3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
1SCHA 1U75A 2BOQA 1GWUA 3M23A 1AEKA 4JPLA 1AEJA 1MN2A 5SYJA 1H57A 5CIGA 1S6VA 5FNEA 2VNZX 1BEKA 2BCNA 1H55A 2EUSA 2AS3A 1CMUA 4NVNB 3M25A 2CYPA 4GEDA 1ARUA 5AMMA 3ZCHA 1H3JA 4C50A 3VLKA 5SXWA 4NVKB 1H5GA 1ARVA 1AETA 1YZPA 2EUTA 1BEMA 4NVJB 4XV8A 2RBWX 3CCPA 3FMUA 4BLXA 5EJXA 2B11A 2V23A 1BJ9A 2B10A 1MK8A 5SYHA 2RBZX 4CVIA 5SX2A 1SJ2A 5CICA 5SYLA 4CUOA 2PCCA 2PCBA 1CCAA 3RIVA 5KQKA 1H5MA 2GHDX 3ZCGA 5SYIA 2XJ6A 1UB2A 4XV7A 2ICVA 1AEBA 2AQDA 4CCPA 4CCXA 2WD4A 2E3BA 5KQ0A 3VLIA 5SXRA 1IYNA 1ARXA 2RC0X 2VCSA 3M2IA 1ARWA 1RYCA 1CCJA 3M2BA 4JMVA 4JPTA 5SXTA 1ARYA 1AEMA 5L86A 5CJHA 4BLZA 4BM1A 4JMZA 1CCGA 2E39A 2GGNX 2RBVX 1OAFA 5JQRA 1APXA 5SYUA 4NVHB 4NVDA 4OQ7A 1S73A 1H5HA 1GZBA 4A5GA 1B80A 4BM0A 2Y6BA 3UW8A 5SW4A 3R98A 1U2JA 3R99A 1DSEA 1AEFA 1CPFA 3E2OA 3ZCYA 1QGJA 5AOGA 1B82A 1EBEA 3M28A 5CIHA 4XV6A 2RBUX 5L05A 1ARPA 1CCPA 1QPAA 4NVOB 4NVEA 5ALAA 2GHEX 3FM4A 5KQ2A 4JMAA 2Y6AA 1B85A 2XJ8A 4PAEA 1H58A 1C8IA 2YCGA 1CPEA 2CCAA 3M8MA 2CEPA 1H5CA 2EURA 3M2DA 1AENA 5SXQA 5KQ6A 1ATJA 1U74A 3M5QA 1GZAA 4JB4A 2EUPA 1BEQA 2EUOA 3X16A 1BEPA 1GWOA 2GHCX 3RIWA 3M2CA 5CIDA 4USCA 4JM5A 1CCLA 1HSRA 5SX0A 5ABQA 5KQHA 1A2GA 4ATJA 1ITKA 4JMTA 1HCHA 3ATJA 5SYVA 3RRWA 1CPDA 3M2AA 4BLLA 4FEFA 1AEUA 3M27A 5CIEA 5L02A 5SYWA 2B12A 2N18A 1AEQA 2VNXX 4CZQA 5SYXA 5SW6A 5KQ3A 7ATJA 1W4YA 1MNPA 2YLJA 4BLYA 3M2GA 4CZPA 1A2FA 5JPRA 2V2EA 2VKAA 1AESA 1SDQA 1KXNA 1V0HX 3HDLA 1Z53A 1SOGA 2CCPA 1CMQA 3E2NA 2RBTX 5CCPA 6CCPA 1DSGA 2AS2A 5JHXA 1MN1A 2ANZA 2AS4A 4CVJA 4JMSA 4C51A 1JCIA 2GHKX 3M2FA 2E3AA 3VLHA 1KZMA 3Q3UA 2VCFX 4BLKA 5KSFA 3VLJA 4NFGA 1JDRA 1LY9A 1CCIA 4NVFA 2CL4X 1DCCA 4A71A 1ML2A 1AEVA 4FDQA 1CMPA 2EUUA 2RC1X 4NVIB 1AC4A 1YZRA 2XIHA 2X08A 5AL9A 1H5FA 1H5IA 1U2LA 4NVLA 3FKGA 4JQNA 5ABOA 1DJ1A 1AC8A 1DSPA 1H5EA 1H5JA 1CCKA 1CCBA 1CCCA 4NVBA 1YYDA 2GB8A 4A7MA 3M2EA 3WNUA 4NVGB 1AEOA 1KXMA 4JN0A 4BM3A 2W23A 1GWTA 2RBYX 5EJTA 3VLLA 1CMTA 2RBXX 1DJ5A 2X07A 1ZBZA 4BLNA 1FHFA 2XJ5A 5SW5A 4A6ZA 4BM4A 1ZBYA 4XV4A 2VO2X 3M29A 1LYCA 5SX6A 4JM6A 4JMWA 2ATJA 2RC2X 1CYFA 3FJWA 1BESA 2B0ZA 1MKRA 4FCNA 3VLMA 5D6MA 2Y5AA 5SXXA 3M26A 5SYKA 1LY8A 1BEJA 4A78A 5SX7A 5SX0B 1LYKA 4JQMA 2XILA 1PA2A 4P4QA 1BVAA 5SXSA 4FCSA 1QO4A 4NVMB 4NVAA 1AEHA 4G05A 1YYGA 5KSKA 1CK6A 4CZOA 4CZNA 4JM9A 2GHHX 4XV5A 2XIFA 7CCPA 1DSOA 5JHZA 1LGAA 5SX1A 5SX3A 1CPGA 2VCNA 5KQIA 3M2HA 5ABNA 3FM6A 1OAGA 1AEDA 4BM2A 4XVAA 4NVCA 5JHYA 1AA4A 1AEGA 1KRJA 1AEEA 4JPUA 5CIBA 2EUQA 1H5DA 1W4WA 1H5AA 1LLPA 2AS6A 2EUNA 5FNBA 1BGPA 1STQA 4JQKA 1DS4A 1GW2A 3WXOA 1U2KA 4JQJA 2CCDA 3CCXA 1KOKA 1SBMA 2JTIA 2AS1A 3FM1A 3UT2A 4JM8A 2XI6A 4JMBA 2IA8A 1MKQA 1GX2A 5CIFA 1H5KA 1H5LA 4CZRA 6ATJA 1CCEA 3EXBA 5SYYA
chains in the Genus database with same CATH superfamily
2J62A 4JI6T 3AA0B 2BOQA 4JPLA 5IUXA 2V5DA 4GK0E 2ZM8A 3UUMA 5CIGA 3F57A 2VNZX 1YD8G 4NIQA 4PFOA 5CA0E 3UT5E 4NVNB 3ONLC 5JH7E 2CYPA 4U2ZA 3C50A 1ARUA 2D2SA 4JUYA 3ZCHA 5LA6E 2ZLYA 3AA7B 4ZI2C 2WS3A 4HFDA 1E7PA 2A2FX 2EUTA 1BEMA 4NVJB 4XV8A 5JREA 4EYYR 3CCPA 2VL8A 2LSGA 4WYVA 5EJXA 1SHZC 5A1LA 3TLVA 4EV6A 3M65A 2RBZX 1H7CA 2E9XA 4UVBB 4TWHA 2X0HA 1J5ET 3X1LF 4N78D 3KV6A 3B13A 4JV5T 2V26A 3ZCGA 3O1IA 4DUYT 4LF5T 3SOLA 2ICVA 4CCPA 1NWMX 5AQNB 5GONE 2LSJA 2XQYA 3LDQB 3RLFF 5KQ0A 3RPUA 5SXRA 1IYNA 1MMGA 3W15B 2RC0X 3M2IA 1ARWA 2A9UA 4AQFA 1UURA 1CCJA 3M2BA 4JMVA 1KF6A 1HG5A 2V6YA 1NEKA 5SXTA 4QX7B 1AEMA 4DIDB 4X1KE 3PUYF 4BLZA 1CCGA 1OAFA 4IE4A 2ES0A 2WZHA 3FHNA 1APXA 2H7VC 4IDZA 3SWHA 2ODVA 5ABFB 3AEDA 3K8PC 1QUUA 3AVSA 3AAEB 1B80A 4NPPA 3UW8A 4CI1B 2I59A 1IBMT 3NRXA 4U72A 5HEJA 5JDGA 3VRBA 4ZI3D 3ZCYA 1EBEA 5IYZE 4XV6A 5L05A 3UTKA 2H3RA 4QHOA 4NVEA 2OA5A 3FXDB 2LLYA 3O1JA 5FY0A 5LXTE 3ZJ2A 3FZMB 4ISSA 4G63A 4U31A 2V7IA 1CHUA 4ZZBA 2DLRA 5EK3A 5LGTB 1WYCA 2EUPA 1BEQA 4I43B 3ZKRA 2AXDS 1BEPA 3RC3A 2GHCX 2LE8A 4NXMT 1G8XA 2KSRA 3N9OA 1HSRA 3ZT7A 5HXRA 1YQ3A 4I0UA 4PK5A 1A2GA 1HNZT 5AQSB 3TLTA 4B6XA 2X9HA 3ATJA 4DNDA 5FVKA 3M2AA 1UX4A 2OV9A 5LOVE 2JQHA 2LM2A 1HF8A 5AQIB 1AEUA 1VCSA 4WZXA 4HWCA 3FBLA 2B12A 1AEQA 3GN5B 5AQFB 4DMWA 5SW6A 2AE9A 5KQ3A 2X9WA 4UXNB 1N33T 2YLJA 2WSSS 3M2GA 5J2UE 4GK5E 4O2BE 4ADZA 4LFAT 4UF0B 4TV9E 3ANWB 1AESA 2A72A 2E9XD 3HDLA 1KXNA 4H9NC 5HCMA 1SOGA 4HWFA 3VKGA 1OEDB 2Q9QA 3UU6A 4X65T 5JDNA 4X1YE 3OTOT 3AEFA 4AXPA 3E2NA 2G0UA 4CXYA 1LRZA 4TX5A 1BR2A 1DSGA 2B1EA 2AS2A 1MN1A 4AQFC 2YKSA 2LHRA 1D1CA 4C51A 1JCIA 1FEWA 4BA9A 1N34T 1VOMA 3HKBE 2QGSA 2VCFX 2GK9A 4DV2T 2BG9B 2CL4X 3Q5EA 4A71A 4F6RC 1ML2A 1CMPA 3GWHA 2BBJA 3MA9A 1J1JA 3Q2MA 2LJLA 4GIWA 4WNKA 5AL9A 3H3AA 3L39A 4JI3T 1T8BA 5LYJE 1AC8A 1CCKA 5AQRB 2VK9A 4QXHB 4NVBA 4HFHA 4PW8A 4HFEA 3M2EA 3AE4A 3PUGA 4ZEYA 4HWDA 1KXMA 4BM3A 4HWHA 2OLTA 1GWTA 2RBXX 5CA1E 4PAGA 5ABHA 5KXJA 3FZFB 3PJAA 2ACZA 4A6ZA 5ABGA 4XV4A 1HNXT 3QNUA 3QOFA 2ATJA 5HXEA 2RC2X 3P8CD 4P0BA 2CA5A 1HX1B 3VLMA 3FZLB 2R6GF 4EIWA 1D0ZA 4EB6E 5SYKA 1E1HB 3H37A 1LY8A 5FP3A 3PV0F 5JR9A 4HWIB 2KINB 2LHNA 2E2AA 1MIWA 1QSDA 5SXSA 4ZS3A 2V7JA 4ILUA 1AEHA 1ZEEA 1YYGA 2XASB 4KMCA 5DJQC 2GHHX 4XV5A 3R84B 5EK2A 2XIFA 3AEBA 1WR0A 4YT0A 1NAFA 1IJ5A 3UUBA 2WMOA 2UXCT 3UU8A 2UXBT 4QH1A 4GYRA 3AB3B 5FYMA 4CN6A 4Z90A 3PU8A 4NUVA 4LMLA 2YINA 4EZ4A 4BM2A 2Q9QC 4XVAA 5JHYA 4DBRA 1ZP0A 2XSBA 3DP7A 3N2GE 2RA1A 4NXNT 3CVRA 3VR8A 4JPUA 1BR4A 4AISA 2HN2A 2Q9QD 4U33A 3N9NA 1WRDA 3RIAA 3ZMVB 4EOZB 2XAGB 4KUMB 3VRAA 1H5AA 3UU4A 2XAFB 4AKIA 3ZN0B 4H7AA 4AKRB 3AXJA 2YN6A 4YLHA 3CKDA 3S4UA 2CCDA 1KOKA 1E2AA 4QH4A 1ZHCA 2RPAA 4ZHQE 2JTIA 2AS1A 3PUWF 3RHWA 2KNDA 4JM8A 1XMQT 3TLSA 4IREA 5C8YE 3AA6B 3NBXX 2D9DA 2N1GA 1H5KA 4DV4T 1YKHB 1CCEA 5SYYA 3M23A 1AEKA 3ONJA 2UUCT 2XAJB 1H57A 2BS4A 2JMHA 4AKGA 3AEGA 4WW0A 4GKFA 2VL0A 4UVCB 4TN7B 2LRLA 2V8SV 4WBOA 3KV4A 4GEDA 2W63A 4IGUA 3AA1B 4DR3T 5BR8T 1KNZA 4KX6A 4NVKB 1H5GA 4H9RC 5DQWA 2JJ9A 2V1DB 3QB5K 4IDOA 1YZPA 4HE8A 5JTGA 1OXZA 3Q5XA 4DR1T 3FMUA 4BLXA 4DUZT 2V23A 3X1DA 2B10A 5SYHA 4CN1A 4CVIA 4CUOA 3U3IA 4IDPA 3PDYA 5KQKA 5JDQA 1XNQT 1H5MA 4PJJA 3UFEA 1IJ6A 4QYZB 2XJ6A 3KFWX 2X0LB 2WWVA 4HFVA 1AEBA 2AQDA 4IE0A 5AQOB 2WD4A 3HI2A 2WY2A 5LHHB 3C4ZA 3P4QA 4OX9T 1RYCA 4CZZB 3ZMUB 3Q5DA 4O8SA 4JPTA 2XQAA 1ARYA 5H6RB 5CJHA 2W00A 5AQKB 1M7KA 4L5GA 3ETVA 4JMZA 2LSYA 2C5IT 4EZHA 3UUNA 1DU2A 4ERRA 3ZMTB 3KVAA 3ZT6A 4IHJE 4NVHB 2UUBT 2FJBA 1S73A 2WB5A 2IUBA 4O4HE 4TWDA 4NUUA 4BM0A 1Y64B 2Y6BA 2SPCA 2V6XA 4ZZCA 3LK3B 5TAOA 4EGWA 3R98A 4DVDA 2XQ6A 2WDRA 3CPZA 4JEUB 1DSEA 1AEFA 3E2OA 2YEVC 1IBKT 2WU5A 1GQEA 5EK4A 1QPAA 2BKOA 2JQ9A 1X79A 5ALAA 1HG2A 5HEGA 4GKJT 1B85A 1H58A 2PFVA 2Y8DA 4OYJA 4DBQA 2JQQA 2CCAA 4E7ZA 2EURA 1AENA 3RX6A 4UV8B 3EI0A 2WP9A 4DV6T 3M5QA 3I0OA 4B3ST 3RIFA 4XZCA 4A98A 2EUOA 1HX8A 2HPLA 1GWOA 5CIDA 4YHJA 2XJ7A 3IBPA 2CXLA 3V5UA 5SX0A 3WAJA 5KQHA 3KBUA 3NRYA 2CBJA 3RRWA 5E0OA 1CPDA 2XM2A 2W4XA 5CFBA 4BLLA 4ILBA 2N9DA 2X9YA 5L02A 5SYWA 3O1HA 3ZJ1A 7ATJA 2PBIA 2ZM0A 4YHHT 2VQFT 4IE5A 4CZPA 1A2FA 5JPRA 2C5KT 2V2EA 4TUYE 3RRCA 2VKAA 2J47A 1V0HX 1Z53A 3PU3A 3Q9DA 4XAXB 5LBMA 2WAUA 4HTEA 4YXDA 5LB7B 4U7YA 2LM9A 3VU7H 1HR0T 4ILAA 4EAHA 6CCPA 2CPTA 5JHXA 2ANZA 5F3JA 4P09A 2LT3A 4LFBT 4QXCB 3M2FA 3QUJA 2Q9QB 2X51A 4KI0F 4A56A 4ANJA 1WCRA 3VLHA 4E7SA 1WR6A 1KZMA 3AE7A 4ZI3C 2NWBA 4TV8E 3PUAA 1JNZA 3VLJA 3K3OA 4JI8T 2D0TA 1DCCA 3P4WA 5C3JA 1IZNB 4COFA 5L3DB 3JAFA 3RYCE 4EEBA 3P7IA 2EUUA 2RC1X 2CCQA 5BMVE 4NVIB 5FXWA 2H7OA 1AC4A 5J0ZA 2XIHA 3EVYA 1IBLT 1H5FA 2XQ3A 4NVLA 5AQJB 5ABOA 3QC9A 4L9IA 3CX7B 1CCCA 2IDOB 4YJ3E 3WNUA 2XQ8A 4NVGB 4JN0A 4IT4A 2W23A 4YJ2E 3VLLA 2C0SA 3OVUA 4JI5T 1CMTA 3U78A 3TLWA 1QLBA 2FUPA 2LOPA 4WBNE 4BLNA 1FHFA 2XJ5A 2FJDA 2K48A 2K3WA 5LG4A 2VO2X 3UU3A 4JM6A 3AEEA 2WMNA 2N2NA 3N2KE 1BESA 4YSZA 1B7TA 1KK7A 4TNWA 3M26A 2W62A 5ADXL 1BEJA 5JQGE 2X9XA 3RYIE 3UFGA 4P4QA 3HA4A 1VRBA 1BVAA 2QVAA 2E9XC 4NVMB 4QX8B 4H9QC 3ZYLA 2CEAA 1CK6A 2KXPB 3UUXB 2ZM6T 4ZS2A 1W0BA 3ZCJA 4IL4A 7CCPA 4YTMA 3P4SA 5JHZA 2IC6A 4B3RT 1LGAA 4EYUA 2VCNA 3AE6A 3BQLA 3M2HA 5CJ5A 1MNEA 3WI3A 1UK5A 5LHGB 3CQCB 1LKXA 4B3TT 4GYSA 1OAGA 1JNRA 1AA4A 2FBWA 3CWZB 2YU2A 4X20E 4JLEA 2WZIA 3ZC0A 5JDMA 2VURA 3NKZA 3RGLA 4Q25A 1MNDA 2EUQA 1KEYA 4F8HA 2PJQA 2J1DG 2WM9A 3KBTA 2EUNA 3LK2B 5HXSA 1BGPA 2PG8A 3RQWA 4CXWA 5LJNA 4JQKA 1DS4A 3R6NA 1Z8UA 3C4WA 1AJ3A 1SBMA 3FM1A 3H3MA 2FJEA 3UT2A 2DWGA 3OKQA 3CK6A 2IA8A 1MKQA 1M62A 3J9X1 5L3GB 2VWAA 3ZLIA 1W0AA 6ATJA 3EXBA 5LGNB 1SCHA 1U75A 2CWYA 1GWUA 1AEJA 3PUQA 1D0YA 1MN2A 5SYJA 5FNEA 1BEKA 2BCNA 1H55A 2CLYC 5AQUB 3M25A 4QXBB 4YFSA 4IIJE 4A97A 1H3JA 4C50A 1XDOA 3VLKA 3AE2A 5SXWA 5AQVB 1ARVA 4A5XA 2W61A 2B76A 5AFUL 2RBWX 3GN5A 4X64T 4H79A 2XTLA 3P4PA 3BQIA 5FXXA 1BJ9A 5FMNA 1MK8A 1SJ2A 5FKYA 5CICA 5SYLA 2PCBA 1CCAA 3RIVA 1UGOA 4UF0A 4AI6A 3PURA 4DV7T 2GHDX 4ISTA 5H9FB 4DV5T 3ANWA 2YU1A 2Z6EA 1XZYA 1KNRA 1UB2A 4UIGA 2QRXA 5HWXA 1BR1A 4H63V 4X5TA 2VB6A 4DR6T 3KINB 3A8YC 3ZEFB 3VLIA 1U4QA 4LF6T 1HTJF 2VCSA 3LK42 4IE7A 4OFZA 5ETWA 5AQMB 4GOUA 4I4TE 4UELA 3RC8A 3CX8B 2X68A 3QB5A 4JBWF 4Z91A 3SRZA 4AKLA 3O9XA 2CMRA 2GGNX 2RBVX 2F4VT 5FL1A 5AQGB 4QWNB 4TZ4C 5SYUA 1Y01A 3N9QA 4OQ7A 1H5HA 2UXXB 4H9OC 3WAKA 1G73A 3UQ7A 2PTFA 3DTOA 2DCFA 2YOEA 3N2OA 5LGUB 1S35A 1FMWA 5SW4A 5LP6E 2OEBA 4AQGA 4K0UA 1UX5A 2NTXA 1U2JA 4DV3T 4JI1T 1CPFA 3C64A 1MIVA 1QGJA 5AOGA 2KLQA 3J7Yq 3K1SA 1V9DA 2RBUX 4ZI7E 3VHLA 1CCPA 4MBQA 4NVOB 1SA0E 3NZPA 5KQ2A 3UQ4A 2E8IA 4JMAA 2Y6AA 4H9PC 4PAEA 2VVSA 4YSXA 1C8IA 4OHFA 3HR0A 1CPEA 3L3PA 3M8MA 1H5CA 5SXQA 4HFIA 2CM0A 3CX6B 5LCYA 1ATJA 5L3BB 1U74A 5JVDE 4P0AA 2M6IA 1LVKA 3X16A 5EZYE 2VVNA 3SS1A 4AQYT 2XPKA 4JM5A 4U7UB 5HCJA 3PE0A 3CIRA 3ZYMA 1YXRA 4OK0A 1ITKA 1O3XA 2BVLA 4CQIA 4JMTA 1HCHA 1IAPA 2Y48B 4MHCA 3TLUA 2K24A 4FEFA 4O4IE 2W2UA 1MMNA 2LEHA 2X66A 3M27A 3ZMZB 2WCAA 5JR9C 2WSSV 1XWMA 4HFBA 2VNXX 4CZQA 1D1BA 5CD4J 1OEDE 2J4GA 1US7B 5JRCA 3OYXA 2KWIB 3RKGA 3AE1A 2LSKA 3AAAB 1MNPA 5F5WA 3AVRA 2E9XB 2MBGA 3EAMA 5IHYA 3AAIA 1T7SA 4JI0T 3I0QA 4UR9A 2XSAA 2BS3A 2NP9A 4M1PA 1SDQA 2XQ5A 2CCPA 5LMNT 2V7LA 2WWUA 2RBTX 5CCPA 3KDSE 2WU2A 2AS4A 2BG9E 3ZMSB 3NZQA 3N9PA 5HXCA 5LHIB 2V6YB 2CXDA 2XM1A 3DJBA 1HCIA 5L3FB 5L2LA 3LBXA 4OYKA 3LSVA 2CXFA 5HWYA 5FY1A 2L3LA 4NFGA 1JDRA 1LY9A 4JI2T 1CCIA 1ABVA 1N36T 2UU9T 3NVOA 2IHR1 4FI5A 1AEVA 4DR4T 3RH3A 3KV9A 3AE8A 4BJMA 4DV1T 2IIUA 3ABVA 3LFMA 5H9EB 4G2AA 1YZRA 3AECA 3ZN1B 5IWAT 2BKPA 2X08A 4PK6A 4ASKA 2X0YA 4JQNA 1DJ1A 3MK7C 1CCBA 2ZOPA 2BO5A 2DNXA 4CXXA 4JEHB 5CB4E 3ZCIA 1YKEB 4A7MA 1FJGT 3IHRA 2NW9A 1AEOA 1LVFA 4FJOA 5AQPB 2RBYX 1L0VA 1DJ5A 2QA7A 5AQTB 2XQ7A 5JDLA 1ZBZA 1FIOA 3ETUA 1N32T 2HPJA 5KMGP 4CI3B 2UUAT 3M29A 1LYCA 5SX6A 2CLYB 4JMWA 3FB2A 2NW8A 5LBQB 1CYFA 2B0ZA 2ZCAA 4FCNA 2W66A 2Y5AA 5SXXA 2EHOA 4HEAA 2H88A 2QYWA 4HFCA 1HFAA 4LF9T 4ZOLE 4A78A 3EDVA 2XAQB 4ZI2D 1LYKA 2MTQA 2XILA 1PA2A 4DR2T 1X9BA 3M3ZB 4FCSA 4DR7T 1QO4A 5FNVE 4PFPA 3ESLA 3FZKB 3UULA 4G05A 5KDMC 3LJCA 4CZOA 2V5CA 2XY8B 4CZNA 4O4JE 3RYHE 4JM9A 1ZKEA 3RIUA 2WDQA 1DSOA 3N5LA 4DO0A 2LKHA 1HNWT 4B3MT 2KT9A 1CPGA 5KQIA 2ZM2A 4X66T 2UXDT 3E0ZA 4YY3T 3T1HT 3PUZF 3FM6A 3KVBA 4NVCA 3A7MA 1KRJA 3PUSA 4O4LE 1YW0A 4KP3C 4EEDA 1AEEA 3CQXC 5CIBA 1H5DA 4JZAA 1LLPA 2AS6A 4GKKT 1FMVA 2VKJA 3RI5A 3I9WA 3T1YT 3F2EA 2NW7A 5LMUT 1GW2A 3PJAJ 4Z8XA 2XQ9A 2YDSA 1U2KA 4JQJA 3OYZA 2BBHA 3CCXA 5L3CB 2KWHA 3E22E 2E5VA 4LF8T 2HHHT 3SFDA 2JIWA 2VQET 2XI6A 2BZBA 3RKOA 4JMBA 3ZSTA 3B57A 2KZ7B 4KBMB 1WYBA 3I9YA 2V7KA 3CQGB 1GX2A 1H5LA 4X62T 4CZRA 4YTNA 4V1Av 4LF7T 1OWAA 2D5UA 3SFEA 3O4XE 2IMLA 1R8IA 3Q5WA 4JI4T 4DMVA 1S6VA 2P9BA 3AE3A 1W09A 2EUSA 2AS3A 2MYSA 1VCTA 3L8RA 5JDFA 1CMUA 2MOZA 3V5SA 4TNVA 5AMMA 2I6HA 2LKGA 2KMFA 5L47A 5L3EB 4K0KT 1SUMB 1AETA 3G06A 4EXTA 1D1AA 5LG3A 2B11A 4ILCA 2IW5B 4AIUA 3GMIA 5SX2A 2EHOC 5L4HA 2PCCA 5H6QB 4P1NA 2L9QA 2Y6XA 3E08A 3P4RA 3BQKA 5JR9B 4HKAA 5SYIA 4DV0T 3K3QC 3FZHB 2EHOD 4XV7A 3MZKB 4CCXA 4U2YA 2DWKA 3FXEB 3HL6A 2E3BA 3BK9A 1D0XA 3ZSSA 1HS7A 2MPKA 3UU5A 3EABA 1ARXA 3RIUC 3ONXA 3HKEE 5ABFA 5HXHA 4PJNA 2YDQA 2W67A 5L86A 2VKHA 4YTPA 4BM1A 2E39A 3JCFA 5JQRA 1KNPA 3JADA 4CN4A 3ZYKA 3AE9A 4NVDA 3KV5A 3PUVF 5C2TA 2BVMA 2JPFA 5DABA 3C98B 1GZBA 4IL9A 4A5GA 2MAWA 3LG7A 4MALA 4MFRA 3IA3A 4U74A 4QH5A 3R99A 3CMLA 3C51A 3AXJB 3D0TA 1B82A 3M28A 5CIHA 2W0GA 1ARPA 5LJMA 1S94A 3F31A 2GHEX 3FM4A 2XJ8A 3MXZA 5HEOA 4LF4T 5FL0A 3PUXF 2K9AA 1WLXA 2UXNB 3AEAA 4HGAA 4C90A 2YCGA 5DQVA 2WBLA 2CEPA 4UV9B 3M2DA 3MACA 2DHRA 3A5XA 4PJMA 5KQ6A 1MIYA 3N9MA 1GZAA 4JB4A 1U5PA 2D0UA 3EDUA 3RIWA 2JQKA 3M2CA 2BS2A 4USCA 2L8KA 1CCLA 4I50E 4ZXLA 2IAKA 2XHEB 2LOSA 4IE6A 2ODUA 3C4XA 5ABQA 4ATJA 4BJNA 4LFCT 4PJLA 3ZPOA 5SYVA 3ZC1A 1MMAA 2E5LT 2JMXA 4XBFB 2M67A 1Z0PA 3MKDA 5KX5E 2ZMAA 5HAXA 4PK4A 5CIEA 2X67A 1BR0A 2N18A 5SYXA 3MJXA 5AQQB 1OEDA 1CUNA 4YSYA 1W4YA 4IDNA 4BLYA 1ZOYA 5AQLB 3IF8B 3EUHA 3RQUA 5L4EA 2VKOA 5JRCB 2CBIA 5FXZA 1CMQA 1T72A 3FBZA 5JDHA 1W9RA 1ZV4X 2VASA 4CVJA 5HEHA 2CRBA 2BG9A 5ABEA 2C5JA 1WFDA 2XUEA 2HH7A 4JMSA 3OPCA 2GHKX 4JI7T 2CE7A 2E3AA 2CHNA 2NR4A 2M6BA 3QK6A 3Q3UA 1YQ4A 4BLKA 5KSFA 3B5MA 3VKHA 5FXVA 3HKCE 4AKHA 1UUSA 4NVFA 1MMDA 1NENA 2YDRA 4QKNA 4FDQA 4H9SE 1SE7A 3L09A 3LBXB 5CGMA 5J2TE 2DL1A 2BDEA 2XAHB 2VKDA 1I94T 3WA8A 4HN9A 1H5IA 1U2LA 3JC6C 3EHZA 3FKGA 2XZEA 1DSPA 1H5EA 2JRKA 1H5JA 3GA8A 1YYDA 2GB8A 4UVAB 1EZ3A 4X1IE 3JC6D 3OBVE 4JYAT 3OJAA 5EJTA 2WDVA 2X07A 5SW5A 2XQ4A 4BM4A 4MLKA 3RYFE 1ZBYA 4J2CA 1J5WA 1KFYA 1XDPA 2WQYA 3FJWA 5AQHB 1MKRA 2JMKA 5D6MA 2K5BB 3I1AA 3AE5A 5SX7A 4LMKA 5SX0B 3N9LA 4JQMA 4KHPT 2IC9A 4U7IA 4NVAA 2CHOA 4H63H 5KSKA 2EHOB 4L0RA 3P50A 3HKDE 4BAYB 5HYAA 2CWOA 2A3DA 2NOXA 5F8PA 1OEDC 5SX1A 5SX3A 5FY7A 5J1GA 4I55E 1XMOT 2FJAA 3VR9A 1T98A 3TKLB 5ABNA 5LNKA 1XNRT 2NTYA 2RP4A 4KHZF 5M4YA 3JAEA 4U3CA 1AEDA 1AEGA 3ZT5A 2LRKA 2BKNA 4CI2B 3K3NA 4O2AE 3RF1A 2YK0A 4TWFA 2LSIA 2DI4A 1UCUA 2BG9C 2I0MA 1W4WA 3IEEA 3T8OA 5FNBA 5FVLA 4LMJA 1STQA 4IDQA 4PNIA 5HEUA 3WXOA 2HN1A 4DR5T 4C91A 3PTRB 3NWIA 2A7UB 4UEMA 2H89A 5CIFA 2ACXA 1I6ZA 2V7MA
chains in the Genus database with same CATH topology
1SCHA 1U75A 2CWYA 3AA0B 2BOQA 1OWAA 1GWUA 2D5UA 3M23A 3O4XE 1AEKA 4JPLA 1AEJA 3PUQA 1D0YA 1MN2A 2XAJB 4GK0E 3Q5WA 2ZM8A 5SYJA 4DMVA 1H57A 3UUMA 5CIGA 1S6VA 5FNEA 3F57A 2P9BA 2JMHA 4AKGA 2VNZX 1BEKA 1YD8G 4WW0A 4PFOA 2BCNA 1H55A 2EUSA 2AS3A 5CA0E 2MYSA 2CLYC 4UVCB 5JDFA 1CMUA 2MOZA 4NVNB 3M25A 3UT5E 4TN7B 4QXBB 2CYPA 4WBOA 5JH7E 3C50A 3KV4A 3V5SA 4GEDA 2W63A 4YFSA 4E7ZA 1ARUA 4IGUA 4IIJE 5AMMA 2D2SA 4JUYA 3ZCHA 3AA1B 1H3JA 4C50A 3VLKA 5LA6E 2KMFA 2ZLYA 3AA7B 5L3EB 5SXWA 4ZI2C 1KNZA 4NVKB 1H5GA 4H9RC 5DQWA 1ARVA 1AETA 2JJ9A 2A2FX 2V1DB 1YZPA 2W61A 2EUTA 4HE8A 1BEMA 4NVJB 4XV8A 5JREA 1OXZA 3Q5XA 4EYYR 4EXTA 5AFUL 2RBWX 3CCPA 3FMUA 2LSGA 1D1AA 2VL8A 4BLXA 3GN5A 5EJXA 4H79A 1SHZC 5A1LA 2B11A 2V23A 2XTLA 3BQIA 2IW5B 5FXXA 1BJ9A 2B10A 1MK8A 5SYHA 3M65A 3GMIA 5FMNA 2RBZX 4CVIA 5SX2A 1H7CA 1SJ2A 2E9XA 4UVBB 2EHOC 5CICA 5SYLA 4CUOA 2PCCA 5H6QB 3U3IA 2PCBA 3PDYA 1CCAA 3RIVA 5KQKA 4N78D 5JDQA 3KV6A 1H5MA 4UF0A 3PURA 4AI6A 2GHDX 2L9QA 5H9FB 4ISTA 3ANWA 3B13A 4PJJA 2Y6XA 3E08A 3UFEA 2V26A 1IJ6A 3ZCGA 2YU1A 3BQKA 5SYIA 3O1IA 4HKAA 2Z6EA 4QYZB 3K3QC 5JR9B 2XJ6A 1UB2A 2EHOD 4UIGA 4XV7A 3SOLA 3KFWX 5HWXA 2X0LB 3MZKB 2ICVA 4HFVA 1AEBA 2AQDA 4CCPA 1NWMX 4IE0A 4CCXA 1BR1A 5GONE 2WD4A 2LSJA 3HI2A 4H63V 2VB6A 2XQYA 2DWKA 3FXEB 5LHHB 3HL6A 2E3BA 3BK9A 5KQ0A 1D0XA 3KINB 3ZEFB 3C4ZA 3RPUA 3VLIA 1HS7A 1U4QA 5SXRA 1IYNA 1MMGA 3W15B 1ARXA 2RC0X 1HTJF 2VCSA 3M2IA 3LK42 1ARWA 4IE7A 4OFZA 4AQFA 1RYCA 1CCJA 3ONXA 4CZZB 3HKEE 3M2BA 4JMVA 5ETWA 3ZMUB 1HG5A 4GOUA 5HXHA 4O8SA 4JPTA 5SXTA 4I4TE 4PJNA 4QX7B 1ARYA 4UELA 1AEMA 4X1KE 5L86A 3RC8A 5H6RB 5CJHA 3CX8B 2VKHA 2W00A 2X68A 4BLZA 3SRZA 4L5GA 3ETVA 4BM1A 4AKLA 4JMZA 2CMRA 3O9XA 2LSYA 1CCGA 2E39A 2GGNX 2RBVX 2C5IT 1OAFA 4IE4A 3UUNA 4EZHA 4KUMB 5JQRA 4QWNB 2ES0A 4TZ4C 3FHNA 4ERRA 3ZMTB 1APXA 2H7VC 4IDZA 5SYUA 3KVAA 2ODVA 3SWHA 3ZYKA 3KV5A 4NVHB 4NVDA 3N9QA 4IHJE 4OQ7A 1S73A 1H5HA 2BVMA 2UXXB 2JPFA 4H9OC 5DABA 3C98B 1GZBA 3WAKA 1G73A 3K8PC 1QUUA 3AVSA 4A5GA 4O4HE 3LG7A 4NUUA 3AAEB 1B80A 4MALA 4BM0A 1Y64B 3DTOA 2Y6BA 3UW8A 2DCFA 2SPCA 3N2OA 1S35A 1FMWA 5SW4A 3LK3B 4MFRA 5TAOA 4CI1B 5LGUB 5LP6E 2I59A 3R98A 4U74A 4K0UA 4AQGA 4DVDA 1UX5A 2NTXA 1U2JA 3CPZA 3NRXA 4JEUB 3R99A 1DSEA 1AEFA 4U72A 1CPFA 5JDGA 3E2OA 3C64A 4ZI3D 3ZCYA 2YEVC 3CMLA 3C51A 1MIVA 1QGJA 5AOGA 3D0TA 1B82A 1EBEA 3M28A 5CIHA 2KLQA 5IYZE 3J7Yq 4XV6A 1V9DA 2RBUX 5L05A 1ARPA 1CCPA 2W0GA 3UTKA 5EK4A 3VHLA 4ZI7E 5LJMA 2H3RA 1QPAA 1S94A 4MBQA 4NVOB 3F31A 4NVEA 1SA0E 1X79A 5ALAA 2GHEX 3FM4A 5KQ2A 4JMAA 2E8IA 2OA5A 2Y6AA 1HG2A 4H9PC 1B85A 2XJ8A 3MXZA 3ZYLA 4PAEA 2K9AA 1H58A 3FXDB 1C8IA 2PFVA 3O1JA 1WLXA 2Y8DA 2UXNB 4OYJA 5FY0A 5LXTE 4DBQA 4OHFA 4HGAA 4C90A 2YCGA 2JQQA 1CPEA 2CCAA 2WBLA 3HR0A 3M8MA 3L3PA 5DQVA 2CEPA 1H5CA 2EURA 3M2DA 4UV9B 1AENA 3ZJ2A 3RX6A 5SXQA 4UV8B 4ISSA 4G63A 3MACA 2DHRA 2CM0A 3A5XA 3CX6B 4PJMA 5KQ6A 5LCYA 2V7IA 1ATJA 5L3BB 1U74A 2DLRA 5JVDE 3M5QA 3I0OA 4P0AA 1MIYA 5EK3A 5LGTB 3N9MA 1GZAA 4JB4A 1WYCA 4XZCA 1U5PA 2EUPA 2D0UA 1BEQA 1LVKA 4I43B 3EDUA 2EUOA 1HX8A 3X16A 2HPLA 1BEPA 1GWOA 2GHCX 3RIWA 3M2CA 5EZYE 3RC3A 3SS1A 5CIDA 2LE8A 4USCA 4YHJA 2L8KA 4JM5A 1CCLA 4I50E 1G8XA 3IBPA 2IAKA 2CXLA 2XHEB 1HSRA 4U7UB 3N9OA 3PE0A 5HXRA 3ZYMA 3V5UA 2LOSA 5SX0A 4IE6A 2ODUA 3C4XA 4OK0A 5ABQA 5KQHA 3WAJA 4PK5A 1A2GA 4ATJA 4B6XA 1ITKA 1O3XA 3KBUA 4BJNA 2BVLA 4PJLA 3ZPOA 2X9HA 4CQIA 4JMTA 3NRYA 1HCHA 3ATJA 5SYVA 1IAPA 2Y48B 4MHCA 3ZC1A 4DNDA 3RRWA 5E0OA 1CPDA 4CXXA 1MMAA 3M2AA 1UX4A 2K24A 5LOVE 4BLLA 4FEFA 1HF8A 4O4IE 4XBFB 2M67A 1Z0PA 3MKDA 1MMNA 2LEHA 5KX5E 2ZMAA 1AEUA 2X66A 4PK4A 3M27A 5HAXA 3ZMZB 5CIEA 2X67A 1BR0A 2N9DA 2WSSV 5JR9C 2X9YA 5L02A 3FBLA 5SYWA 2B12A 2N18A 1AEQA 2VNXX 3O1HA 4CZQA 1D1BA 3GN5B 5SYXA 5CD4J 3MJXA 5JRCA 1US7B 3OYXA 2KWIB 3ZJ1A 4DMWA 5SW6A 5KQ3A 1CUNA 2LSKA 2X9WA 3AAAB 7ATJA 2PBIA 1W4YA 1MNPA 4UXNB 2ZM0A 4QHOA 2YLJA 4BLYA 3AVRA 2E9XB 3M2GA 4IE5A 2MBGA 5J2UE 4GK5E 4CZPA 4O2BE 3AAIA 5IHYA 1A2FA 5JPRA 4ADZA 2C5KT 3I0QA 2V2EA 4TUYE 3IF8B 4UF0B 3EUHA 3RRCA 4TV9E 3ANWB 2VKAA 1AESA 2A72A 2E9XD 2NP9A 4M1PA 1SDQA 1KXNA 1V0HX 3HDLA 1Z53A 4H9NC 1SOGA 3PU3A 3VKGA 2VKOA 3Q9DA 4XAXB 5JRCB 2CCPA 5LBMA 2Q9QA 2WAUA 4HTEA 4X1YE 5JDNA 5FXZA 2LM9A 2V7LA 4AXPA 1CMQA 3E2NA 2G0UA 2WWUA 4CXYA 3VU7H 1LRZA 3FBZA 2RBTX 5CCPA 4TX5A 4EAHA 6CCPA 1BR2A 1DSGA 2B1EA 2AS2A 5JDHA 3KDSE 5JHXA 1ZV4X 2VASA 1MN1A 4AQFC 2ANZA 2AS4A 5F3JA 4CVJA 3ZMSB 4P09A 3NZQA 2LHRA 2C5JA 2LT3A 3N9PA 1D1CA 2XUEA 2HH7A 4JMSA 4QXCB 4C51A 5HXCA 1JCIA 1FEWA 5LGNB 2GHKX 5LHIB 3M2FA 4BA9A 3QUJA 2Q9QB 2CE7A 2CXDA 2X51A 4A56A 2E3AA 3DJBA 1HCIA 4ANJA 5L3FB 3VLHA 4E7SA 1WR6A 1KZMA 1VOMA 3QK6A 5L2LA 3HKBE 3Q3UA 3LBXA 4OYKA 4ZI3C 2QGSA 2VCFX 2NWBA 4BLKA 5KSFA 2CXFA 2GK9A 3VKHA 4TV8E 5HWYA 3PUAA 5FY1A 5FXVA 2L3LA 3VLJA 3HKCE 4NFGA 3K3OA 1JDRA 1LY9A 1CCIA 4AKHA 2D0TA 4NVFA 2CL4X 1MMDA 1DCCA 4A71A 1IZNB 1ML2A 4F6RC 4QKNA 4FI5A 1AEVA 4FDQA 4H9SE 5L3DB 1CMPA 3RH3A 3P7IA 3KV9A 3GWHA 3RYCE 2EUUA 4BJMA 2RC1X 2CCQA 3L09A 3LBXB 5BMVE 3MA9A 4NVIB 3LFMA 5FXWA 5J2TE 2H7OA 3Q2MA 1AC4A 5H9EB 4G2AA 1YZRA 3ZN1B 2XIHA 2BDEA 2LJLA 3EVYA 2XAHB 2X08A 2VKDA 4GIWA 4PK6A 5AL9A 4WNKA 3WA8A 4HN9A 3H3AA 1H5FA 1H5IA 4ASKA 1U2LA 3JC6C 4NVLA 3FKGA 4JQNA 5ABOA 5LYJE 1DJ1A 1AC8A 1DSPA 1H5EA 1H5JA 1CCKA 2JRKA 3GA8A 3MK7C 3QC9A 4L9IA 2VK9A 1CCBA 3CX7B 1CCCA 2DNXA 4NVBA 3NZPA 1YYDA 4JEHB 4PW8A 4QXHB 4YJ3E 5CB4E 3ZCIA 2GB8A 4A7MA 1EZ3A 1YKEB 3IHRA 4UVAB 3M2EA 3WNUA 3PUGA 4X1IE 2NW9A 4NVGB 3JC6D 3OBVE 1AEOA 1KXMA 4JN0A 4BM3A 1LVFA 2W23A 4FJOA 4YJ2E 1GWTA 2RBYX 5EJTA 3VLLA 3OJAA 2C0SA 3U78A 1CMTA 2RBXX 5CA1E 4PAGA 1DJ5A 2QA7A 5JDLA 2X07A 1ZBZA 4WBNE 2LOPA 4BLNA 1FIOA 1FHFA 2XJ5A 3ETUA 5SW5A 2K48A 4A6ZA 4BM4A 5LG4A 4MLKA 3RYFE 1ZBYA 2HPJA 5KMGP 4XV4A 4CI3B 2VO2X 3M29A 4J2CA 1LYCA 5SX6A 4JM6A 2CLYB 4JMWA 2ATJA 3FB2A 5HXEA 2RC2X 3P8CD 2NW8A 2WMNA 5LBQB 2N2NA 4P0BA 2CA5A 1CYFA 3N2KE 3FJWA 1BESA 2B0ZA 1MKRA 2ZCAA 4FCNA 3VLMA 1B7TA 1KK7A 2JMKA 4EIWA 1D0ZA 5D6MA 2Y5AA 5SXXA 3M26A 2W62A 4EB6E 5SYKA 2EHOA 5ADXL 2K5BB 1E1HB 3H37A 1LY8A 4HEAA 5FP3A 3I1AA 1HFAA 4ZOLE 1BEJA 4A78A 3EDVA 5JQGE 5SX7A 2X9XA 2XAQB 3RYIE 5SX0B 5JR9A 4ZI2D 3N9LA 1LYKA 4JQMA 2MTQA 2XILA 2KINB 1PA2A 4P4QA 2LHNA 3HA4A 1MIWA 1BVAA 1QSDA 5SXSA 1VRBA 4FCSA 2IC9A 1QO4A 2E9XC 4NVMB 4ZS3A 2V7JA 4ILUA 4PFPA 5FNVE 3ESLA 4QX8B 4NVAA 4H9QC 3UULA 1AEHA 4G05A 1ZEEA 1YYGA 4H63H 5KSKA 1CK6A 2CEAA 3LJCA 2EHOB 2XASB 5KDMC 4L0RA 2KXPB 4KMCA 4CZOA 5DJQC 3HKDE 3UUXB 4BAYB 4ZS2A 5HYAA 4CZNA 4O4JE 2CWOA 2A3DA 3RYHE 4JM9A 2NOXA 2GHHX 4XV5A 1ZKEA 3R84B 5F8PA 3ZCJA 2XIFA 5EK2A 7CCPA 1DSOA 3N5LA 5JHZA 4DO0A 2IC6A 1LGAA 5SX1A 4EYUA 5SX3A 5FY7A 2KT9A 1CPGA 2VCNA 5KQIA 3BQLA 2ZM2A 1NAFA 3M2HA 1IJ5A 1MNEA 2WMOA 5J1GA 4I55E 3WI3A 3E0ZA 4GYRA 3AB3B 3CQCB 1T98A 5FYMA 3TKLB 5ABNA 5LHGB 5LNKA 3FM6A 3PU8A 2NTYA 2YINA 4NUVA 2RP4A 3KVBA 5M4YA 1LKXA 4GYSA 1OAGA 1AEDA 4BM2A 4XVAA 4NVCA 5JHYA 2Q9QC 4EZ4A 4DBRA 1AA4A 3CWZB 1AEGA 1KRJA 2YU2A 3PUSA 4O4LE 4X20E 4JLEA 1YW0A 3DP7A 4KP3C 1AEEA 3ZC0A 3N2GE 2RA1A 4CI2B 3CVRA 5JDMA 4JPUA 1BR4A 3CQXC 1MNDA 5CIBA 2EUQA 2Q9QD 3K3NA 1H5DA 4JZAA 4O2AE 2PJQA 3N9NA 2YK0A 1WRDA 3ZMVB 2J1DG 2DI4A 1UCUA 2LSIA 2XAGB 4EOZB 1W4WA 2WM9A 3IEEA 1H5AA 1LLPA 2AS6A 2EUNA 5FNBA 3KBTA 3LK2B 2XAFB 3T8OA 5HXSA 4AKIA 1FMVA 2VKJA 3I9WA 1BGPA 2PG8A 4CXWA 1STQA 4JQKA 3F2EA 2NW7A 4H7AA 1DS4A 3ZN0B 5LJNA 3R6NA 4PNIA 4AKRB 1GW2A 4Z8XA 4YLHA 3C4WA 3CKDA 3WXOA 1AJ3A 1U2KA 4JQJA 3OYZA 3S4UA 2CCDA 3CCXA 1KOKA 5L3CB 1SBMA 1ZHCA 4ZHQE 2KWHA 3E22E 4C91A 2JTIA 2AS1A 3FM1A 3UT2A 2DWGA 3PTRB 2KNDA 4JM8A 3OKQA 2XI6A 2BZBA 3RKOA 4JMBA 3B57A 2IA8A 2KZ7B 1MKQA 4KBMB 3J9X1 5C8YE 4UEMA 5L3GB 1WYBA 3AA6B 2V7KA 3I9YA 3CQGB 2VWAA 3NBXX 1GX2A 5CIFA 2ACXA 3ZLIA 2N1GA 1H5KA 1H5LA 2V7MA 4CZRA 6ATJA 1YKHB 1CCEA 3EXBA 5SYYA 4V1Av
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCH A;  1U75 A;  2BOQ A;  1GWU A;  3M23 A;  1AEK A;  4JPL A;  1AEJ A;  1MN2 A;  5SYJ A;  1H57 A;  5CIG A;  1S6V A;  5FNE A;  2VNZ X;  1BEK A;  2BCN A;  1H55 A;  2EUS A;  2AS3 A;  1CMU A;  4NVN B;  3M25 A;  2CYP A;  4GED A;  1ARU A;  5AMM A;  3ZCH A;  1H3J A;  4C50 A;  3VLK A;  5SXW A;  4NVK B;  1H5G A;  1ARV A;  1AET A;  1YZP A;  2EUT A;  1BEM A;  4NVJ B;  4XV8 A;  2RBW X;  3CCP A;  3FMU A;  4BLX A;  5EJX A;  2B11 A;  2V23 A;  1BJ9 A;  2B10 A;  1MK8 A;  5SYH A;  2RBZ X;  4CVI A;  5SX2 A;  1SJ2 A;  5CIC A;  5SYL A;  4CUO A;  2PCC A;  2PCB A;  1CCA A;  3RIV A;  5KQK A;  1H5M A;  2GHD X;  3ZCG A;  5SYI A;  2XJ6 A;  1UB2 A;  4XV7 A;  2ICV A;  1AEB A;  2AQD A;  4CCP A;  4CCX A;  2WD4 A;  2E3B A;  5KQ0 A;  3VLI A;  5SXR A;  1IYN A;  1ARX A;  2RC0 X;  2VCS A;  3M2I A;  1ARW A;  1RYC A;  1CCJ A;  3M2B A;  4JMV A;  4JPT A;  5SXT A;  1ARY A;  1AEM A;  5L86 A;  5CJH A;  4BLZ A;  4BM1 A;  4JMZ A;  1CCG A;  2E39 A;  2GGN X;  2RBV X;  1OAF A;  5JQR A;  1APX A;  5SYU A;  4NVH B;  4NVD A;  4OQ7 A;  1S73 A;  1H5H A;  1GZB A;  4A5G A;  1B80 A;  4BM0 A;  2Y6B A;  3UW8 A;  5SW4 A;  3R98 A;  1U2J A;  3R99 A;  1DSE A;  1AEF A;  1CPF A;  3E2O A;  3ZCY A;  1QGJ A;  5AOG A;  1B82 A;  1EBE A;  3M28 A;  5CIH A;  4XV6 A;  2RBU X;  5L05 A;  1ARP A;  1CCP A;  1QPA A;  4NVO B;  4NVE A;  5ALA A;  2GHE X;  3FM4 A;  5KQ2 A;  4JMA A;  2Y6A A;  1B85 A;  2XJ8 A;  4PAE A;  1H58 A;  1C8I A;  2YCG A;  1CPE A;  2CCA A;  3M8M A;  2CEP A;  1H5C A;  2EUR A;  3M2D A;  1AEN A;  5SXQ A;  5KQ6 A;  1ATJ A;  1U74 A;  3M5Q A;  1GZA A;  4JB4 A;  2EUP A;  1BEQ A;  2EUO A;  3X16 A;  1BEP A;  1GWO A;  2GHC X;  3RIW A;  3M2C A;  5CID A;  4USC A;  4JM5 A;  1CCL A;  1HSR A;  5SX0 A;  5ABQ A;  5KQH A;  1A2G A;  4ATJ A;  1ITK A;  4JMT A;  1HCH A;  3ATJ A;  5SYV A;  3RRW A;  1CPD A;  3M2A A;  4BLL A;  4FEF A;  1AEU A;  3M27 A;  5CIE A;  5L02 A;  5SYW A;  2B12 A;  2N18 A;  1AEQ A;  2VNX X;  4CZQ A;  5SYX A;  5SW6 A;  5KQ3 A;  7ATJ A;  1W4Y A;  1MNP A;  2YLJ A;  4BLY A;  3M2G A;  4CZP A;  1A2F A;  5JPR A;  2V2E A;  2VKA A;  1AES A;  1SDQ A;  1KXN A;  1V0H X;  3HDL A;  1Z53 A;  1SOG A;  2CCP A;  1CMQ A;  3E2N A;  2RBT X;  5CCP A;  6CCP A;  1DSG A;  2AS2 A;  5JHX A;  1MN1 A;  2ANZ A;  2AS4 A;  4CVJ A;  4JMS A;  4C51 A;  1JCI A;  2GHK X;  3M2F A;  2E3A A;  3VLH A;  1KZM A;  3Q3U A;  2VCF X;  4BLK A;  5KSF A;  3VLJ A;  4NFG A;  1JDR A;  1LY9 A;  1CCI A;  4NVF A;  2CL4 X;  1DCC A;  4A71 A;  1ML2 A;  1AEV A;  4FDQ A;  1CMP A;  2EUU A;  2RC1 X;  4NVI B;  1AC4 A;  1YZR A;  2XIH A;  2X08 A;  5AL9 A;  1H5F A;  1H5I A;  1U2L A;  4NVL A;  3FKG A;  4JQN A;  5ABO A;  1DJ1 A;  1AC8 A;  1DSP A;  1H5E A;  1H5J A;  1CCK A;  1CCB A;  1CCC A;  4NVB A;  1YYD A;  2GB8 A;  4A7M A;  3M2E A;  3WNU A;  4NVG B;  1AEO A;  1KXM A;  4JN0 A;  4BM3 A;  2W23 A;  1GWT A;  2RBY X;  5EJT A;  3VLL A;  1CMT A;  2RBX X;  1DJ5 A;  2X07 A;  1ZBZ A;  4BLN A;  1FHF A;  2XJ5 A;  5SW5 A;  4A6Z A;  4BM4 A;  1ZBY A;  4XV4 A;  2VO2 X;  3M29 A;  1LYC A;  5SX6 A;  4JM6 A;  4JMW A;  2ATJ A;  2RC2 X;  1CYF A;  3FJW A;  1BES A;  2B0Z A;  1MKR A;  4FCN A;  3VLM A;  5D6M A;  2Y5A A;  5SXX A;  3M26 A;  5SYK A;  1LY8 A;  1BEJ A;  4A78 A;  5SX7 A;  5SX0 B;  1LYK A;  4JQM A;  2XIL A;  1PA2 A;  4P4Q A;  1BVA A;  5SXS A;  4FCS A;  1QO4 A;  4NVM B;  4NVA A;  1AEH A;  4G05 A;  1YYG A;  5KSK A;  1CK6 A;  4CZO A;  4CZN A;  4JM9 A;  2GHH X;  4XV5 A;  2XIF A;  7CCP A;  1DSO A;  5JHZ A;  1LGA A;  5SX1 A;  5SX3 A;  1CPG A;  2VCN A;  5KQI A;  3M2H A;  5ABN A;  3FM6 A;  1OAG A;  1AED A;  4BM2 A;  4XVA A;  4NVC A;  5JHY A;  1AA4 A;  1AEG A;  1KRJ A;  1AEE A;  4JPU A;  5CIB A;  2EUQ A;  1H5D A;  1W4W A;  1H5A A;  1LLP A;  2AS6 A;  2EUN A;  5FNB A;  1BGP A;  1STQ A;  4JQK A;  1DS4 A;  1GW2 A;  3WXO A;  1U2K A;  4JQJ A;  2CCD A;  3CCX A;  1KOK A;  1SBM A;  2JTI A;  2AS1 A;  3FM1 A;  3UT2 A;  4JM8 A;  2XI6 A;  4JMB A;  2IA8 A;  1MKQ A;  1GX2 A;  5CIF A;  1H5K A;  1H5L A;  4CZR A;  6ATJ A;  1CCE A;  3EXB A;  5SYY A; 
#chains in the Genus database with same CATH topology
 2J62 A;  4JI6 T;  3AA0 B;  2BOQ A;  4JPL A;  5IUX A;  2V5D A;  4GK0 E;  2ZM8 A;  3UUM A;  5CIG A;  3F57 A;  2VNZ X;  1YD8 G;  4NIQ A;  4PFO A;  5CA0 E;  3UT5 E;  4NVN B;  3ONL C;  5JH7 E;  2CYP A;  4U2Z A;  3C50 A;  1ARU A;  2D2S A;  4JUY A;  3ZCH A;  5LA6 E;  2ZLY A;  3AA7 B;  4ZI2 C;  2WS3 A;  4HFD A;  1E7P A;  2A2F X;  2EUT A;  1BEM A;  4NVJ B;  4XV8 A;  5JRE A;  4EYY R;  3CCP A;  2VL8 A;  2LSG A;  4WYV A;  5EJX A;  1SHZ C;  5A1L A;  3TLV A;  4EV6 A;  3M65 A;  2RBZ X;  1H7C A;  2E9X A;  4UVB B;  4TWH A;  2X0H A;  1J5E T;  3X1L F;  4N78 D;  3KV6 A;  3B13 A;  4JV5 T;  2V26 A;  3ZCG A;  3O1I A;  4DUY T;  4LF5 T;  3SOL A;  2ICV A;  4CCP A;  1NWM X;  5AQN B;  5GON E;  2LSJ A;  2XQY A;  3LDQ B;  3RLF F;  5KQ0 A;  3RPU A;  5SXR A;  1IYN A;  1MMG A;  3W15 B;  2RC0 X;  3M2I A;  1ARW A;  2A9U A;  4AQF A;  1UUR A;  1CCJ A;  3M2B A;  4JMV A;  1KF6 A;  1HG5 A;  2V6Y A;  1NEK A;  5SXT A;  4QX7 B;  1AEM A;  4DID B;  4X1K E;  3PUY F;  4BLZ A;  1CCG A;  1OAF A;  4IE4 A;  2ES0 A;  2WZH A;  3FHN A;  1APX A;  2H7V C;  4IDZ A;  3SWH A;  2ODV A;  5ABF B;  3AED A;  3K8P C;  1QUU A;  3AVS A;  3AAE B;  1B80 A;  4NPP A;  3UW8 A;  4CI1 B;  2I59 A;  1IBM T;  3NRX A;  4U72 A;  5HEJ A;  5JDG A;  3VRB A;  4ZI3 D;  3ZCY A;  1EBE A;  5IYZ E;  4XV6 A;  5L05 A;  3UTK A;  2H3R A;  4QHO A;  4NVE A;  2OA5 A;  3FXD B;  2LLY A;  3O1J A;  5FY0 A;  5LXT E;  3ZJ2 A;  3FZM B;  4ISS A;  4G63 A;  4U31 A;  2V7I A;  1CHU A;  4ZZB A;  2DLR A;  5EK3 A;  5LGT B;  1WYC A;  2EUP A;  1BEQ A;  4I43 B;  3ZKR A;  2AXD S;  1BEP A;  3RC3 A;  2GHC X;  2LE8 A;  4NXM T;  1G8X A;  2KSR A;  3N9O A;  1HSR A;  3ZT7 A;  5HXR A;  1YQ3 A;  4I0U A;  4PK5 A;  1A2G A;  1HNZ T;  5AQS B;  3TLT A;  4B6X A;  2X9H A;  3ATJ A;  4DND A;  5FVK A;  3M2A A;  1UX4 A;  2OV9 A;  5LOV E;  2JQH A;  2LM2 A;  1HF8 A;  5AQI B;  1AEU A;  1VCS A;  4WZX A;  4HWC A;  3FBL A;  2B12 A;  1AEQ A;  3GN5 B;  5AQF B;  4DMW A;  5SW6 A;  2AE9 A;  5KQ3 A;  2X9W A;  4UXN B;  1N33 T;  2YLJ A;  2WSS S;  3M2G A;  5J2U E;  4GK5 E;  4O2B E;  4ADZ A;  4LFA T;  4UF0 B;  4TV9 E;  3ANW B;  1AES A;  2A72 A;  2E9X D;  3HDL A;  1KXN A;  4H9N C;  5HCM A;  1SOG A;  4HWF A;  3VKG A;  1OED B;  2Q9Q A;  3UU6 A;  4X65 T;  5JDN A;  4X1Y E;  3OTO T;  3AEF A;  4AXP A;  3E2N A;  2G0U A;  4CXY A;  1LRZ A;  4TX5 A;  1BR2 A;  1DSG A;  2B1E A;  2AS2 A;  1MN1 A;  4AQF C;  2YKS A;  2LHR A;  1D1C A;  4C51 A;  1JCI A;  1FEW A;  4BA9 A;  1N34 T;  1VOM A;  3HKB E;  2QGS A;  2VCF X;  2GK9 A;  4DV2 T;  2BG9 B;  2CL4 X;  3Q5E A;  4A71 A;  4F6R C;  1ML2 A;  1CMP A;  3GWH A;  2BBJ A;  3MA9 A;  1J1J A;  3Q2M A;  2LJL A;  4GIW A;  4WNK A;  5AL9 A;  3H3A A;  3L39 A;  4JI3 T;  1T8B A;  5LYJ E;  1AC8 A;  1CCK A;  5AQR B;  2VK9 A;  4QXH B;  4NVB A;  4HFH A;  4PW8 A;  4HFE A;  3M2E A;  3AE4 A;  3PUG A;  4ZEY A;  4HWD A;  1KXM A;  4BM3 A;  4HWH A;  2OLT A;  1GWT A;  2RBX X;  5CA1 E;  4PAG A;  5ABH A;  5KXJ A;  3FZF B;  3PJA A;  2ACZ A;  4A6Z A;  5ABG A;  4XV4 A;  1HNX T;  3QNU A;  3QOF A;  2ATJ A;  5HXE A;  2RC2 X;  3P8C D;  4P0B A;  2CA5 A;  1HX1 B;  3VLM A;  3FZL B;  2R6G F;  4EIW A;  1D0Z A;  4EB6 E;  5SYK A;  1E1H B;  3H37 A;  1LY8 A;  5FP3 A;  3PV0 F;  5JR9 A;  4HWI B;  2KIN B;  2LHN A;  2E2A A;  1MIW A;  1QSD A;  5SXS A;  4ZS3 A;  2V7J A;  4ILU A;  1AEH A;  1ZEE A;  1YYG A;  2XAS B;  4KMC A;  5DJQ C;  2GHH X;  4XV5 A;  3R84 B;  5EK2 A;  2XIF A;  3AEB A;  1WR0 A;  4YT0 A;  1NAF A;  1IJ5 A;  3UUB A;  2WMO A;  2UXC T;  3UU8 A;  2UXB T;  4QH1 A;  4GYR A;  3AB3 B;  5FYM A;  4CN6 A;  4Z90 A;  3PU8 A;  4NUV A;  4LML A;  2YIN A;  4EZ4 A;  4BM2 A;  2Q9Q C;  4XVA A;  5JHY A;  4DBR A;  1ZP0 A;  2XSB A;  3DP7 A;  3N2G E;  2RA1 A;  4NXN T;  3CVR A;  3VR8 A;  4JPU A;  1BR4 A;  4AIS A;  2HN2 A;  2Q9Q D;  4U33 A;  3N9N A;  1WRD A;  3RIA A;  3ZMV B;  4EOZ B;  2XAG B;  4KUM B;  3VRA A;  1H5A A;  3UU4 A;  2XAF B;  4AKI A;  3ZN0 B;  4H7A A;  4AKR B;  3AXJ A;  2YN6 A;  4YLH A;  3CKD A;  3S4U A;  2CCD A;  1KOK A;  1E2A A;  4QH4 A;  1ZHC A;  2RPA A;  4ZHQ E;  2JTI A;  2AS1 A;  3PUW F;  3RHW A;  2KND A;  4JM8 A;  1XMQ T;  3TLS A;  4IRE A;  5C8Y E;  3AA6 B;  3NBX X;  2D9D A;  2N1G A;  1H5K A;  4DV4 T;  1YKH B;  1CCE A;  5SYY A;  3M23 A;  1AEK A;  3ONJ A;  2UUC T;  2XAJ B;  1H57 A;  2BS4 A;  2JMH A;  4AKG A;  3AEG A;  4WW0 A;  4GKF A;  2VL0 A;  4UVC B;  4TN7 B;  2LRL A;  2V8S V;  4WBO A;  3KV4 A;  4GED A;  2W63 A;  4IGU A;  3AA1 B;  4DR3 T;  5BR8 T;  1KNZ A;  4KX6 A;  4NVK B;  1H5G A;  4H9R C;  5DQW A;  2JJ9 A;  2V1D B;  3QB5 K;  4IDO A;  1YZP A;  4HE8 A;  5JTG A;  1OXZ A;  3Q5X A;  4DR1 T;  3FMU A;  4BLX A;  4DUZ T;  2V23 A;  3X1D A;  2B10 A;  5SYH A;  4CN1 A;  4CVI A;  4CUO A;  3U3I A;  4IDP A;  3PDY A;  5KQK A;  5JDQ A;  1XNQ T;  1H5M A;  4PJJ A;  3UFE A;  1IJ6 A;  4QYZ B;  2XJ6 A;  3KFW X;  2X0L B;  2WWV A;  4HFV A;  1AEB A;  2AQD A;  4IE0 A;  5AQO B;  2WD4 A;  3HI2 A;  2WY2 A;  5LHH B;  3C4Z A;  3P4Q A;  4OX9 T;  1RYC A;  4CZZ B;  3ZMU B;  3Q5D A;  4O8S A;  4JPT A;  2XQA A;  1ARY A;  5H6R B;  5CJH A;  2W00 A;  5AQK B;  1M7K A;  4L5G A;  3ETV A;  4JMZ A;  2LSY A;  2C5I T;  4EZH A;  3UUN A;  1DU2 A;  4ERR A;  3ZMT B;  3KVA A;  3ZT6 A;  4IHJ E;  4NVH B;  2UUB T;  2FJB A;  1S73 A;  2WB5 A;  2IUB A;  4O4H E;  4TWD A;  4NUU A;  4BM0 A;  1Y64 B;  2Y6B A;  2SPC A;  2V6X A;  4ZZC A;  3LK3 B;  5TAO A;  4EGW A;  3R98 A;  4DVD A;  2XQ6 A;  2WDR A;  3CPZ A;  4JEU B;  1DSE A;  1AEF A;  3E2O A;  2YEV C;  1IBK T;  2WU5 A;  1GQE A;  5EK4 A;  1QPA A;  2BKO A;  2JQ9 A;  1X79 A;  5ALA A;  1HG2 A;  5HEG A;  4GKJ T;  1B85 A;  1H58 A;  2PFV A;  2Y8D A;  4OYJ A;  4DBQ A;  2JQQ A;  2CCA A;  4E7Z A;  2EUR A;  1AEN A;  3RX6 A;  4UV8 B;  3EI0 A;  2WP9 A;  4DV6 T;  3M5Q A;  3I0O A;  4B3S T;  3RIF A;  4XZC A;  4A98 A;  2EUO A;  1HX8 A;  2HPL A;  1GWO A;  5CID A;  4YHJ A;  2XJ7 A;  3IBP A;  2CXL A;  3V5U A;  5SX0 A;  3WAJ A;  5KQH A;  3KBU A;  3NRY A;  2CBJ A;  3RRW A;  5E0O A;  1CPD A;  2XM2 A;  2W4X A;  5CFB A;  4BLL A;  4ILB A;  2N9D A;  2X9Y A;  5L02 A;  5SYW A;  3O1H A;  3ZJ1 A;  7ATJ A;  2PBI A;  2ZM0 A;  4YHH T;  2VQF T;  4IE5 A;  4CZP A;  1A2F A;  5JPR A;  2C5K T;  2V2E A;  4TUY E;  3RRC A;  2VKA A;  2J47 A;  1V0H X;  1Z53 A;  3PU3 A;  3Q9D A;  4XAX B;  5LBM A;  2WAU A;  4HTE A;  4YXD A;  5LB7 B;  4U7Y A;  2LM9 A;  3VU7 H;  1HR0 T;  4ILA A;  4EAH A;  6CCP A;  2CPT A;  5JHX A;  2ANZ A;  5F3J A;  4P09 A;  2LT3 A;  4LFB T;  4QXC B;  3M2F A;  3QUJ A;  2Q9Q B;  2X51 A;  4KI0 F;  4A56 A;  4ANJ A;  1WCR A;  3VLH A;  4E7S A;  1WR6 A;  1KZM A;  3AE7 A;  4ZI3 C;  2NWB A;  4TV8 E;  3PUA A;  1JNZ A;  3VLJ A;  3K3O A;  4JI8 T;  2D0T A;  1DCC A;  3P4W A;  5C3J A;  1IZN B;  4COF A;  5L3D B;  3JAF A;  3RYC E;  4EEB A;  3P7I A;  2EUU A;  2RC1 X;  2CCQ A;  5BMV E;  4NVI B;  5FXW A;  2H7O A;  1AC4 A;  5J0Z A;  2XIH A;  3EVY A;  1IBL T;  1H5F A;  2XQ3 A;  4NVL A;  5AQJ B;  5ABO A;  3QC9 A;  4L9I A;  3CX7 B;  1CCC A;  2IDO B;  4YJ3 E;  3WNU A;  2XQ8 A;  4NVG B;  4JN0 A;  4IT4 A;  2W23 A;  4YJ2 E;  3VLL A;  2C0S A;  3OVU A;  4JI5 T;  1CMT A;  3U78 A;  3TLW A;  1QLB A;  2FUP A;  2LOP A;  4WBN E;  4BLN A;  1FHF A;  2XJ5 A;  2FJD A;  2K48 A;  2K3W A;  5LG4 A;  2VO2 X;  3UU3 A;  4JM6 A;  3AEE A;  2WMN A;  2N2N A;  3N2K E;  1BES A;  4YSZ A;  1B7T A;  1KK7 A;  4TNW A;  3M26 A;  2W62 A;  5ADX L;  1BEJ A;  5JQG E;  2X9X A;  3RYI E;  3UFG A;  4P4Q A;  3HA4 A;  1VRB A;  1BVA A;  2QVA A;  2E9X C;  4NVM B;  4QX8 B;  4H9Q C;  3ZYL A;  2CEA A;  1CK6 A;  2KXP B;  3UUX B;  2ZM6 T;  4ZS2 A;  1W0B A;  3ZCJ A;  4IL4 A;  7CCP A;  4YTM A;  3P4S A;  5JHZ A;  2IC6 A;  4B3R T;  1LGA A;  4EYU A;  2VCN A;  3AE6 A;  3BQL A;  3M2H A;  5CJ5 A;  1MNE A;  3WI3 A;  1UK5 A;  5LHG B;  3CQC B;  1LKX A;  4B3T T;  4GYS A;  1OAG A;  1JNR A;  1AA4 A;  2FBW A;  3CWZ B;  2YU2 A;  4X20 E;  4JLE A;  2WZI A;  3ZC0 A;  5JDM A;  2VUR A;  3NKZ A;  3RGL A;  4Q25 A;  1MND A;  2EUQ A;  1KEY A;  4F8H A;  2PJQ A;  2J1D G;  2WM9 A;  3KBT A;  2EUN A;  3LK2 B;  5HXS A;  1BGP A;  2PG8 A;  3RQW A;  4CXW A;  5LJN A;  4JQK A;  1DS4 A;  3R6N A;  1Z8U A;  3C4W A;  1AJ3 A;  1SBM A;  3FM1 A;  3H3M A;  2FJE A;  3UT2 A;  2DWG A;  3OKQ A;  3CK6 A;  2IA8 A;  1MKQ A;  1M62 A;  3J9X 1;  5L3G B;  2VWA A;  3ZLI A;  1W0A A;  6ATJ A;  3EXB A;  5LGN B;  1SCH A;  1U75 A;  2CWY A;  1GWU A;  1AEJ A;  3PUQ A;  1D0Y A;  1MN2 A;  5SYJ A;  5FNE A;  1BEK A;  2BCN A;  1H55 A;  2CLY C;  5AQU B;  3M25 A;  4QXB B;  4YFS A;  4IIJ E;  4A97 A;  1H3J A;  4C50 A;  1XDO A;  3VLK A;  3AE2 A;  5SXW A;  5AQV B;  1ARV A;  4A5X A;  2W61 A;  2B76 A;  5AFU L;  2RBW X;  3GN5 A;  4X64 T;  4H79 A;  2XTL A;  3P4P A;  3BQI A;  5FXX A;  1BJ9 A;  5FMN A;  1MK8 A;  1SJ2 A;  5FKY A;  5CIC A;  5SYL A;  2PCB A;  1CCA A;  3RIV A;  1UGO A;  4UF0 A;  4AI6 A;  3PUR A;  4DV7 T;  2GHD X;  4IST A;  5H9F B;  4DV5 T;  3ANW A;  2YU1 A;  2Z6E A;  1XZY A;  1KNR A;  1UB2 A;  4UIG A;  2QRX A;  5HWX A;  1BR1 A;  4H63 V;  4X5T A;  2VB6 A;  4DR6 T;  3KIN B;  3A8Y C;  3ZEF B;  3VLI A;  1U4Q A;  4LF6 T;  1HTJ F;  2VCS A;  3LK4 2;  4IE7 A;  4OFZ A;  5ETW A;  5AQM B;  4GOU A;  4I4T E;  4UEL A;  3RC8 A;  3CX8 B;  2X68 A;  3QB5 A;  4JBW F;  4Z91 A;  3SRZ A;  4AKL A;  3O9X A;  2CMR A;  2GGN X;  2RBV X;  2F4V T;  5FL1 A;  5AQG B;  4QWN B;  4TZ4 C;  5SYU A;  1Y01 A;  3N9Q A;  4OQ7 A;  1H5H A;  2UXX B;  4H9O C;  3WAK A;  1G73 A;  3UQ7 A;  2PTF A;  3DTO A;  2DCF A;  2YOE A;  3N2O A;  5LGU B;  1S35 A;  1FMW A;  5SW4 A;  5LP6 E;  2OEB A;  4AQG A;  4K0U A;  1UX5 A;  2NTX A;  1U2J A;  4DV3 T;  4JI1 T;  1CPF A;  3C64 A;  1MIV A;  1QGJ A;  5AOG A;  2KLQ A;  3J7Y q;  3K1S A;  1V9D A;  2RBU X;  4ZI7 E;  3VHL A;  1CCP A;  4MBQ A;  4NVO B;  1SA0 E;  3NZP A;  5KQ2 A;  3UQ4 A;  2E8I A;  4JMA A;  2Y6A A;  4H9P C;  4PAE A;  2VVS A;  4YSX A;  1C8I A;  4OHF A;  3HR0 A;  1CPE A;  3L3P A;  3M8M A;  1H5C A;  5SXQ A;  4HFI A;  2CM0 A;  3CX6 B;  5LCY A;  1ATJ A;  5L3B B;  1U74 A;  5JVD E;  4P0A A;  2M6I A;  1LVK A;  3X16 A;  5EZY E;  2VVN A;  3SS1 A;  4AQY T;  2XPK A;  4JM5 A;  4U7U B;  5HCJ A;  3PE0 A;  3CIR A;  3ZYM A;  1YXR A;  4OK0 A;  1ITK A;  1O3X A;  2BVL A;  4CQI A;  4JMT A;  1HCH A;  1IAP A;  2Y48 B;  4MHC A;  3TLU A;  2K24 A;  4FEF A;  4O4I E;  2W2U A;  1MMN A;  2LEH A;  2X66 A;  3M27 A;  3ZMZ B;  2WCA A;  5JR9 C;  2WSS V;  1XWM A;  4HFB A;  2VNX X;  4CZQ A;  1D1B A;  5CD4 J;  1OED E;  2J4G A;  1US7 B;  5JRC A;  3OYX A;  2KWI B;  3RKG A;  3AE1 A;  2LSK A;  3AAA B;  1MNP A;  5F5W A;  3AVR A;  2E9X B;  2MBG A;  3EAM A;  5IHY A;  3AAI A;  1T7S A;  4JI0 T;  3I0Q A;  4UR9 A;  2XSA A;  2BS3 A;  2NP9 A;  4M1P A;  1SDQ A;  2XQ5 A;  2CCP A;  5LMN T;  2V7L A;  2WWU A;  2RBT X;  5CCP A;  3KDS E;  2WU2 A;  2AS4 A;  2BG9 E;  3ZMS B;  3NZQ A;  3N9P A;  5HXC A;  5LHI B;  2V6Y B;  2CXD A;  2XM1 A;  3DJB A;  1HCI A;  5L3F B;  5L2L A;  3LBX A;  4OYK A;  3LSV A;  2CXF A;  5HWY A;  5FY1 A;  2L3L A;  4NFG A;  1JDR A;  1LY9 A;  4JI2 T;  1CCI A;  1ABV A;  1N36 T;  2UU9 T;  3NVO A;  2IHR 1;  4FI5 A;  1AEV A;  4DR4 T;  3RH3 A;  3KV9 A;  3AE8 A;  4BJM A;  4DV1 T;  2IIU A;  3ABV A;  3LFM A;  5H9E B;  4G2A A;  1YZR A;  3AEC A;  3ZN1 B;  5IWA T;  2BKP A;  2X08 A;  4PK6 A;  4ASK A;  2X0Y A;  4JQN A;  1DJ1 A;  3MK7 C;  1CCB A;  2ZOP A;  2BO5 A;  2DNX A;  4CXX A;  4JEH B;  5CB4 E;  3ZCI A;  1YKE B;  4A7M A;  1FJG T;  3IHR A;  2NW9 A;  1AEO A;  1LVF A;  4FJO A;  5AQP B;  2RBY X;  1L0V A;  1DJ5 A;  2QA7 A;  5AQT B;  2XQ7 A;  5JDL A;  1ZBZ A;  1FIO A;  3ETU A;  1N32 T;  2HPJ A;  5KMG P;  4CI3 B;  2UUA T;  3M29 A;  1LYC A;  5SX6 A;  2CLY B;  4JMW A;  3FB2 A;  2NW8 A;  5LBQ B;  1CYF A;  2B0Z A;  2ZCA A;  4FCN A;  2W66 A;  2Y5A A;  5SXX A;  2EHO A;  4HEA A;  2H88 A;  2QYW A;  4HFC A;  1HFA A;  4LF9 T;  4ZOL E;  4A78 A;  3EDV A;  2XAQ B;  4ZI2 D;  1LYK A;  2MTQ A;  2XIL A;  1PA2 A;  4DR2 T;  1X9B A;  3M3Z B;  4FCS A;  4DR7 T;  1QO4 A;  5FNV E;  4PFP A;  3ESL A;  3FZK B;  3UUL A;  4G05 A;  5KDM C;  3LJC A;  4CZO A;  2V5C A;  2XY8 B;  4CZN A;  4O4J E;  3RYH E;  4JM9 A;  1ZKE A;  3RIU A;  2WDQ A;  1DSO A;  3N5L A;  4DO0 A;  2LKH A;  1HNW T;  4B3M T;  2KT9 A;  1CPG A;  5KQI A;  2ZM2 A;  4X66 T;  2UXD T;  3E0Z A;  4YY3 T;  3T1H T;  3PUZ F;  3FM6 A;  3KVB A;  4NVC A;  3A7M A;  1KRJ A;  3PUS A;  4O4L E;  1YW0 A;  4KP3 C;  4EED A;  1AEE A;  3CQX C;  5CIB A;  1H5D A;  4JZA A;  1LLP A;  2AS6 A;  4GKK T;  1FMV A;  2VKJ A;  3RI5 A;  3I9W A;  3T1Y T;  3F2E A;  2NW7 A;  5LMU T;  1GW2 A;  3PJA J;  4Z8X A;  2XQ9 A;  2YDS A;  1U2K A;  4JQJ A;  3OYZ A;  2BBH A;  3CCX A;  5L3C B;  2KWH A;  3E22 E;  2E5V A;  4LF8 T;  2HHH T;  3SFD A;  2JIW A;  2VQE T;  2XI6 A;  2BZB A;  3RKO A;  4JMB A;  3ZST A;  3B57 A;  2KZ7 B;  4KBM B;  1WYB A;  3I9Y A;  2V7K A;  3CQG B;  1GX2 A;  1H5L A;  4X62 T;  4CZR A;  4YTN A;  4V1A v;  4LF7 T;  1OWA A;  2D5U A;  3SFE A;  3O4X E;  2IML A;  1R8I A;  3Q5W A;  4JI4 T;  4DMV A;  1S6V A;  2P9B A;  3AE3 A;  1W09 A;  2EUS A;  2AS3 A;  2MYS A;  1VCT A;  3L8R A;  5JDF A;  1CMU A;  2MOZ A;  3V5S A;  4TNV A;  5AMM A;  2I6H A;  2LKG A;  2KMF A;  5L47 A;  5L3E B;  4K0K T;  1SUM B;  1AET A;  3G06 A;  4EXT A;  1D1A A;  5LG3 A;  2B11 A;  4ILC A;  2IW5 B;  4AIU A;  3GMI A;  5SX2 A;  2EHO C;  5L4H A;  2PCC A;  5H6Q B;  4P1N A;  2L9Q A;  2Y6X A;  3E08 A;  3P4R A;  3BQK A;  5JR9 B;  4HKA A;  5SYI A;  4DV0 T;  3K3Q C;  3FZH B;  2EHO D;  4XV7 A;  3MZK B;  4CCX A;  4U2Y A;  2DWK A;  3FXE B;  3HL6 A;  2E3B A;  3BK9 A;  1D0X A;  3ZSS A;  1HS7 A;  2MPK A;  3UU5 A;  3EAB A;  1ARX A;  3RIU C;  3ONX A;  3HKE E;  5ABF A;  5HXH A;  4PJN A;  2YDQ A;  2W67 A;  5L86 A;  2VKH A;  4YTP A;  4BM1 A;  2E39 A;  3JCF A;  5JQR A;  1KNP A;  3JAD A;  4CN4 A;  3ZYK A;  3AE9 A;  4NVD A;  3KV5 A;  3PUV F;  5C2T A;  2BVM A;  2JPF A;  5DAB A;  3C98 B;  1GZB A;  4IL9 A;  4A5G A;  2MAW A;  3LG7 A;  4MAL A;  4MFR A;  3IA3 A;  4U74 A;  4QH5 A;  3R99 A;  3CML A;  3C51 A;  3AXJ B;  3D0T A;  1B82 A;  3M28 A;  5CIH A;  2W0G A;  1ARP A;  5LJM A;  1S94 A;  3F31 A;  2GHE X;  3FM4 A;  2XJ8 A;  3MXZ A;  5HEO A;  4LF4 T;  5FL0 A;  3PUX F;  2K9A A;  1WLX A;  2UXN B;  3AEA A;  4HGA A;  4C90 A;  2YCG A;  5DQV A;  2WBL A;  2CEP A;  4UV9 B;  3M2D A;  3MAC A;  2DHR A;  3A5X A;  4PJM A;  5KQ6 A;  1MIY A;  3N9M A;  1GZA A;  4JB4 A;  1U5P A;  2D0U A;  3EDU A;  3RIW A;  2JQK A;  3M2C A;  2BS2 A;  4USC A;  2L8K A;  1CCL A;  4I50 E;  4ZXL A;  2IAK A;  2XHE B;  2LOS A;  4IE6 A;  2ODU A;  3C4X A;  5ABQ A;  4ATJ A;  4BJN A;  4LFC T;  4PJL A;  3ZPO A;  5SYV A;  3ZC1 A;  1MMA A;  2E5L T;  2JMX A;  4XBF B;  2M67 A;  1Z0P A;  3MKD A;  5KX5 E;  2ZMA A;  5HAX A;  4PK4 A;  5CIE A;  2X67 A;  1BR0 A;  2N18 A;  5SYX A;  3MJX A;  5AQQ B;  1OED A;  1CUN A;  4YSY A;  1W4Y A;  4IDN A;  4BLY A;  1ZOY A;  5AQL B;  3IF8 B;  3EUH A;  3RQU A;  5L4E A;  2VKO A;  5JRC B;  2CBI A;  5FXZ A;  1CMQ A;  1T72 A;  3FBZ A;  5JDH A;  1W9R A;  1ZV4 X;  2VAS A;  4CVJ A;  5HEH A;  2CRB A;  2BG9 A;  5ABE A;  2C5J A;  1WFD A;  2XUE A;  2HH7 A;  4JMS A;  3OPC A;  2GHK X;  4JI7 T;  2CE7 A;  2E3A A;  2CHN A;  2NR4 A;  2M6B A;  3QK6 A;  3Q3U A;  1YQ4 A;  4BLK A;  5KSF A;  3B5M A;  3VKH A;  5FXV A;  3HKC E;  4AKH A;  1UUS A;  4NVF A;  1MMD A;  1NEN A;  2YDR A;  4QKN A;  4FDQ A;  4H9S E;  1SE7 A;  3L09 A;  3LBX B;  5CGM A;  5J2T E;  2DL1 A;  2BDE A;  2XAH B;  2VKD A;  1I94 T;  3WA8 A;  4HN9 A;  1H5I A;  1U2L A;  3JC6 C;  3EHZ A;  3FKG A;  2XZE A;  1DSP A;  1H5E A;  2JRK A;  1H5J A;  3GA8 A;  1YYD A;  2GB8 A;  4UVA B;  1EZ3 A;  4X1I E;  3JC6 D;  3OBV E;  4JYA T;  3OJA A;  5EJT A;  2WDV A;  2X07 A;  5SW5 A;  2XQ4 A;  4BM4 A;  4MLK A;  3RYF E;  1ZBY A;  4J2C A;  1J5W A;  1KFY A;  1XDP A;  2WQY A;  3FJW A;  5AQH B;  1MKR A;  2JMK A;  5D6M A;  2K5B B;  3I1A A;  3AE5 A;  5SX7 A;  4LMK A;  5SX0 B;  3N9L A;  4JQM A;  4KHP T;  2IC9 A;  4U7I A;  4NVA A;  2CHO A;  4H63 H;  5KSK A;  2EHO B;  4L0R A;  3P50 A;  3HKD E;  4BAY B;  5HYA A;  2CWO A;  2A3D A;  2NOX A;  5F8P A;  1OED C;  5SX1 A;  5SX3 A;  5FY7 A;  5J1G A;  4I55 E;  1XMO T;  2FJA A;  3VR9 A;  1T98 A;  3TKL B;  5ABN A;  5LNK A;  1XNR T;  2NTY A;  2RP4 A;  4KHZ F;  5M4Y A;  3JAE A;  4U3C A;  1AED A;  1AEG A;  3ZT5 A;  2LRK A;  2BKN A;  4CI2 B;  3K3N A;  4O2A E;  3RF1 A;  2YK0 A;  4TWF A;  2LSI A;  2DI4 A;  1UCU A;  2BG9 C;  2I0M A;  1W4W A;  3IEE A;  3T8O A;  5FNB A;  5FVL A;  4LMJ A;  1STQ A;  4IDQ A;  4PNI A;  5HEU A;  3WXO A;  2HN1 A;  4DR5 T;  4C91 A;  3PTR B;  3NWI A;  2A7U B;  4UEM A;  2H89 A;  5CIF A;  2ACX A;  1I6Z A;  2V7M A; 
#chains in the Genus database with same CATH homology
 1SCH A;  1U75 A;  2CWY A;  3AA0 B;  2BOQ A;  1OWA A;  1GWU A;  2D5U A;  3M23 A;  3O4X E;  1AEK A;  4JPL A;  1AEJ A;  3PUQ A;  1D0Y A;  1MN2 A;  2XAJ B;  4GK0 E;  3Q5W A;  2ZM8 A;  5SYJ A;  4DMV A;  1H57 A;  3UUM A;  5CIG A;  1S6V A;  5FNE A;  3F57 A;  2P9B A;  2JMH A;  4AKG A;  2VNZ X;  1BEK A;  1YD8 G;  4WW0 A;  4PFO A;  2BCN A;  1H55 A;  2EUS A;  2AS3 A;  5CA0 E;  2MYS A;  2CLY C;  4UVC B;  5JDF A;  1CMU A;  2MOZ A;  4NVN B;  3M25 A;  3UT5 E;  4TN7 B;  4QXB B;  2CYP A;  4WBO A;  5JH7 E;  3C50 A;  3KV4 A;  3V5S A;  4GED A;  2W63 A;  4YFS A;  4E7Z A;  1ARU A;  4IGU A;  4IIJ E;  5AMM A;  2D2S A;  4JUY A;  3ZCH A;  3AA1 B;  1H3J A;  4C50 A;  3VLK A;  5LA6 E;  2KMF A;  2ZLY A;  3AA7 B;  5L3E B;  5SXW A;  4ZI2 C;  1KNZ A;  4NVK B;  1H5G A;  4H9R C;  5DQW A;  1ARV A;  1AET A;  2JJ9 A;  2A2F X;  2V1D B;  1YZP A;  2W61 A;  2EUT A;  4HE8 A;  1BEM A;  4NVJ B;  4XV8 A;  5JRE A;  1OXZ A;  3Q5X A;  4EYY R;  4EXT A;  5AFU L;  2RBW X;  3CCP A;  3FMU A;  2LSG A;  1D1A A;  2VL8 A;  4BLX A;  3GN5 A;  5EJX A;  4H79 A;  1SHZ C;  5A1L A;  2B11 A;  2V23 A;  2XTL A;  3BQI A;  2IW5 B;  5FXX A;  1BJ9 A;  2B10 A;  1MK8 A;  5SYH A;  3M65 A;  3GMI A;  5FMN A;  2RBZ X;  4CVI A;  5SX2 A;  1H7C A;  1SJ2 A;  2E9X A;  4UVB B;  2EHO C;  5CIC A;  5SYL A;  4CUO A;  2PCC A;  5H6Q B;  3U3I A;  2PCB A;  3PDY A;  1CCA A;  3RIV A;  5KQK A;  4N78 D;  5JDQ A;  3KV6 A;  1H5M A;  4UF0 A;  3PUR A;  4AI6 A;  2GHD X;  2L9Q A;  5H9F B;  4IST A;  3ANW A;  3B13 A;  4PJJ A;  2Y6X A;  3E08 A;  3UFE A;  2V26 A;  1IJ6 A;  3ZCG A;  2YU1 A;  3BQK A;  5SYI A;  3O1I A;  4HKA A;  2Z6E A;  4QYZ B;  3K3Q C;  5JR9 B;  2XJ6 A;  1UB2 A;  2EHO D;  4UIG A;  4XV7 A;  3SOL A;  3KFW X;  5HWX A;  2X0L B;  3MZK B;  2ICV A;  4HFV A;  1AEB A;  2AQD A;  4CCP A;  1NWM X;  4IE0 A;  4CCX A;  1BR1 A;  5GON E;  2WD4 A;  2LSJ A;  3HI2 A;  4H63 V;  2VB6 A;  2XQY A;  2DWK A;  3FXE B;  5LHH B;  3HL6 A;  2E3B A;  3BK9 A;  5KQ0 A;  1D0X A;  3KIN B;  3ZEF B;  3C4Z A;  3RPU A;  3VLI A;  1HS7 A;  1U4Q A;  5SXR A;  1IYN A;  1MMG A;  3W15 B;  1ARX A;  2RC0 X;  1HTJ F;  2VCS A;  3M2I A;  3LK4 2;  1ARW A;  4IE7 A;  4OFZ A;  4AQF A;  1RYC A;  1CCJ A;  3ONX A;  4CZZ B;  3HKE E;  3M2B A;  4JMV A;  5ETW A;  3ZMU B;  1HG5 A;  4GOU A;  5HXH A;  4O8S A;  4JPT A;  5SXT A;  4I4T E;  4PJN A;  4QX7 B;  1ARY A;  4UEL A;  1AEM A;  4X1K E;  5L86 A;  3RC8 A;  5H6R B;  5CJH A;  3CX8 B;  2VKH A;  2W00 A;  2X68 A;  4BLZ A;  3SRZ A;  4L5G A;  3ETV A;  4BM1 A;  4AKL A;  4JMZ A;  2CMR A;  3O9X A;  2LSY A;  1CCG A;  2E39 A;  2GGN X;  2RBV X;  2C5I T;  1OAF A;  4IE4 A;  3UUN A;  4EZH A;  4KUM B;  5JQR A;  4QWN B;  2ES0 A;  4TZ4 C;  3FHN A;  4ERR A;  3ZMT B;  1APX A;  2H7V C;  4IDZ A;  5SYU A;  3KVA A;  2ODV A;  3SWH A;  3ZYK A;  3KV5 A;  4NVH B;  4NVD A;  3N9Q A;  4IHJ E;  4OQ7 A;  1S73 A;  1H5H A;  2BVM A;  2UXX B;  2JPF A;  4H9O C;  5DAB A;  3C98 B;  1GZB A;  3WAK A;  1G73 A;  3K8P C;  1QUU A;  3AVS A;  4A5G A;  4O4H E;  3LG7 A;  4NUU A;  3AAE B;  1B80 A;  4MAL A;  4BM0 A;  1Y64 B;  3DTO A;  2Y6B A;  3UW8 A;  2DCF A;  2SPC A;  3N2O A;  1S35 A;  1FMW A;  5SW4 A;  3LK3 B;  4MFR A;  5TAO A;  4CI1 B;  5LGU B;  5LP6 E;  2I59 A;  3R98 A;  4U74 A;  4K0U A;  4AQG A;  4DVD A;  1UX5 A;  2NTX A;  1U2J A;  3CPZ A;  3NRX A;  4JEU B;  3R99 A;  1DSE A;  1AEF A;  4U72 A;  1CPF A;  5JDG A;  3E2O A;  3C64 A;  4ZI3 D;  3ZCY A;  2YEV C;  3CML A;  3C51 A;  1MIV A;  1QGJ A;  5AOG A;  3D0T A;  1B82 A;  1EBE A;  3M28 A;  5CIH A;  2KLQ A;  5IYZ E;  3J7Y q;  4XV6 A;  1V9D A;  2RBU X;  5L05 A;  1ARP A;  1CCP A;  2W0G A;  3UTK A;  5EK4 A;  3VHL A;  4ZI7 E;  5LJM A;  2H3R A;  1QPA A;  1S94 A;  4MBQ A;  4NVO B;  3F31 A;  4NVE A;  1SA0 E;  1X79 A;  5ALA A;  2GHE X;  3FM4 A;  5KQ2 A;  4JMA A;  2E8I A;  2OA5 A;  2Y6A A;  1HG2 A;  4H9P C;  1B85 A;  2XJ8 A;  3MXZ A;  3ZYL A;  4PAE A;  2K9A A;  1H58 A;  3FXD B;  1C8I A;  2PFV A;  3O1J A;  1WLX A;  2Y8D A;  2UXN B;  4OYJ A;  5FY0 A;  5LXT E;  4DBQ A;  4OHF A;  4HGA A;  4C90 A;  2YCG A;  2JQQ A;  1CPE A;  2CCA A;  2WBL A;  3HR0 A;  3M8M A;  3L3P A;  5DQV A;  2CEP A;  1H5C A;  2EUR A;  3M2D A;  4UV9 B;  1AEN A;  3ZJ2 A;  3RX6 A;  5SXQ A;  4UV8 B;  4ISS A;  4G63 A;  3MAC A;  2DHR A;  2CM0 A;  3A5X A;  3CX6 B;  4PJM A;  5KQ6 A;  5LCY A;  2V7I A;  1ATJ A;  5L3B B;  1U74 A;  2DLR A;  5JVD E;  3M5Q A;  3I0O A;  4P0A A;  1MIY A;  5EK3 A;  5LGT B;  3N9M A;  1GZA A;  4JB4 A;  1WYC A;  4XZC A;  1U5P A;  2EUP A;  2D0U A;  1BEQ A;  1LVK A;  4I43 B;  3EDU A;  2EUO A;  1HX8 A;  3X16 A;  2HPL A;  1BEP A;  1GWO A;  2GHC X;  3RIW A;  3M2C A;  5EZY E;  3RC3 A;  3SS1 A;  5CID A;  2LE8 A;  4USC A;  4YHJ A;  2L8K A;  4JM5 A;  1CCL A;  4I50 E;  1G8X A;  3IBP A;  2IAK A;  2CXL A;  2XHE B;  1HSR A;  4U7U B;  3N9O A;  3PE0 A;  5HXR A;  3ZYM A;  3V5U A;  2LOS A;  5SX0 A;  4IE6 A;  2ODU A;  3C4X A;  4OK0 A;  5ABQ A;  5KQH A;  3WAJ A;  4PK5 A;  1A2G A;  4ATJ A;  4B6X A;  1ITK A;  1O3X A;  3KBU A;  4BJN A;  2BVL A;  4PJL A;  3ZPO A;  2X9H A;  4CQI A;  4JMT A;  3NRY A;  1HCH A;  3ATJ A;  5SYV A;  1IAP A;  2Y48 B;  4MHC A;  3ZC1 A;  4DND A;  3RRW A;  5E0O A;  1CPD A;  4CXX A;  1MMA A;  3M2A A;  1UX4 A;  2K24 A;  5LOV E;  4BLL A;  4FEF A;  1HF8 A;  4O4I E;  4XBF B;  2M67 A;  1Z0P A;  3MKD A;  1MMN A;  2LEH A;  5KX5 E;  2ZMA A;  1AEU A;  2X66 A;  4PK4 A;  3M27 A;  5HAX A;  3ZMZ B;  5CIE A;  2X67 A;  1BR0 A;  2N9D A;  2WSS V;  5JR9 C;  2X9Y A;  5L02 A;  3FBL A;  5SYW A;  2B12 A;  2N18 A;  1AEQ A;  2VNX X;  3O1H A;  4CZQ A;  1D1B A;  3GN5 B;  5SYX A;  5CD4 J;  3MJX A;  5JRC A;  1US7 B;  3OYX A;  2KWI B;  3ZJ1 A;  4DMW A;  5SW6 A;  5KQ3 A;  1CUN A;  2LSK A;  2X9W A;  3AAA B;  7ATJ A;  2PBI A;  1W4Y A;  1MNP A;  4UXN B;  2ZM0 A;  4QHO A;  2YLJ A;  4BLY A;  3AVR A;  2E9X B;  3M2G A;  4IE5 A;  2MBG A;  5J2U E;  4GK5 E;  4CZP A;  4O2B E;  3AAI A;  5IHY A;  1A2F A;  5JPR A;  4ADZ A;  2C5K T;  3I0Q A;  2V2E A;  4TUY E;  3IF8 B;  4UF0 B;  3EUH A;  3RRC A;  4TV9 E;  3ANW B;  2VKA A;  1AES A;  2A72 A;  2E9X D;  2NP9 A;  4M1P A;  1SDQ A;  1KXN A;  1V0H X;  3HDL A;  1Z53 A;  4H9N C;  1SOG A;  3PU3 A;  3VKG A;  2VKO A;  3Q9D A;  4XAX B;  5JRC B;  2CCP A;  5LBM A;  2Q9Q A;  2WAU A;  4HTE A;  4X1Y E;  5JDN A;  5FXZ A;  2LM9 A;  2V7L A;  4AXP A;  1CMQ A;  3E2N A;  2G0U A;  2WWU A;  4CXY A;  3VU7 H;  1LRZ A;  3FBZ A;  2RBT X;  5CCP A;  4TX5 A;  4EAH A;  6CCP A;  1BR2 A;  1DSG A;  2B1E A;  2AS2 A;  5JDH A;  3KDS E;  5JHX A;  1ZV4 X;  2VAS A;  1MN1 A;  4AQF C;  2ANZ A;  2AS4 A;  5F3J A;  4CVJ A;  3ZMS B;  4P09 A;  3NZQ A;  2LHR A;  2C5J A;  2LT3 A;  3N9P A;  1D1C A;  2XUE A;  2HH7 A;  4JMS A;  4QXC B;  4C51 A;  5HXC A;  1JCI A;  1FEW A;  5LGN B;  2GHK X;  5LHI B;  3M2F A;  4BA9 A;  3QUJ A;  2Q9Q B;  2CE7 A;  2CXD A;  2X51 A;  4A56 A;  2E3A A;  3DJB A;  1HCI A;  4ANJ A;  5L3F B;  3VLH A;  4E7S A;  1WR6 A;  1KZM A;  1VOM A;  3QK6 A;  5L2L A;  3HKB E;  3Q3U A;  3LBX A;  4OYK A;  4ZI3 C;  2QGS A;  2VCF X;  2NWB A;  4BLK A;  5KSF A;  2CXF A;  2GK9 A;  3VKH A;  4TV8 E;  5HWY A;  3PUA A;  5FY1 A;  5FXV A;  2L3L A;  3VLJ A;  3HKC E;  4NFG A;  3K3O A;  1JDR A;  1LY9 A;  1CCI A;  4AKH A;  2D0T A;  4NVF A;  2CL4 X;  1MMD A;  1DCC A;  4A71 A;  1IZN B;  1ML2 A;  4F6R C;  4QKN A;  4FI5 A;  1AEV A;  4FDQ A;  4H9S E;  5L3D B;  1CMP A;  3RH3 A;  3P7I A;  3KV9 A;  3GWH A;  3RYC E;  2EUU A;  4BJM A;  2RC1 X;  2CCQ A;  3L09 A;  3LBX B;  5BMV E;  3MA9 A;  4NVI B;  3LFM A;  5FXW A;  5J2T E;  2H7O A;  3Q2M A;  1AC4 A;  5H9E B;  4G2A A;  1YZR A;  3ZN1 B;  2XIH A;  2BDE A;  2LJL A;  3EVY A;  2XAH B;  2X08 A;  2VKD A;  4GIW A;  4PK6 A;  5AL9 A;  4WNK A;  3WA8 A;  4HN9 A;  3H3A A;  1H5F A;  1H5I A;  4ASK A;  1U2L A;  3JC6 C;  4NVL A;  3FKG A;  4JQN A;  5ABO A;  5LYJ E;  1DJ1 A;  1AC8 A;  1DSP A;  1H5E A;  1H5J A;  1CCK A;  2JRK A;  3GA8 A;  3MK7 C;  3QC9 A;  4L9I A;  2VK9 A;  1CCB A;  3CX7 B;  1CCC A;  2DNX A;  4NVB A;  3NZP A;  1YYD A;  4JEH B;  4PW8 A;  4QXH B;  4YJ3 E;  5CB4 E;  3ZCI A;  2GB8 A;  4A7M A;  1EZ3 A;  1YKE B;  3IHR A;  4UVA B;  3M2E A;  3WNU A;  3PUG A;  4X1I E;  2NW9 A;  4NVG B;  3JC6 D;  3OBV E;  1AEO A;  1KXM A;  4JN0 A;  4BM3 A;  1LVF A;  2W23 A;  4FJO A;  4YJ2 E;  1GWT A;  2RBY X;  5EJT A;  3VLL A;  3OJA A;  2C0S A;  3U78 A;  1CMT A;  2RBX X;  5CA1 E;  4PAG A;  1DJ5 A;  2QA7 A;  5JDL A;  2X07 A;  1ZBZ A;  4WBN E;  2LOP A;  4BLN A;  1FIO A;  1FHF A;  2XJ5 A;  3ETU A;  5SW5 A;  2K48 A;  4A6Z A;  4BM4 A;  5LG4 A;  4MLK A;  3RYF E;  1ZBY A;  2HPJ A;  5KMG P;  4XV4 A;  4CI3 B;  2VO2 X;  3M29 A;  4J2C A;  1LYC A;  5SX6 A;  4JM6 A;  2CLY B;  4JMW A;  2ATJ A;  3FB2 A;  5HXE A;  2RC2 X;  3P8C D;  2NW8 A;  2WMN A;  5LBQ B;  2N2N A;  4P0B A;  2CA5 A;  1CYF A;  3N2K E;  3FJW A;  1BES A;  2B0Z A;  1MKR A;  2ZCA A;  4FCN A;  3VLM A;  1B7T A;  1KK7 A;  2JMK A;  4EIW A;  1D0Z A;  5D6M A;  2Y5A A;  5SXX A;  3M26 A;  2W62 A;  4EB6 E;  5SYK A;  2EHO A;  5ADX L;  2K5B B;  1E1H B;  3H37 A;  1LY8 A;  4HEA A;  5FP3 A;  3I1A A;  1HFA A;  4ZOL E;  1BEJ A;  4A78 A;  3EDV A;  5JQG E;  5SX7 A;  2X9X A;  2XAQ B;  3RYI E;  5SX0 B;  5JR9 A;  4ZI2 D;  3N9L A;  1LYK A;  4JQM A;  2MTQ A;  2XIL A;  2KIN B;  1PA2 A;  4P4Q A;  2LHN A;  3HA4 A;  1MIW A;  1BVA A;  1QSD A;  5SXS A;  1VRB A;  4FCS A;  2IC9 A;  1QO4 A;  2E9X C;  4NVM B;  4ZS3 A;  2V7J A;  4ILU A;  4PFP A;  5FNV E;  3ESL A;  4QX8 B;  4NVA A;  4H9Q C;  3UUL A;  1AEH A;  4G05 A;  1ZEE A;  1YYG A;  4H63 H;  5KSK A;  1CK6 A;  2CEA A;  3LJC A;  2EHO B;  2XAS B;  5KDM C;  4L0R A;  2KXP B;  4KMC A;  4CZO A;  5DJQ C;  3HKD E;  3UUX B;  4BAY B;  4ZS2 A;  5HYA A;  4CZN A;  4O4J E;  2CWO A;  2A3D A;  3RYH E;  4JM9 A;  2NOX A;  2GHH X;  4XV5 A;  1ZKE A;  3R84 B;  5F8P A;  3ZCJ A;  2XIF A;  5EK2 A;  7CCP A;  1DSO A;  3N5L A;  5JHZ A;  4DO0 A;  2IC6 A;  1LGA A;  5SX1 A;  4EYU A;  5SX3 A;  5FY7 A;  2KT9 A;  1CPG A;  2VCN A;  5KQI A;  3BQL A;  2ZM2 A;  1NAF A;  3M2H A;  1IJ5 A;  1MNE A;  2WMO A;  5J1G A;  4I55 E;  3WI3 A;  3E0Z A;  4GYR A;  3AB3 B;  3CQC B;  1T98 A;  5FYM A;  3TKL B;  5ABN A;  5LHG B;  5LNK A;  3FM6 A;  3PU8 A;  2NTY A;  2YIN A;  4NUV A;  2RP4 A;  3KVB A;  5M4Y A;  1LKX A;  4GYS A;  1OAG A;  1AED A;  4BM2 A;  4XVA A;  4NVC A;  5JHY A;  2Q9Q C;  4EZ4 A;  4DBR A;  1AA4 A;  3CWZ B;  1AEG A;  1KRJ A;  2YU2 A;  3PUS A;  4O4L E;  4X20 E;  4JLE A;  1YW0 A;  3DP7 A;  4KP3 C;  1AEE A;  3ZC0 A;  3N2G E;  2RA1 A;  4CI2 B;  3CVR A;  5JDM A;  4JPU A;  1BR4 A;  3CQX C;  1MND A;  5CIB A;  2EUQ A;  2Q9Q D;  3K3N A;  1H5D A;  4JZA A;  4O2A E;  2PJQ A;  3N9N A;  2YK0 A;  1WRD A;  3ZMV B;  2J1D G;  2DI4 A;  1UCU A;  2LSI A;  2XAG B;  4EOZ B;  1W4W A;  2WM9 A;  3IEE A;  1H5A A;  1LLP A;  2AS6 A;  2EUN A;  5FNB A;  3KBT A;  3LK2 B;  2XAF B;  3T8O A;  5HXS A;  4AKI A;  1FMV A;  2VKJ A;  3I9W A;  1BGP A;  2PG8 A;  4CXW A;  1STQ A;  4JQK A;  3F2E A;  2NW7 A;  4H7A A;  1DS4 A;  3ZN0 B;  5LJN A;  3R6N A;  4PNI A;  4AKR B;  1GW2 A;  4Z8X A;  4YLH A;  3C4W A;  3CKD A;  3WXO A;  1AJ3 A;  1U2K A;  4JQJ A;  3OYZ A;  3S4U A;  2CCD A;  3CCX A;  1KOK A;  5L3C B;  1SBM A;  1ZHC A;  4ZHQ E;  2KWH A;  3E22 E;  4C91 A;  2JTI A;  2AS1 A;  3FM1 A;  3UT2 A;  2DWG A;  3PTR B;  2KND A;  4JM8 A;  3OKQ A;  2XI6 A;  2BZB A;  3RKO A;  4JMB A;  3B57 A;  2IA8 A;  2KZ7 B;  1MKQ A;  4KBM B;  3J9X 1;  5C8Y E;  4UEM A;  5L3G B;  1WYB A;  3AA6 B;  2V7K A;  3I9Y A;  3CQG B;  2VWA A;  3NBX X;  1GX2 A;  5CIF A;  2ACX A;  3ZLI A;  2N1G A;  1H5K A;  1H5L A;  2V7M A;  4CZR A;  6ATJ A;  1YKH B;  1CCE A;  3EXB A;  5SYY A;  4V1A v; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...