;  3B57 A;  5L47 A;  4DV3 T;  4BLN A;  4QXH B;  3AEF A;  3OKQ A;  2UXN B;  4YSY A;  2C5J A;  2XAQ B;  2XQ3 A;  5LG4 A;  4CXW A;  4U7I A;  1CPE A;  2LSJ A;  4NVN B;  2XTL A;  3QB5 A;  1HX8 A;  1AEU A;  2UXC T;  1JNZ A;  3ZYK A;  3P7I A;  3M26 A;  5JH7 E;  2P9B A;  3T8O A;  3FBZ A;  4JMW A;  1ZEE A;  4CVJ A;  1WLX A;  5FNV E;  2DCF A;  4YTM A;  4HFE A;  2C0S A;  4KHZ F;  5FL0 A;  2RBY X;  3VLL A;  4TNV A;  5FNE A;  1JNR A;  2JPF A;  2XPK A;  3KFW X;  1WCR A;  5AMM A;  2XY8 B;  5LYJ E;  3Q5D A;  2VKO A;  3C4W A;  2CXL A;  5CID A;  2L9Q A;  2X68 A;  1XWM A;  3N2O A;  3VLI A;  1ARU A;  2BDE A;  2QRX A;  3CPZ A;  1UGO A;  3ZJ1 A;  1CUN A;  4DV2 T;  2EHO A;  1CPD A;  1NWM X;  1ZV4 X;  5KQH A;  4DND A;  1MNE A;  5LGN B;  1HNX T;  4HFH A;  4AKR B;  2WZH A;  1Z8U A;  1RYC A;  4UV8 B;  1HFA A;  1W4Y A;  3IHR A;  3SRZ A;  3I0Q A;  2CPT A;  2VL0 A;  5HEH A;  4CI1 B;  4O2A E;  2N2N A;  3PUX F;  4LFB T;  3T1Y T;  4EEB A;  4JMS A;  3QUJ A;  3Q3U A;  1BGP A;  2V6X A;  2BBJ A;  3RX6 A;  3EI0 A;  1CCL A;  1KXN A;  2GB8 A;  1T72 A;  5DQV A;  2WM9 A;  4XV5 A;  3PUZ F;  4CZZ B;  4JI5 T;  3ZCJ A;  5LHH B;  4QX8 B;  3J7Y q;  4U31 A;  5JDM A;  1DU2 A;  5E0O A;  1H5A A;  4DMW A;  1J1J A;  3VLK A;  2RBU X;  3B5M A;  5KSF A;  1OWA A;  5JHX A;  4NVH B;  4GYR A;  1WFD A;  4LMK A;  4YHH T;  3BQK A;  2VB6 A;  1IBK T;  2WAU A;  4F8H A;  3N9O A;  1CPF A;  2LRL A;  3CML A;  5SYW A;  2LJL A;  3HKC E;  4ZZB A;  4YTN A;  3AEB A;  4AQY T;  2VUR A;  1YZR A;  1N36 T;  1B80 A;  4HE8 A;  2WD4 A;  3H3M A;  1VCT A;  2KLQ A;  2XAH B;  2A3D A;  2VVN A;  1W0B A;  3QNU A;  5JDH A;  1BVA A;  2Y8D A;  4UR9 A;  2WWU A;  1YXR A;  3AAE B;  1SHZ C;  2CCA A;  2CXD A;  2XQY A;  2BS3 A;  2RC2 X;  5EK4 A;  2UXD T;  1U2L A;  3NZP A;  3C4X A;  3FB2 A;  3I9W A;  4P1N A;  5DQW A;  4CZQ A;  4QH1 A;  4NVD A;  2KSR A;  3KBU A;  5EK2 A;  2GHE X;  4OX9 T;  2JMX A;  4COF A;  3NRX A;  4U74 A;  2HPJ A;  4JUY A;  5ABO A;  4H9N C;  4P4Q A;  1V0H X;  2WDV A;  4HTE A;  1Z0P A;  4JM8 A;  1ZBY A;  2JJ9 A;  1HTJ F;  5JR9 B;  3BK9 A;  4O4I E;  4OYJ A;  1AEF A;  2ZLY A;  5C2T A;  2HN1 A;  1CCA A;  4B3T T;  2WU2 A;  3RYF E;  3M2D A;  3OJA A;  2C5K T;  5CIC A;  1H5K A;  3RC8 A;  3N9N A;  5LNK A;  3Q5E A;  1AEO A;  3LSV A;  2IHR 1;  2EUN A;  3UU6 A;  5AL9 A;  2E3A A;  2ATJ A;  4BA9 A;  4KUM B;  1US7 B;  4CN1 A;  1S94 A;  1LYC A;  3UU5 A;  1YYG A;  3CIR A;  3UU3 A;  1H5C A;  4ZI3 C;  4PAG A;  4JYA T;  2AQD A;  3ZMZ B;  3Q9D A;  3F2E A;  3I1A A;  2YU1 A;  4Z90 A;  1D0X A;  3GA8 A;  3RYC E;  5JDN A;  2JQH A;  4WBN E;  2A2F X;  5JQR A;  1SBM A;  4GYS A;  4U7Y A;  1L0V A;  2UUB T;  3AE7 A;  4EXT A;  2SPC A;  5CJ5 A;  4DR1 T;  2OEB A;  4JI0 T;  1XDO A;  1AC8 A;  4USC A;  2RBT X;  4ZS2 A;  5FXX A;  2WDR A;  3IEE A;  5AQG B;  3NWI A;  4X1Y E;  1UX4 A;  3AE6 A;  2KT9 A;  2E9X C;  3RF1 A;  3LK2 B;  3VR8 A;  3KV5 A;  1IYN A;  4JQN A;  2LKH A;  4DUY T;  4X62 T;  2LOS A;  3RIU A;  1X9B A;  5IUX A;  5CD4 J;  4UVC B;  2LLY A;  2AE9 A;  2V23 A;  3HL6 A;  1HF8 A;  2V7L A;  5JRC B;  1H5D A;  4WBO A;  1BR1 A;  1OED E;  1MKR A;  1NAF A;  1BEP A;  3ETV A;  2VL8 A;  1GX2 A;  1BEJ A;  5SXR A;  2NW8 A;  5AQV B;  4FCN A;  3M3Z B;  5AQT B;  2XIF A;  1H3J A;  3ZN0 B;  2LSI A;  2NR4 A;  2ZM2 A;  3RLF F;  3AED A;  1HNW T;  3Q2M A;  4YFS A;  3DTO A;  4G63 A;  3K1S A;  2NP9 A;  3UQ7 A;  4A56 A;  1MMD A;  4QX7 B;  5HEG A;  2NWB A;  3QK6 A;  4ZI7 E;  5SYX A;  4E7S A;  5AQF B;  2IDO B;  3K3O A;  1ARW A;  2HN2 A;  2XQ4 A;  1W4W A;  2X0L B;  4CN4 A;  4OQ7 A;  3KDS E;  4EAH A;  4B3R T;  3ZMV B;  1KK7 A;  2GHH X;  4ERR A;  5D6M A;  1UK5 A;  5CIF A;  3RHW A;  4EYU A;  5FL1 A;  5SW6 A;  2YLJ A;  3E2N A;  4YJ2 E;  4NVE A;  2VQF T;  4JEH B;  1H5H A;  2VCN A;  2BZB A;  5JDL A;  4NVI B;  5JHZ A;  1UUR A;  3VHL A;  4QWN B;  3CQG B;  2CCP A;  2V6Y A;  3GN5 A;  2KWH A;  3O9X A;  3BQL A;  2AS4 A;  5LB7 B;  4TN7 B;  4A6Z A;  3QOF A;  1OED A;  5SYY A;  4BLL A;  5JDQ A;  3HI2 A;  3X1L F;  1MK8 A;  4CZP A;  5LMU T;  1ARY A;  4CZR A;  3ZJ2 A;  4JB4 A;  1AEJ A;  4UF0 A;  2HPL A;  4XV7 A;  5KSK A;  1GWU A;  4BLY A;  4NVA A;  3R99 A;  4CXX A;  4U72 A;  5BR8 T;  5J0Z A;  3R6N A;  2WS3 A;  2NW7 A;  4ZI2 D;  2ACZ A;  1CHU A;  4HWF A;  3O1I A;  1WYB A;  5FYM A;  5FVL A;  1FJG T;  5CA1 E;  1X79 A;  2XJ5 A;  4LF7 T;  1AED A;  4AKH A;  1U2J A;  5CB4 E;  4X20 E;  2FJA A;  4HGA A;  5FNB A;  4JN0 A;  2K9A A;  4NVL A;  3WI3 A;  4UV9 B;  4H9O C;  5LGU B;  1DSG A;  2MAW A;  4LML A;  4BAY B;  2E9X B;  4JMB A;  2E8I A;  3ZCY A;  1J5W A;  3FZM B;  3KBT A;  1A2G A;  4TUY E;  3AXJ B;  1N32 T;  5EJX A;  1G8X A;  5CIE A;  3MXZ A;  1CMQ A;  4DV4 T;  3N2K E;  4EGW A;  3FXD B;  3E08 A;  3FZK B;  4JMT A;  4O8S A;  2Q9Q A;  5L3G B;  2BG9 B;  4ILA A;  3HKE E;  4BM2 A;  2YDS A;  2LHR A;  3ZMU B;  4H9Q C;  3K3Q C;  3TLT A;  2WSS S;  4ATJ A;  5LJN A;  4JI7 T;  1BR4 A;  4JPU A;  3O1H A;  1N33 T;  2XHE B;  2E5L T;  4CZN A;  4EED A;  2DWK A;  4JM5 A;  4E7Z A;  2RBV X;  1H5F A;  4LFA T;  2W00 A;  4IE4 A;  4NPP A;  4PJM A;  5L3B B;  5LG3 A;  2FJD A;  3Q5X A;  3IBP A;  2PCC A;  3PUG A;  2XQ8 A;  4DR2 T;  1WR0 A;  4JMV A;  5AQN B;  3CK6 A;  4DBR A;  2BBH A;  4NVG B;  1D0Y A;  5JTG A;  4JMA A;  1MIY A;  2RP4 A;  2E2A A;  1XMQ T;  4PK5 A;  1D1B A;  3RRC A;  3AE4 A;  1JDR A;  1E7P A;  2NW9 A;  2Y6A A;  1LGA A;  2XJ7 A;  2XQ6 A;  4QYZ B;  2W4X A;  4L9I A;  2PCB A;  4C90 A;  1KNZ A;  1HR0 T;  4IT4 A;  1IAP A;  4IDN A;  1BES A;  4CI2 B;  1T7S A;  4PJN A;  2H7V C;  2W0G A;  3ZT5 A;  4YSX A;  3ZN1 B;  3WAJ A;  5AQJ B;  5SXT A;  2X07 A;  3UUM A;  5JDG A;  3LDQ B;  5SXW A;  1G73 A;  1OAF A;  3NBX X;  1B82 A;  2YU2 A;  4IE5 A;  4A71 A;  4X66 T;  4JI4 T;  2EUT A;  1MND A;  2VNZ X;  3R84 B;  2L8K A;  2E9X D;  4IE0 A;  2EHO B;  2MYS A;  5ABF B;  3N9M A;  2Z6E A;  4YSZ A;  1DSP A;  5SYV A;  4DBQ A;  2X9W A;  1YYD A;  4DMV A;  4PNI A;  1LY8 A;  3H37 A;  3R98 A;  1AEV A;  5FXW A;  2CE7 A;  2LSY A;  3ZST A;  2W61 A;  2I0M A;  4U2Z A;  1MMN A;  4NVO B;  5HXH A;  4H9S E;  3M65 A;  4NUV A;  5AQR B;  4GED A;  5CA0 E;  2PFV A;  5F8P A;  5JR9 C;  1Y64 B;  2WBL A;  4WZX A;  4ZZC A;  5SW4 A;  4QHO A;  1YQ4 A;  2H7O A;  3ZC1 A;  1XMO T;  1YKH B;  2RBW X;  1BJ9 A;  2WDQ A;  2DHR A;  4BLK A;  1ZHC A;  1IZN B;  2LSK A;  1H5L A;  2WQY A;  1SOG A;  4TWF A;  4WW0 A;  1H55 A;  4UVB B;  2CA5 A;  4ILB A;  2RBZ X;  3WA8 A;  4U7U B;  1CCJ A;  1H5J A;  2EUQ A;  1WR6 A;  3M27 A;  2XM2 A;  5FKY A;  4TZ4 C;  5LHI B;  3VR9 A;  4EIW A;  5KQ2 A;  3MK7 C;  5H6Q B;  1APX A;  3KV4 A;  3K8P C;  4QKN A;  4U2Y A;  2V1D B;  3F57 A;  4H79 A;  4OHF A;  4IDQ A;  3RH3 A;  4CCP A;  1QO4 A;  2F4V T;  1UUS A;  2K48 A;  2Y48 B;  1AEQ A;  1AEH A;  5LA6 E;  1QGJ A;  2PJQ A;  2V7I A;  3M2I A;  2EUR A;  5SX7 A;  4HWC A;  2L3L A;  4LF5 T;  1ZKE A;  2XJ6 A;  2LHN A;  2CWY A;  3SS1 A;  3M2F A;  1AEG A;  2NTX A;  2AXD S;  2CBI A;  3ZEF B;  4XZC A;  4O4L E;  4ZI2 C;  5H9F B;  2JMK A;  3CX6 B;  4GKJ T;  1WYC A;  3RPU A;  5CGM A;  2EHO D;  2B76 A;  5HXS A;  4B6X A;  2R6G F;  3L09 A;  2PTF A;  5ABG A;  1XDP A;  4YTP A;  1NEK A;  1KEY A;  1LVF A;  3UUX B;  3CWZ B;  3PUA A;  1AJ3 A;  2A7U B;  3EDU A;  3UUL A;  2YEV C;  5FXZ A;  2X0Y A;  5SW5 A;  3SWH A;  2V7M A;  5LGT B;  5J1G A;  4BLX A;  3C50 A;  4O2B E;  3M2H A;  2W2U A;  4N78 D;  3C98 B;  4CI3 B;  3E0Z A;  4UEM A;  2CEA A;  2MPK A;  1AEK A;  1D0Z A;  5SYL A;  2IUB A;  3AE9 A;  5CFB A;  1STQ A;  2OA5 A;  3E22 E;  4JMZ A;  1D1A A;  2V2E A;  2V5D A;  3AVS A;  2XSB A;  4XAX B;  4HFI A;  1YKE B;  2KMF A;  4YT0 A;  1I94 T;  3L8R A;  3PU3 A;  3ZCI A;  1IJ6 A;  3LFM A;  3ZKR A;  5J2T E;  4MAL A;  3IF8 B;  5SYJ A;  3C4Z A;  4U3C A;  3ONL C;  4BM3 A;  3M2A A;  5ADX L;  3ANW A;  2RA1 A;  2E3B A;  1GZB A;  2FUP A;  3U78 A;  4L0R A;  1ZP0 A;  4GK5 E;  4AIS A;  4JBW F;  4ZS3 A;  4LF6 T;  4H9R C;  4JQM A;  4JM6 A;  2UXB T;  3VRA A;  1H5G A;  3P8C D;  3MZK B;  3AE5 A;  2VKD A;  1KNP A;  2WY2 A;  1HCI A;  3IA3 A;  4Z8X A;  2RC1 X;  2XIL A;  3K3N A;  3KV6 A;  4AQG A;  3D0T A;  2ES0 A;  2V7K A;  4ZOL E;  3AAA B;  3LG7 A;  4JEU B;  5LBM A;  1T8B A;  5J2U E;  5IYZ E;  1HNZ T;  2XUE A;  5SX3 A;  3PDY A;  2J47 A;  1XZY A;  3JAE A;  1KZM A;  2UXX B;  3ZT6 A;  2B0Z A;  3RQW A;  4CZO A;  3AE3 A;  3ETU A;  5HYA A;  3FM4 A;  2BVM A;  6ATJ A;  4CUO A;  4HFV A;  2K3W A;  4OK0 A;  1MNP A;  5GON E;  3ZLI A;  3TLW A;  4YLH A;  2CYP A;  4XV6 A;  2XAJ B;  2IC9 A;  4CCX A;  3FJW A;  4C51 A;  5BMV E;  2LSG A;  5HEJ A;  2BG9 C;  3UU8 A;  4IL4 A;  5FY7 A;  2D0U A;  5ABN A;  4PJJ A;  3RKG A;  3O4X E;  5AQM B;  3FHN A;  2KWI B;  3UTK A;  4YY3 T;  2M6B A;  1GQE A;  4KHP T;  1SE7 A;  2ODU A;  2Y5A A;  4O4J E;  2V26 A;  2XZE A;  5LOV E;  3ABV A;  2YOE A;  4IE6 A;  2BCN A;  5LXT E;  1MMA A;  2LT3 A;  4TV8 E;  5FVK A;  5TAO A;  2VK9 A;  2ZMA A;  3PUQ A;  5FP3 A;  3GMI A;  2MOZ A;  3GN5 B;  4JQK A;  4DV5 T;  2UUA T;  1IJ5 A;  3T1H T;  4EZ4 A;  1OED B;  5HXC A;  5L86 A;  3SOL A;  1DS4 A;  5JRC A;  2CM0 A;  2H3R A;  2LKG A;  1LRZ A;  5H6R B;  4WNK A;  2PG8 A;  3PUV F;  3EVY A;  4BJN A;  2IIU A;  2GGN X;  2IC6 A;  3KVA A;  5L4H A;  1QUU A;  3I9Y A;  2GHC X;  2XQ9 A;  4B3S T;  4NVB A;  1M62 A;  1BEQ A;  3JCF A;  2LEH A;  4IDZ A;  2AS6 A;  5LBQ B;  3AAI A;  4FJO A;  2D5U A;  4K0U A;  3W15 B;  4BLZ A;  2ACX A;  3SFD A;  2CLY B;  1LVK A;  4LFC T;  2BKN A;  2BOQ A;  5HXR A;  1FMV A;  3ZMS B;  4CVI A;  2EHO C;  4DVD A;  4DO0 A;  4WYV A;  1HG2 A;  2YN6 A;  3VU7 H;  1ARP A;  3FZF B;  4QH5 A;  3AA6 B;  3ZSS A;  1CCB A;  5KQ3 A;  5HWX A;  5LMN T;  1FEW A;  5KQI A;  4FEF A;  2J62 A;  4TX5 A;  1W09 A;  3GWH A;  3OYZ A;  3AB3 B;  4A7M A;  4V1A v;  2Q9Q B;  5SXS A;  5EJT A;  2YCG A;  1UCU A;  1JCI A;  2J1D G;  2MBG A;  2VCS A;  3FBL A;  2VAS A;  2ZCA A;  2FJB A;  5M4Y A;  4XV4 A;  2C5I T;  2CHO A;  5CIH A;  2M6I A;  3RKO A;  4NVM B;  2K24 A;  4DID B;  5SX0 B; 
#chains in the Genus database with same CATH homology
 4PNI A;  2Y8D A;  1LY8 A;  3H37 A;  3R98 A;  1AEV A;  5FXW A;  2CE7 A;  2LSY A;  3ZC0 A;  1DJ1 A;  2W61 A;  1B85 A;  2WWU A;  3AAE B;  3UT5 E;  3TKL B;  1SHZ C;  2CCA A;  1MMN A;  1U74 A;  1BR2 A;  2CXD A;  2AS1 A;  2RC2 X;  4NVO B;  2XQY A;  3M65 A;  4H9S E;  4NUV A;  5HXH A;  4PK4 A;  1DJ5 A;  1SJ2 A;  4KBM B;  4GED A;  1V9D A;  2GHK X;  5CA0 E;  2PFV A;  1BR0 A;  5F8P A;  3ESL A;  4UIG A;  5EK4 A;  4AKL A;  5JR9 C;  1U2L A;  1Y64 B;  3C4X A;  2WBL A;  4NVK B;  3FB2 A;  3I9W A;  4C50 A;  2LM9 A;  2XI6 A;  5SW4 A;  3AA7 B;  4QHO A;  4CZQ A;  2H7O A;  5DQW A;  3CCX A;  4C91 A;  1LKX A;  4NVD A;  3ZC1 A;  3S4U A;  3V5U A;  3KBU A;  1WRD A;  5A1L A;  5EK2 A;  2GHE X;  4XBF B;  5ALA A;  1YKH B;  5SXQ A;  3VLJ A;  2RBW X;  3UT2 A;  4O4H E;  3NRX A;  1BJ9 A;  5KMG P;  4U74 A;  2HPJ A;  5KQK A;  2DHR A;  4JUY A;  2IAK A;  4KMC A;  4QXB B;  5HAX A;  4UVA B;  1D1C A;  4BLK A;  5ABO A;  2CWO A;  4H9N C;  3UUN A;  1ZHC A;  1T98 A;  3N2G E;  5L3C B;  4JLE A;  1IZN B;  2JRK A;  1ITK A;  4MLK A;  2LSK A;  1H5E A;  1H5L A;  4P4Q A;  1SOG A;  4WW0 A;  1V0H X;  1H55 A;  4HTE A;  3NRY A;  4UVB B;  1CCC A;  4MHC A;  1Z0P A;  4JM8 A;  5LHG B;  1ZBY A;  2JJ9 A;  2CA5 A;  1HTJ F;  5JR9 B;  3M23 A;  3CX8 B;  2RBZ X;  3BK9 A;  4G2A A;  4O4I E;  3WA8 A;  4U7U B;  1U5P A;  1CCJ A;  4ISS A;  4EOZ B;  5F3J A;  1H5J A;  4OYJ A;  1AEF A;  2EUQ A;  3VKG A;  2ZLY A;  1WR6 A;  3M27 A;  5SXX A;  2W23 A;  4UF0 B;  3NZP A;  3VLM A;  1U4Q A;  1CCA A;  4TZ4 C;  2Y6X A;  1FIO A;  5LHI B;  4JZA A;  3RIW A;  3RYF E;  3M2D A;  3UW8 A;  4EIW A;  5KQ2 A;  2N9D A;  3OJA A;  3EUH A;  2C5K T;  2KZ7 B;  3MK7 C;  5CIC A;  5H6Q B;  2E9X A;  1APX A;  1H5K A;  4UXN B;  3KV4 A;  3RC8 A;  5KQ0 A;  3N9N A;  5LNK A;  2HH7 A;  2BVL A;  3K8P C;  4QKN A;  1AEO A;  1VOM A;  2V1D B;  2KXP B;  5HXE A;  3CQC B;  3F57 A;  1LY9 A;  2EUN A;  4FCS A;  4H79 A;  1CMU A;  5AL9 A;  2E3A A;  2ATJ A;  4OHF A;  4YJ3 E;  4BA9 A;  3CX7 B;  1AEE A;  4KUM B;  2LOP A;  1US7 B;  4CCP A;  2YIN A;  3RH3 A;  1QO4 A;  3ZYL A;  3EXB A;  4CQI A;  1SDQ A;  1S94 A;  1LYC A;  2X08 A;  2K48 A;  2Y48 B;  3HKB E;  1YYG A;  1AEQ A;  3E2O A;  3PE0 A;  1AEH A;  5LA6 E;  1CMP A;  1QGJ A;  1UX5 A;  2PJQ A;  1H5C A;  5L3D B;  4ZI3 C;  4CXY A;  4PAG A;  1KXM A;  5CCP A;  2V7I A;  4GK0 E;  3OYX A;  4KP3 C;  3M2I A;  2AQD A;  3ZMZ B;  3Q9D A;  2EUR A;  5SX7 A;  3F2E A;  2L3L A;  4TV9 E;  1MN1 A;  2YU1 A;  1ZKE A;  2XJ6 A;  3I1A A;  1D0X A;  2KND A;  2LHN A;  3GA8 A;  3RYC E;  3CVR A;  4H7A A;  3L3P A;  1AA4 A;  2CWY A;  4AXP A;  1AC4 A;  3SS1 A;  4F6R C;  5JDN A;  3M2F A;  4L5G A;  4P0A A;  5CJH A;  1AEG A;  2A2F X;  2NTX A;  3A5X A;  4WBN E;  1EZ3 A;  1H57 A;  5JQR A;  1SBM A;  2X9X A;  2YK0 A;  2VKJ A;  4BM0 A;  4GYS A;  2K5B B;  3ZEF B;  1AEM A;  3UFE A;  3N9Q A;  4XZC A;  4O4L E;  5JRE A;  4ZI2 C;  2WMO A;  2DLR A;  2Q9Q D;  1PA2 A;  5H9F B;  2JMK A;  2SPC A;  2X67 A;  3CX6 B;  1H5M A;  1UB2 A;  4FDQ A;  4EXT A;  3JC6 C;  2EUS A;  3QC9 A;  3M5Q A;  4BM4 A;  1AC8 A;  1WYC A;  3PU8 A;  4MBQ A;  3RPU A;  2JTI A;  2PBI A;  2EHO D;  2WSS V;  2ZM8 A;  4USC A;  3J9X 1;  3ZMT B;  2RBT X;  4ZS2 A;  1KRJ A;  5FXX A;  2X9Y A;  5HXS A;  4QXC B;  3IEE A;  4B6X A;  7ATJ A;  5SX6 A;  5DJQ C;  3L09 A;  4X1Y E;  1UX4 A;  2W63 A;  5ABQ A;  2JQQ A;  4AKG A;  1AEB A;  4BM1 A;  1S35 A;  2E9X C;  2KT9 A;  4I43 B;  3LK2 B;  4X1K E;  5ETW A;  5L3E B;  1H58 A;  3M29 A;  4H9P C;  3KV5 A;  2N1G A;  1IYN A;  3RIV A;  4JQN A;  5KDM C;  2ICV A;  4I55 E;  1LVF A;  1EBE A;  2LOS A;  3FXE B;  3UUX B;  3CWZ B;  2CMR A;  5EZY E;  3PUA A;  5CD4 J;  3LBX A;  1ARX A;  4UVC B;  4AKI A;  2X66 A;  5FXV A;  1AJ3 A;  1A2F A;  2V23 A;  3CQX C;  3HL6 A;  3O1J A;  1HF8 A;  2V7L A;  1SA0 E;  5JRC B;  3EDU A;  3UUL A;  1H5D A;  2YEV C;  4WBO A;  5FXZ A;  2AS2 A;  4OFZ A;  2VNX X;  5LP6 E;  1BR1 A;  2VCF X;  5SW5 A;  1CCP A;  3M2G A;  3M2E A;  5KX5 E;  1CMT A;  3SWH A;  3EDV A;  2M67 A;  1MKR A;  5H9E B;  1NAF A;  1BEP A;  2X9H A;  2V7M A;  3C64 A;  3ETV A;  5J1G A;  2XIH A;  3RRW A;  3I0O A;  4BLX A;  2VL8 A;  1GX2 A;  4ANJ A;  2N18 A;  1BEJ A;  6CCP A;  1GW2 A;  5SXR A;  2NW8 A;  3M8M A;  4FCN A;  3C50 A;  5JDF A;  2XIF A;  4O2B E;  1H3J A;  3M2H A;  3N9P A;  2LE8 A;  4N78 D;  5FY1 A;  3ZN0 B;  5JPR A;  2LSI A;  2ZM2 A;  1HSR A;  1GWO A;  5JVD E;  1LYK A;  3C98 B;  3WAK A;  2WMN A;  4CI3 B;  4EYY R;  3M25 A;  3ZCG A;  3Q2M A;  3E0Z A;  2I59 A;  1CCG A;  4YFS A;  3DTO A;  4UEM A;  2XAS B;  2CEA A;  4G63 A;  1DSE A;  2RC0 X;  2VKA A;  2NP9 A;  1AEK A;  1D0Z A;  5SYL A;  4A56 A;  1MMD A;  2DWG A;  3RYH E;  1STQ A;  3U3I A;  2CEP A;  4QX7 B;  4H63 H;  3KV9 A;  2OA5 A;  5CIB A;  5SX1 A;  2NWB A;  4PJL A;  3QK6 A;  2ZM0 A;  3E22 E;  3F31 A;  4ZI7 E;  5SYX A;  4H63 V;  4E7S A;  2B12 A;  1AES A;  4JMZ A;  1D1A A;  3K3O A;  2V2E A;  3RC3 A;  3VLH A;  1ARW A;  3MA9 A;  3AVS A;  5LCY A;  1W4W A;  2X0L B;  3DJB A;  5ADX L;  4XAX B;  5C8Y E;  1YKE B;  4OQ7 A;  4AQF A;  2A72 A;  1KOK A;  2IW5 B;  3M2C A;  2KMF A;  4IHJ E;  1CCE A;  3FMU A;  1Z53 A;  3Q5W A;  4IST A;  1LLP A;  3ZLI A;  1B7T A;  3AA0 B;  5SYK A;  3PU3 A;  1HG5 A;  4HN9 A;  3ZCI A;  3NZQ A;  5SX0 A;  1IJ6 A;  1QSD A;  3LFM A;  3KDS E;  4EAH A;  3ZMV B;  5J2T E;  4MAL A;  1HS7 A;  2CCD A;  2GHH X;  3FKG A;  5L05 A;  1KK7 A;  3KVB A;  3IF8 B;  5SYJ A;  5D6M A;  4ERR A;  4PFO A;  3ZYM A;  1BEK A;  3C4Z A;  3PTR B;  5CIF A;  5HWY A;  4EYU A;  4BM3 A;  3M2A A;  1DCC A;  4G05 A;  5SW6 A;  5JHY A;  2XAG B;  3H3A A;  3HKD E;  3M28 A;  3MAC A;  5JQG E;  2YLJ A;  3ANW A;  2RA1 A;  4MFR A;  2E3B A;  3E2N A;  1H7C A;  1GZB A;  4EB6 E;  4NVE A;  4YJ2 E;  2ODV A;  4JQJ A;  2XJ8 A;  1MIW A;  3U78 A;  3M2B A;  2GK9 A;  4L0R A;  4JEH B;  4GK5 E;  1DSO A;  1ML2 A;  4A5G A;  2B11 A;  4HEA A;  1GWT A;  1H5H A;  2EUO A;  4PK6 A;  2VCN A;  4IGU A;  2NOX A;  4ZS3 A;  5L3F B;  2BZB A;  1HCH A;  4H9R C;  4EZH A;  5JDL A;  4JQM A;  4NVI B;  4JM6 A;  5JHZ A;  2VWA A;  2IA8 A;  3N5L A;  3VHL A;  4QWN B;  1YZP A;  1H5G A;  3LBX B;  3CQG B;  3P8C D;  3MZK B;  2CCP A;  3GN5 A;  4P09 A;  3ZPO A;  2KWH A;  3CCP A;  1H5I A;  2VKD A;  3WNU A;  3O9X A;  3HA4 A;  2G0U A;  3BQL A;  1ATJ A;  2AS4 A;  1U75 A;  4JM9 A;  4NFG A;  1CPG A;  4TN7 B;  2D0T A;  1HCI A;  4A6Z A;  4Z8X A;  4TV8 E;  1SCH A;  2RC1 X;  3MKD A;  5SYY A;  2XIL A;  2RBX X;  4BLL A;  5JDQ A;  3HI2 A;  3K3N A;  3KV6 A;  4AQG A;  4AI6 A;  2CCQ A;  2NTY A;  4ZI3 D;  4NVC A;  3D0T A;  3WXO A;  2ES0 A;  2GHD X;  2V7K A;  3KIN B;  4ZOL E;  1MK8 A;  3AAA B;  1OXZ A;  3LG7 A;  4CZP A;  4JEU B;  5LBM A;  3MJX A;  5J2U E;  3BQI A;  1FHF A;  4YHJ A;  1ARY A;  4CZR A;  5IYZ E;  1MKQ A;  4JB4 A;  3ZJ2 A;  1AEJ A;  1ARV A;  2XUE A;  5SX3 A;  4UF0 A;  1CCI A;  1MN2 A;  1OAG A;  3RYI E;  3PDY A;  2HPL A;  4XV7 A;  5KSK A;  3X16 A;  3LJC A;  1KZM A;  1GWU A;  4BLY A;  4NVA A;  3R99 A;  2UXX B;  2W62 A;  4U72 A;  4CXX A;  2KIN B;  2B0Z A;  3B57 A;  3R6N A;  2V7J A;  4BLN A;  4CZO A;  4QXH B;  2NW7 A;  3ETU A;  1U2K A;  2UXN B;  3OKQ A;  5FP3 A;  4ZI2 D;  5HYA A;  3O1I A;  3FM4 A;  2BVM A;  1WYB A;  2JMH A;  3JC6 D;  2C5J A;  2VKH A;  2XAQ B;  4IE7 A;  5LG4 A;  6ATJ A;  4CUO A;  4HFV A;  5FYM A;  4CXW A;  4OK0 A;  5CA1 E;  1CPE A;  1MNP A;  2XJ5 A;  3ZCH A;  1X79 A;  2D2S A;  2LSJ A;  1AED A;  3OBV E;  4NVN B;  2XTL A;  4UEL A;  1HX8 A;  4AKH A;  1AEU A;  5SYH A;  4YLH A;  4X1I E;  1U2J A;  2AS3 A;  2CYP A;  4XV6 A;  4OYK A;  4X20 E;  2XAJ B;  5CB4 E;  4HGA A;  5FNB A;  4JN0 A;  4CCX A;  2IC9 A;  2K9A A;  4NVL A;  3FJW A;  4J2C A;  4C51 A;  3WI3 A;  5BMV E;  5SYU A;  3B13 A;  4UV9 B;  3ZYK A;  2LSG A;  3P7I A;  4H9O C;  5LGU B;  1DSG A;  3M26 A;  5JH7 E;  1E1H B;  2P9B A;  3T8O A;  4BAY B;  3FBZ A;  4JMW A;  2E9X B;  1ZEE A;  4CVJ A;  1WLX A;  5ABN A;  2B1E A;  2D0U A;  4JMB A;  4PJJ A;  5FNV E;  5FY7 A;  4GIW A;  2DCF A;  3ZCY A;  2E8I A;  3O4X E;  2C0S A;  3FHN A;  2KWI B;  7CCP A;  3UTK A;  3KBT A;  2RBY X;  4HKA A;  5FY0 A;  3VLL A;  3PUS A;  2ODU A;  3ANW B;  5L3G B;  1C8I A;  5FNE A;  2Y5A A;  1A2G A;  4O4J E;  2V26 A;  5LOV E;  2JPF A;  4TUY E;  4XV8 A;  3ATJ A;  3KFW X;  5LGT B;  5EJX A;  1G8X A;  5CIE A;  5AMM A;  3MXZ A;  2DNX A;  4IE6 A;  4FI5 A;  2BCN A;  5LXT E;  1MMA A;  1CMQ A;  5LYJ E;  2LT3 A;  1GZA A;  2VKO A;  3C4W A;  2CXL A;  3FXD B;  3HR0 A;  3N2K E;  5CID A;  3E08 A;  2L9Q A;  4JMT A;  2X68 A;  4PFP A;  5TAO A;  3N9L A;  2VK9 A;  1O3X A;  4O8S A;  2Q9Q A;  3N2O A;  2ANZ A;  2ZMA A;  3VLI A;  1ARU A;  2BDE A;  2EUU A;  1YD8 G;  2QGS A;  3CPZ A;  3GMI A;  3PUQ A;  4NVF A;  2MOZ A;  3GN5 B;  4JQK A;  3LK3 B;  3ZJ1 A;  5L2L A;  1CUN A;  2EHO A;  1CPD A;  1NWM X;  1ZV4 X;  5KQH A;  3HKE E;  4BM2 A;  1IJ5 A;  4DND A;  4EZ4 A;  1MNE A;  2LHR A;  3ZMU B;  4H9Q C;  5LGN B;  3K3Q C;  4ADZ A;  4XVA A;  3DP7 A;  5HXC A;  4P0B A;  4ATJ A;  5LJN A;  1BR4 A;  4AKR B;  4JPU A;  5L86 A;  1ZBZ A;  3O1H A;  2XHE B;  1RYC A;  4UV8 B;  3SOL A;  4CZN A;  1DS4 A;  1MMG A;  2CM0 A;  2H3R A;  1HFA A;  2DWK A;  4I50 E;  1W4Y A;  5JRC A;  3IHR A;  4JM5 A;  1LRZ A;  3ONX A;  3SRZ A;  4E7Z A;  2RBV X;  2CLY C;  1BEM A;  3I0Q A;  5H6R B;  4CI1 B;  4O2A E;  4WNK A;  5LHH B;  5KQ6 A;  2PG8 A;  3EVY A;  4BJN A;  1H5F A;  2N2N A;  3V5S A;  5SYI A;  2GGN X;  4PAE A;  2W00 A;  4IE4 A;  4PJM A;  4JMS A;  3AVR A;  3QUJ A;  5L3B B;  2IC6 A;  3Q3U A;  3KVA A;  5IHY A;  5GON E;  1BGP A;  1QUU A;  3Q5X A;  2DI4 A;  2GHC X;  3I9Y A;  3IBP A;  3LK4 2;  2PCC A;  1AET A;  3PUG A;  4NVB A;  3RX6 A;  4JMV A;  1BEQ A;  1CCL A;  4DBR A;  4BJM A;  4NVG B;  1D0Y A;  1KXN A;  4JMA A;  2LEH A;  5AFU L;  5DAB A;  1CK6 A;  4GOU A;  2GB8 A;  4IDZ A;  5DQV A;  1MIY A;  2WM9 A;  2RP4 A;  1CYF A;  4XV5 A;  2AS6 A;  4CZZ B;  5LBQ B;  3AAI A;  2Y6B A;  2D5U A;  4FJO A;  4K0U A;  3W15 B;  3ZCJ A;  3C51 A;  5SX2 A;  3FM1 A;  3HDL A;  4BLZ A;  4M1P A;  4PK5 A;  1D1B A;  2ACX A;  3CKD A;  3RRC A;  4ZHQ E;  2CLY B;  1JDR A;  1LVK A;  2QA7 A;  2XAF B;  4QX8 B;  2BOQ A;  3J7Y q;  5HXR A;  1FMV A;  3ZMS B;  2NW9 A;  4PW8 A;  2Y6A A;  1LGA A;  3PUR A;  2Q9Q C;  5E0O A;  1H5A A;  5JR9 A;  5JDM A;  4DMW A;  1QPA A;  3VLK A;  2RBU X;  4CVI A;  4JPL A;  4QYZ B;  5KSF A;  4AQF C;  1CCK A;  4L9I A;  1OWA A;  2PCB A;  2EHO C;  4DVD A;  5AOG A;  4C90 A;  4DO0 A;  5JHX A;  4NVH B;  4GYR A;  1HG2 A;  1S6V A;  3VU7 H;  1KNZ A;  1ARP A;  5CIG A;  4NVJ B;  5L02 A;  1IAP A;  4I4T E;  4NUU A;  1BES A;  1MIV A;  3AA6 B;  4CI2 B;  4PJN A;  2H7V C;  2W0G A;  3WAJ A;  3BQK A;  3ZN1 B;  1CCB A;  5KQ3 A;  2VB6 A;  5HWX A;  1S73 A;  5SXT A;  2X07 A;  5KQI A;  1FEW A;  4FEF A;  3AA1 B;  2WAU A;  3UUM A;  5JDG A;  5SXW A;  3N9O A;  1CPF A;  4JPT A;  1G73 A;  4TX5 A;  1OAF A;  2X51 A;  3CML A;  3NBX X;  4DMV A;  1B82 A;  1VRB A;  2YU2 A;  4IE5 A;  5LJM A;  5SYW A;  2EUP A;  2LJL A;  2MTQ A;  3GWH A;  4A71 A;  3HKC E;  1AEN A;  3OYZ A;  3AB3 B;  5FMN A;  4A7M A;  5EK3 A;  4V1A v;  1YZR A;  2B10 A;  2EUT A;  5SXS A;  5EJT A;  2YCG A;  1MND A;  1B80 A;  2VNZ X;  1UCU A;  2Q9Q B;  4IIJ E;  1JCI A;  4ILU A;  2J1D G;  1YW0 A;  2MBG A;  3R84 B;  4HE8 A;  2L8K A;  2VCS A;  3FBL A;  2E9X D;  2VAS A;  4IE0 A;  3VKH A;  2ZCA A;  2WD4 A;  2EHO B;  4ASK A;  2MYS A;  2KLQ A;  2XAH B;  2A3D A;  5M4Y A;  4XV4 A;  2CL4 X;  2C5I T;  2E39 A;  4A78 A;  2CXF A;  5CIH A;  3N9M A;  3FM6 A;  4NVM B;  2VO2 X;  2Z6E A;  3RKO A;  1FMW A;  1DSP A;  5SYV A;  2K24 A;  4DBQ A;  2X9W A;  1YYD A;  5JDH A;  1BVA A;  5SX0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...