3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
2GHCX 4CZNA 4NVIB 2V23A 6CCPA 1H5JA 2RBVX 1GZBA 1QO4A 4BM2A 1AEBA 3R98A 5SXTA 1SOGA 5CCPA 4BLKA 5AOGA 5JHXA 4A6ZA 3HDLA 4JMTA 1U2KA 1AETA 4JN0A 5SXWA 3FM4A 5KQHA 5CIGA 1JDRA 4CZPA 1LYKA 1DSGA 4NVFA 4NVMB 1YZRA 2XIHA 4NVDA 3WNUA 3M29A 1CCLA 1B80A 1YYDA 5CIBA 4JMBA 2Y6AA 2V2EA 1LLPA 3FM6A 1H58A 1HSRA 1H5FA 5SYVA 1CMUA 1CMTA 2XJ6A 5SYWA 1ATJA 3VLLA 2AS2A 5SXXA 1SCHA 5ABNA 2XIFA 4JMVA 4CUOA 2BCNA 1ARPA 4CCPA 5SX2A 4NVHB 1BEPA 2XILA 2CYPA 3VLIA 4BM1A 6ATJA 1BEJA 2E3BA 2VCFX 7CCPA 4JMSA 2RBXX 1BGPA 3M2CA 2XJ8A 4A5GA 5SYKA 2GHKX 1ARXA 2EURA 5JQRA 2EUOA 4OQ7A 5JHZA 5KQ3A 2B0ZA 4FDQA 1ARUA 3ZCYA 2XJ5A 2EUPA 1AEHA 1GWUA 5SXQA 4CZRA 1H5HA 4JM5A 5FNEA 1MK8A 1YZPA 1AC8A 1LYCA 2W23A 1FHFA 3M27A 1AEOA 1MN1A 4G05A 2CCAA 1OAGA 5SYJA 1PA2A 4XVAA 7ATJA 1MN2A 3M2EA 5CJHA 5L86A 1CCIA 1QGJA 3Q3UA 5CICA 1V0HX 2EUTA 3FM1A 4A71A 3M28A 5SXSA 2YCGA 1QPAA 4XV7A 1AEEA 4XV5A 4XV6A 1H5LA 1GX2A 4JM9A 5KQ2A 1BVAA 4JMWA 3M2GA 2N18A 1CMPA 5KSFA 1H5GA 1H5EA 1BEKA 2Y5AA 4BLYA 2CCPA 2E3AA 2GHHX 5AL9A 5L05A 1AA4A 3FKGA 4GEDA 3E2NA 2VCSA 5SX6A 4XV4A 2PCBA 2EUNA 1B85A 5SX0B 1ARYA 5JHYA 1CPGA 2GHEX 3EXBA 4C51A 4BM0A 5SYLA 1MKQA 4JPUA 5SXRA 2IA8A 1STQA 1CCAA 4A78A 1CCCA 2VKAA 2AS3A 4XV8A 2X07A 1IYNA 1SJ2A 3VLKA 1YYGA 2GB8A 1GW2A 2BOQA 5SW6A 4JPTA 1SBMA 2VNXX 1AEMA 4CZOA 5KQIA 1EBEA 1HCHA 2AS4A 1DJ5A 1CCGA 5FNBA 1APXA 2XI6A 3RIWA 5D6MA 1LY9A 2B11A 4BM3A 4BLZA 3VLMA 1CCEA 2YLJA 2WD4A 3ZCHA 1MNPA 5KQ6A 1ZBZA 4NVEA 5CIEA 2CCDA 4ATJA 1U2LA 1H5DA 5ABQA 3M2BA 5SX0A 2RC0X 3RRWA 3M2AA 2JTIA 5SYYA 4PAEA 2E39A 2AS1A 1AESA 1DSPA 4USCA 5SYHA 2AS6A 2RC1X 5JPRA 2RC2X 3CCPA 3M23A 1H5IA 1W4YA 1H57A 2B12A 3M2IA 5EJXA 5SX3A 1ML2A 1CPEA 4NVOB 1ARWA 3M26A 3UT2A 3VLHA 1SDQA 5CIDA 4FCSA 3CCXA 2X08A 3X16A 1CCPA 1B82A 4JM8A 4A7MA 1U2JA 3UW8A 4JQKA 4CZQA 1BJ9A 1H5AA 5AMMA 2RBUX 3E2OA 1AEGA 1H3JA 5ABOA 4P4QA 4CVJA 3VLJA 5SW5A 1H55A 3ATJA 1ZBYA 5CIFA 4CVIA 4JQJA 4FEFA 1CCBA 1CPDA 1U75A 1UB2A 2CL4X 4JQMA 1DJ1A 2ANZA 1A2GA 1BEMA 4NVGB 1AC4A 4CCXA 4FCNA 1DSOA 4JB4A 2VO2X 3FJWA 2VNZX 3M2HA 4NVCA 2ICVA 1AEQA 1GZAA 1CPFA 5SX7A 1GWTA 4NVKB 1H5KA 4JM6A 1DSEA 1S73A 4NVNB 2EUQA 5SYUA 3R99A 1CYFA 2RBTX 2AQDA 1CCKA 1H5CA 1KRJA 1S6VA 3M2DA 2EUUA 4JMAA 1MKRA 2B10A 1AEFA 1KOKA 1CCJA 4BLLA 5KQ0A 2PCCA 1A2FA 2VCNA 5SX1A 1LGAA 4NVJB 5CIHA 1RYCA 3M8MA 3M2FA 5SYXA 3ZCGA 1KZMA 4JQNA 4BLXA 1DS4A 4NVLA 1JCIA 2GGNX 5KSKA 1AEVA 3M5QA 1AENA 4BM4A 1LY8A 1AEJA 3WXOA 4NFGA 2CEPA 1AEKA 1KXNA 1OAFA 3M25A 1BESA 1CK6A 4NVBA 1W4WA 4C50A 1ITKA 5EJTA 4NVAA 1AEDA 1BEQA 5KQKA 1CMQA 2RBZX 4JMZA 5ALAA 3RIVA 1GWOA 2Y6BA 1Z53A 1C8IA 4JPLA 2GHDX 2ATJA 5L02A 1KXMA 1H5MA 2RBYX 1AEUA 1DCCA 2RBWX 1U74A 5SYIA 4BLNA 3FMUA 1ARVA 5SW4A 2EUSA
chains in the Genus database with same CATH superfamily
3ONJA 4UV9B 5JTGA 2GHCX 3PV0F 4IE6A 4WYVA 5TAOA 3TLVA 5SXTA 3VR8A 4YSZA 4HFIA 3RYIE 1WR6A 2N2NA 1VOMA 2UXDT 4JN0A 2N1GA 3FM4A 5LG4A 4NVMB 2I59A 4NVDA 3M65A 1B80A 2WBLA 1LLPA 5C8YE 3RH3A 4B6XA 4AQYT 4X1YE 3I0QA 4ZI7E 3WAJA 4AKHA 2CXDA 2XJ6A 3VR9A 5BR8T 2LSKA 4EZ4A 5SXXA 2X9HA 2W66A 4NIQA 5ABNA 4AI6A 2BS4A 5CFBA 5LHIB 2EHOB 4CUOA 5SX2A 1ZKEA 5A1LA 4MBQA 4B3MT 2XILA 4BM1A 1SHZC 1BEJA 2E3BA 3UFGA 4WNKA 7CCPA 3ZC1A 3IEEA 4DR6T 5JVDE 1UK5A 2IHR1 2RBXX 1BGPA 4A5GA 5SYKA 2KT9A 2YK0A 3ETVA 2CLYB 1ARXA 5JQRA 4GKJT 4UELA 1IZNB 4EEDA 3GWHA 2YKSA 3E22E 4H63H 5FMNA 5KQ3A 3MKDA 4EYUA 3EDUA 1U5PA 4FDQA 5LBQB 4CI3B 2PG8A 1H7CA 4PNIA 4O4HE 4CZRA 4LMLA 3C98B 4QH1A 2ZCAA 1MK8A 4O4JE 5AQIB 2N9DA 4LF9T 5FYMA 3SFEA 3IF8B 2W23A 2YEVC 4P0AA 1ZV4X 3M27A 5BMVE 2CCAA 3N9MA 2VASA 1FJGT 4NUUA 4YTPA 1PA2A 2XM1A 1MN2A 5CJHA 2LHNA 1CCIA 3CWZB 5FY0A 2LSGA 2BZBA 3QB5A 2C5IT 3CPZA 3O1IA 4XV7A 4EEBA 4XV5A 3LJCA 3LFMA 1GX2A 2Y48B 3M2GA 2DNXA 2N18A 4P0BA 1CMPA 1H5GA 1BEKA 4NUVA 4BLYA 3RIFA 4ISSA 1AA4A 3FKGA 4GEDA 3CX8B 3J9X1 2VCSA 4XV4A 2PCBA 4OFZA 4GYSA 5LGNB 2Z6EA 2V8SV 2V7MA 3UU3A 4JPUA 2HHHT 2IA8A 4XZCA 5H9EB 1XWMA 1CCAA 2BBJA 3C4ZA 1HNXT 2VKAA 2NP9A 2XAHB 4XV8A 3EAMA 3LSVA 1D0XA 4BAYB 3VLKA 5JRCB 1YYGA 3W15B 2CMRA 4DR4T 4KI0F 2Q9QA 3Q2MA 4I43B 1YQ3A 2IC9A 5KQIA 1HCHA 4B3TT 2AS4A 2K24A 4JYAT 1CCGA 2XI6A 2BVLA 5D6MA 4IE7A 2NWBA 3FZLB 4ILBA 1BR4A 1CCEA 2YLJA 5H9FB 1MNPA 3LK2B 2PFVA 1OEDB 3RX6A 4N78D 2WCAA 2J1DG 4ATJA 2JMKA 3DP7A 1U2LA 2E2AA 2G0UA 2V6XA 4EYYR 5LGTB 2LHRA 2YN6A 5FNVE 1H5DA 4PFPA 4JI2T 5ABQA 3P50A 2J47A 2UUAT 3M2AA 4CI1B 4LF5T 4U7IA 1IJ6A 4PAEA 4JUYA 3ZN0B 2H88A 1AESA 4K0UA 4J2CA 3QC9A 4X1KE 2H89A 5HXSA 2JIWA 3ETUA 3CCPA 2XQYA 1ZHCA 2XHEB 5DQWA 5HXEA 3FBZA 3ZJ2A 1VRBA 3P7IA 4QX8B 3VU7H 3LK42 3F57A 1ML2A 3AAEB 3MK7C 4TN7B 3RYHE 1KK7A 3GA8A 2MBGA 3PJAJ 5HCJA 1ARWA 2LSYA 5EK3A 3MA9A 3M26A 3UT2A 5J2TE 2WZHA 5L4EA 3CCXA 2X08A 4OX9T 1B82A 2W61A 4ZHQE 4JM8A 4A7MA 2XJ7A 2WM9A 4JI6T 1AEGA 4EOZB 3R6NA 3VLJA 5HXCA 3RRCA 5SW5A 1HCIA 1QLBA 1ZBYA 5FXXA 4HFBA 1IBMT 3EI0A 4DBRA 4KBMB 4G63A 5AQVB 1CPDA 1HFAA 3Q5WA 1JNRA 1UB2A 3I1AA 4B3RT 2CRBA 1BEMA 2I6HA 2HH7A 2CM0A 4H7AA 4I4TE 4FCNA 1T72A 3Q5DA 3C51A 1DU2A 3QOFA 3ANWB 4KHPT 5L3EB 4EIWA 2NW7A 1N32T 1H5KA 2LKHA 4X66T 3SRZA 3NBXX 2EUQA 5SYUA 4LF6T 4X65T 4EXTA 5AQSB 1CCKA 5L47A 2XAJB 5J0ZA 3ZT7A 3M2DA 2VL0A 2EUUA 2NW8A 4JMAA 4HWCA 2W2UA 4H9OC 1KOKA 1CUNA 2WDRA 5FKYA 3MZKB 4BLLA 2WDVA 2PCCA 3CQCB 3RI5A 4ERRA 3N2OA 2IIUA 3AE9A 1T98A 4NVJB 3FXEB 1RYCA 3M2FA 3L3PA 1S94A 4QWNB 4BJMA 3O1JA 4BLXA 1DS4A 4X5TA 4CQIA 5FXWA 4JEUB 5KSKA 3M5QA 5AQFB 4BM4A 4NFGA 3ZSTA 5AQPB 1KXNA 1N34T 4U33A 4CN4A 4ILCA 1MMAA 3QB5K 3OBVE 4BA9A 5LXTE 3N2KE 4IHJE 5ALAA 3P4SA 2Y6BA 2NTXA 1Z53A 4A98A 1H5MA 5LCYA 1DCCA 5SYIA 5JR9C 3D0TA 3SWHA 1ARVA 3VKHA 2EUSA 2EHOC 4NVIB 2V23A 2W0GA 2OV9A 4XBFB 1H5JA 4L5GA 1WRDA 4EZHA 1SOGA 2UXNB 3AE8A 2CHNA 1I6ZA 4G2AA 3KV4A 4GKKT 4P1NA 5L2LA 2XUEA 2CLYC 4JMTA 3R84B 1AETA 5SXWA 1JDRA 2XIHA 3ZYLA 3WNUA 4F6RC 3M29A 3NRXA 4UR9A 5CIBA 4ZI2D 4JMBA 2VK9A 2CBIA 4MLKA 1H5FA 5CB4E 5ABFA 4O2BE 4PAGA 4KX6A 2V7KA 5M4YA 5SYWA 2H7VC 1Y01A 3LDQB 2AS2A 2LJLA 2K48A 1LKXA 3AA1B 1ARPA 4NVHB 4H9PC 3N9QA 2CYPA 2VCFX 2IDOB 2WB5A 3TLTA 5LP6E 4DUZT 2QRXA 3RKOA 1ZOYA 4I55E 2XQ8A 4JV5T 2GHKX 3B5MA 1YXRA 2J4GA 4CXYA 4ZZCA 3CQGB 1X9BA 3M3ZB 3ZCYA 2V7LA 2XJ5A 2WU2A 5IHYA 5JDFA 2VWAA 5AQMB 1H5HA 4DBQA 3LG7A 2LOPA 1YZPA 1AC8A 5FXVA 3FZHB 2VVNA 2EHOD 5LNKA 3PTRB 1FHFA 3ZN1B 3S4UA 4DMVA 1G8XA 5AQGB 2IC6A 4A56A 2FJBA 4C91A 3AE7A 2JQQA 2JQHA 5LMUT 4I0UA 3FM1A 4HWFA 3HA4A 3NVOA 1KFYA 2L8KA 4XV6A 2WMOA 4JM9A 5KQ2A 1OEDE 2D0TA 4OYKA 1MIVA 5FL0A 2MOZA 5KSFA 4OK0A 2Y5AA 2WQYA 2CCPA 5HWXA 5AL9A 4O4LE 2XAQB 3N5LA 3E2NA 3PU8A 5SX6A 1VCSA 1B85A 5AQUB 1ARYA 1VCTA 2P9BA 2GHEX 1B7TA 2AXDS 2XQ7A 1HTJF 3PUSA 3K3NA 5LA6E 2KINB 2BKOA 3AEFA 3NRYA 3UULA 3VRBA 4TNWA 2QGSA 3DJBA 5E0OA 1IYNA 1SJ2A 2HPLA 3TLSA 4PFOA 1SE7A 4HFDA 1HR0T 1HG2A 5SW6A 3AB3B 1AEMA 4CZOA 3RC8A 4TNVA 3GMIA 2HN1A 3RIWA 4YTNA 4CXXA 3HKEE 2LKGA 2K5BB 4HE8A 2V26A 3MJXA 4DR5T 2BBHA 1ABVA 1WFDA 5CIEA 3M2BA 5SX0A 3PURA 2RC0X 3RRWA 2C5KT 2JTIA 3AE1A 3RKGA 2KXPB 2AS1A 2V5DA 2V7JA 4U7UB 5AQNB 2WZIA 3A5XA 2ACXA 2BDEA 2DHRA 2VVSA 4JI3T 4DV4T 1G73A 4JI1T 1W4YA 2B12A 3M2IA 2D9DA 5CD4J 3FXDB 4ZZBA 1OWAA 3RF1A 1HS7A 1W9RA 2XSAA 5CA1E 2C5JA 3TLWA 2CBJA 2V7IA 1IJ5A 1SDQA 4JZAA 5EK4A 5CIDA 2FJEA 3PUVF 1CCPA 2V6YA 1U2JA 1XDOA 1XDPA 2LM2A 2XSBA 1BJ9A 5AMMA 3ZC0A 2YDQA 1OXZA 5ABOA 4CVJA 4WBOA 3F31A 5DQVA 3LBXA 3ATJA 4QH5A 3UU6A 4WBNE 3FZFB 2JMHA 4U2ZA 1U75A 5FVKA 2W00A 3FBLA 1DJ1A 4DR1T 1EZ3A 3T1HT 1A2GA 4NVGB 2MPKA 2ZM0A 5EZYE 4HFEA 1BR1A 1E7PA 2E9XA 2VO2X 3M2HA 4ISTA 3GN5B 3AEEA 1GZAA 5SX7A 5AQHB 1GWTA 5CA0E 3MXZA 4IDPA 2WAUA 2CXLA 1S73A 3R99A 1W0BA 4YFSA 2RBTX 3RYCE 2LEHA 2AQDA 4DV7T 3UU8A 4DMWA 3ZMTB 3PUAA 2BO5A 3AE3A 3X1DA 1AEFA 4PJMA 4DVDA 4UV8B 4ZS2A 4YHHT 4LF8T 4EV6A 1FIOA 5L3BB 2VCNA 2KWHA 4UXNB 3P4PA 5CIHA 3M8MA 1R8IA 1KZMA 2WWVA 5LHGB 1KEYA 4QXCB 4NVLA 3RGLA 2GGNX 4AQFA 1AEVA 4EAHA 3ZMVB 4DR2T 2X51A 1LY8A 1QSDA 4YSXA 2CEPA 1AEKA 1V9DA 4X62T 4NXNT 3TLUA 1I94T 1W4WA 4OYJA 3HI2A 4H9NC 3T1YT 2YDRA 5EJTA 2X9XA 4COFA 2W63A 5JDHA 2UXBT 5JR9A 2RBZX 2PJQA 3KV5A 2X0YA 1NWMX 2EHOA 4Z8XA 4JPLA 3WA8A 2UUBT 2ATJA 5L02A 3AXJA 3VRAA 1YW0A 2XQ5A 1D1AA 4BLNA 1JNZA 3P4QA 3EHZA 3UUBA 5AQRB 2JRKA 1LRZA 3LK3B 3BQKA 3CK6A 2YU1A 5F3JA 4HGAA 1LVKA 4IE5A 1WR0A 5JDGA 2RBVX 1BR2A 1QO4A 3ABVA 1N33T 1AEBA 4IDNA 5CCPA 3KDSE 4H9QC 2K9AA 4LMJA 4QKNA 3SS1A 4V1Av 4A6ZA 4H9SE 3AA6B 2V5CA 2A3DA 3HDLA 5FY7A 1U2KA 3KINB 1AJ3A 5KQHA 5CIGA 1KNZA 4LFCT 4CZPA 1LYKA 3K3QC 4NVFA 2NR4A 5J2UE 4ZI3C 4IGUA 4U72A 1WLXA 1CCLA 1YYDA 5AQQB 3K1SA 5CGMA 4ZS3A 4DIDB 5GONE 2Y6AA 1MNEA 4Z91A 3ZMUB 2BG9B 4YY3T 4CXWA 1CMUA 2BKPA 5JDLA 1CMTA 1Z8UA 2B76A 3HKBE 1SCHA 4UF0B 4ZI2C 2XIFA 4JMVA 3JC6D 1NEKA 3ZJ1A 2BCNA 4CCPA 1BEPA 2A72A 5ADXL 4JI0T 3M2CA 4LF4T 2EURA 5JDNA 4U2YA 2X0LB 5JHZA 3PUZF 2B0ZA 4BJNA 2CE7A 3AEDA 2RP4A 1NENA 1ARUA 5IUXA 2XASB 2JPFA 4TWHA 2ACZA 1GWUA 1UX4A 2VKHA 5DJQC 1XMOT 3PUXF 5FNEA 3UU5A 2OLTA 2XQ6A 2LSJA 3O1HA 4CN6A 3UFEA 2CHOA 2I0MA 3ESLA 2LRLA 5F5WA 4DV2T 1UX5A 2YDSA 5SYJA 1MIYA 4O8SA 7ATJA 3JAFA 2XQ9A 2ZM6T 3NZQA 3M2EA 5L86A 4IREA 3CMLA 1J5WA 1J1JA 1YKHB 2EUTA 5HEUA 5ABGA 4A71A 3M28A 1UCUA 5SXSA 1QPAA 1AEEA 3V5SA 4ZI3D 2PTFA 1H5LA 2DLRA 1T8BA 5DABA 5AFUL 5LJNA 1BVAA 4JMWA 4TV9E 1XMQT 4TV8E 3FZMB 2WU5A 2NOXA 1WCRA 3KBTA 3N9PA 1XNRT 4PJLA 4E7ZA 4F8HA 5SX0B 5HEHA 5JHYA 3SFDA 4Q25A 5SYLA 3IBPA 3NZPA 2VB6A 5SXRA 3PUQA 2X9WA 5L4HA 3OYXA 5F8PA 4MALA 3QK6A 3O9XA 3X1LF 5AQLB 2GB8A 4HWDA 2BOQA 2W62A 2W67A 1L0VA 2VNXX 1EBEA 4JI7T 4L0RA 3KV9A 4JI5T 4DNDA 3UUNA 4KUMB 2WY2A 1APXA 2VQET 4P09A 4U31A 4HFVA 3KFWX 2B11A 3AA0B 2QVAA 5HCMA 4MHCA 3ZCHA 2V6YB 3AE2A 2SPCA 5KQ6A 3AVRA 5LBMA 1ZBZA 4NVEA 4GYRA 4KMCA 3SOLA 4TWDA 3C4WA 3Q5EA 1D1BA 2M6IA 5SYYA 2E39A 4DV0T 4AKRB 1DSPA 3ZLIA 2XTLA 5SYHA 2RA1A 3DTOA 3F2EA 5JPRA 3ZT5A 2RC2X 2OEBA 4ZXLA 1XNQT 3NWIA 5KMGP 3L09A 4X1IE 2E9XB 2NTYA 2L3LA 1UURA 3QNUA 1CPEA 2WSSS 4QHOA 3B57A 2Q9QB 4C90A 3AVSA 3VLHA 2PBIA 1HG5A 2FBWA 2YU2A 4FCSA 3A8YC 4TUYE 3UQ4A 2OA5A 2JQ9A 3UW8A 1KNPA 2RBUX 3E2OA 5H6QB 2XM2A 4A97A 2IAKA 1H3JA 4P4QA 4KHZF 3JCFA 2BS3A 1E1HB 2IW5B 2VL8A 5CIFA 3ONXA 4CVIA 1OEDC 2VQFT 3CQXC 2MTQA 4HFHA 1CCBA 3RQWA 5L3FB 4QYZB 1SUMB 4GOUA 2M6BA 4X64T 4JQMA 4AKGA 1FMVA 2CXFA 5ABEA 3QUJA 4O4IE 3VHLA 5C2TA 4DR3T 4M1PA 2KNDA 2XQAA 4IL9A 4CCXA 2UXCT 1DSOA 5HEOA 4JB4A 2LE8A 2LSIA 2VNZX 2X67A 2VURA 2LOSA 2ICVA 3OVUA 3I9WA 3ZKRA 1SA0E 4ILAA 2KWIB 4NVKB 2E5VA 2W4XA 3CIRA 2FJDA 1CYFA 2VKOA 3A7MA 5HEGA 3JAEA 3ONLC 4DO0A 4NPPA 1O3XA 2DCFA 4NXMT 5JR9B 2LT3A 4AQGA 2X0HA 5L3GB 4YHJA 4PK6A 4DV6T 3KV6A 3FHNA 3AXJB 3PDYA 3CVRA 2K3WA 3EUHA 4AIUA 1N36T 3V5UA 2KSRA 4PW8A 4PJJA 2M67A 5ETWA 1HNWT 5SYXA 2VKJA 3I0OA 3ZEFB 3ZCGA 5LHHB 3UU4A 4JQNA 3WAKA 1Y64B 3BK9A 2H3RA 1JCIA 2CCQA 4XAXB 4WZXA 2JJ9A 2ODUA 4UVAB 1AEJA 5JDMA 3WXOA 2E5LT 3RLFF 3UUMA 2RPAA 2Y6XA 1MNDA 1OAFA 4U74A 1BESA 4UVCB 2GK9A 4NVBA 4L9IA 2BS2A 3JADA 2BG9E 3TKLB 3RIUC 5FP3A 3PUGA 1ITKA 4FJOA 4HTEA 4AXPA 1E2AA 4K0KT 4X20E 2BG9C 3RIVA 1GWOA 1C8IA 1XZYA 2GHDX 4MFRA 1KXMA 1HNZT 2UUCT 3PJAA 2RBWX 3FMUA 2DL1A 4ZOLE 4AKIA 1D1CA 2DI4A 4CZNA 3BQLA 6CCPA 2KZ7B 2CEAA 1W0AA 4DR7T 2ZM2A 1GZBA 4BM2A 3R98A 4BLKA 5AOGA 2C0SA 5JHXA 3AAIA 5C3JA 3H3MA 3H3AA 3L8RA 5LJMA 1WYCA 3ZSSA 4QXHB 2V1DB 1YQ4A 1DSGA 4GK0E 5KX5E 1YZRA 2FUPA 3C50A 1MMNA 4H79A 5FXZA 2V2EA 4QH4A 1HF8A 3FM6A 1H58A 1HSRA 5SYVA 4UIGA 5H6RB 3N9NA 4ZEYA 3HKCE 4CZZB 2XAFB 3EDVA 1ATJA 2XY8B 3VLLA 3ZCJA 3N9OA 5EK2A 2FJAA 2R6GF 1X79A 3EABA 2ODVA 1FEWA 3FB2A 1T7SA 2QYWA 3VLIA 6ATJA 1S35A 3K3OA 5AQOB 1MMGA 4JMSA 3AECA 2BKNA 4HFCA 3AAAB 3RYFE 2XJ8A 3PE0A 4WW0A 4EB6E 3OJAA 2XZEA 1ZP0A 3JC6C 5HXHA 2EUOA 4OQ7A 4ADZA 5HXRA 1ZEEA 2H7OA 5LGUB 3UQ7A 2EUPA 1AEHA 3J7Yq 1M7KA 3O4XE 3UT5E 5SXQA 4JM5A 3CX7B 1J5ET 4IE4A 2A2FX 1IAPA 2DWGA 3OPCA 1YKEB 3KBUA 1LYCA 4YLHA 3I9YA 3IHRA 3P4WA 5CJ5A 4QXBB 1AEOA 4YXDA 4GIWA 5ABFB 2D5UA 1BR0A 2KLQA 1MN1A 4G05A 1OAGA 3VKGA 2B1EA 2UU9T 4YT0A 4XVAA 4FI5A 2BVMA 3CKDA 5JDQA 1QGJA 3Q3UA 2X68A 5CICA 1V0HX 4B3ST 4OHFA 4IT4A 2NW9A 3E08A 2ES0A 4ILUA 2YCGA 5L3DB 2CA5A 3ZPOA 3U3IA 4JEHB 1WYBA 3AA7B 2JQKA 4TZ4C 3RPUA 2L9QA 1H5EA 4TWFA 5LYJE 2E3AA 2GHHX 2J62A 5L05A 3AEBA 3UTKA 2EUNA 3HR0A 4CI2B 3OTOT 1CPGA 3OKQA 3EXBA 4C51A 2ZOPA 4BM0A 1UGOA 3B13A 1MKQA 1MIWA 1STQA 4A78A 1CCCA 1FMWA 2AS3A 3L39A 2X07A 2HN2A 4HN9A 2XPKA 1GW2A 4UVBB 3UUXB 4JPTA 1SBMA 2E9XC 3IA3A 5J1GA 3AE5A 4PK5A 2MYSA 3BQIA 2WSSV 1DJ5A 5FNBA 4H63V 1W09A 2Q9QC 1LY9A 1QUUA 4BM3A 4Z90A 4BLZA 3VLMA 5IWAT 2WD4A 2WWUA 3PUYF 2XQ3A 4DUYT 2VKDA 3E0ZA 2CCDA 1LVFA 2IMLA 5HEJA 5JREA 3P8CD 3ZYMA 4IDQA 2D2SA 1KNRA 2IUBA 2X66A 5HYAA 2Y8DA 3OYZA 4LF7T 4USCA 4ASKA 1HX1B 2WMNA 2KMFA 2AS6A 3RQUA 2RC1X 4GKFA 2E8IA 3N2GE 3Q5XA 3KVBA 5AQJB 3GN5A 4IDOA 3M23A 3G06A 3FZKB 1H5IA 3ZT6A 5HAXA 4LFAT 3AEAA 1H57A 5JRCA 4AQFC 5EJXA 1D0ZA 3ZYKA 5SX3A 3EVYA 1NAFA 4CN1A 5AQTB 1M62A 3MACA 4JI8T 3HKDE 3ZMZB 2CPTA 4YTMA 2UXXB 4NVOB 1IBLT 4LMKA 4KP3C 4EGWA 3PU3A 2ZMAA 1HX8A 3X16A 2X9YA 3N9LA 3CX6B 1OEDA 4JQKA 4CZQA 5KXJA 5LG3A 4DV5T 1H5AA 2MAWA 2JMXA 2HPJA 4HWIB 4IE0A 1H55A 2LRKA 1GQEA 3WI3A 4JQJA 4FEFA 2QA7A 4HEAA 2XAGB 4LFBT 4AISA 2CL4X 2LM9A 1UUSA 5FY1A 2ANZA 5FVLA 2E9XD 2D0UA 1AC4A 2CWYA 1US7B 2XQ4A 2ZLYA 3T8OA 3FJWA 4NVCA 1AEQA 4U3CA 2Q9QD 5L3CB 4IDZA 1CPFA 4HKAA 4I50E 2WDQA 4JM6A 1DSEA 5HWYA 4NVNB 3PUWF 3P4RA 4IL4A 1CHUA 4TX5A 4JI4T 4AKLA 3AE4A 1H5CA 3AE6A 1KRJA 1S6VA 3HL6A 2A7UB 4PK4A 4A5XA 4PJNA 4JBWF 3U78A 1MKRA 2B10A 5LMNT 5LB7B 4UEMA 4E7SA 1CCJA 5KQ0A 2DWKA 4ANJA 2WS3A 1A2FA 3C4XA 4IIJE 3K8PC 3LBXB 5SX1A 1LGAA 4H9RC 4DV3T 2CWOA 3H37A 5LOVE 5AQKB 3NKZA 2ZM8A 1IBKT 2A9UA 5KDMC 4YJ2E 5ABHA 1YD8G 1AENA 4QX7B 3KVAA 1KF6A 3RIUA 2LLYA 3ANWA 3AEGA 4O2AE 3M25A 3RC3A 4YSYA 1CK6A 4JLEA 3ZCIA 2BG9A 1MMDA 1D0YA 4C50A 4YJ3E 4U7YA 4NVAA 1AEDA 1BEQA 3RHWA 5FL1A 5KQKA 4UF0A 1CMQA 4JMZA 1Z0PA 4DV1T 3C64A 2YINA 4HWHA 5JQGE 2AE9A 3ZMSB 2F4VT 2WP9A 2RBYX 5IYZE 3RIAA 1AEUA 2YOEA 1U74A 4GK5E 1U4QA 5SW4A 3Q9DA 5JH7E
chains in the Genus database with same CATH topology
2DI4A 2EHOC 1LRZA 3LK3B 4UV9B 2GHCX 3BQKA 4CZNA 5F3JA 2YU1A 3BQLA 4NVIB 4IE6A 2V23A 2W0GA 6CCPA 4HGAA 1LVKA 2KZ7B 2CEAA 4IE5A 4XBFB 1H5JA 4L5GA 2RBVX 1GZBA 1BR2A 1WRDA 1QO4A 4BM2A 2ZM2A 5TAOA 5JDGA 1AEBA 3R98A 5SXTA 4EZHA 1SOGA 5CCPA 3KDSE 2K9AA 4H9QC 4BLKA 4QKNA 5AOGA 2C0SA 2UXNB 3SS1A 5JHXA 3AAIA 4V1Av 4A6ZA 4H9SE 3AA6B 3H3AA 4G2AA 2A3DA 3KV4A 3RYIE 3HDLA 5FY7A 1WR6A 2XUEA 2CLYC 2N2NA 1VOMA 5L2LA 4JMTA 1U2KA 3R84B 1AETA 4JN0A 5SXWA 3KINB 2N1GA 5LJMA 1WYCA 1AJ3A 3FM4A 4QXHB 5KQHA 5CIGA 2V1DB 1JDRA 5LG4A 1KNZA 4CZPA 1LYKA 3K3QC 1DSGA 4GK0E 5KX5E 4NVFA 4NVMB 1YZRA 2XIHA 3C50A 3ZYLA 2I59A 5J2UE 4ZI3C 4NVDA 3WNUA 1MMNA 4IGUA 3M29A 4F6RC 3M65A 4H79A 4U72A 3NRXA 5FXZA 1WLXA 1CCLA 1B80A 1YYDA 5CIBA 4ZS3A 4ZI2D 4JMBA 2WBLA 3C64A 5GONE 2Y6AA 2V2EA 1LLPA 1HF8A 1MNEA 3FM6A 1H58A 3ZMUB 5C8YE 2VK9A 1HSRA 4MLKA 1H5FA 3RH3A 4B6XA 4CXWA 5SYVA 5CB4E 4O2BE 4X1YE 4PAGA 1CMUA 4UIGA 3I0QA 5H6RB 3N9NA 4ZI7E 3WAJA 5JDLA 4AKHA 2CXDA 1CMTA 3HKCE 4CZZB 2V7KA 2XJ6A 5SYWA 2H7VC 2XAFB 1ATJA 2LSKA 3EDVA 5M4YA 4EZ4A 3VLLA 2AS2A 5SXXA 2X9HA 3HKBE 3ZCJA 1SCHA 4UF0B 5ABNA 3N9OA 5EK2A 4AI6A 2LJLA 2K48A 4ZI2C 2XIFA 4JMVA 1LKXA 1X79A 2EHOB 3AA1B 3JC6D 5LHIB 4CUOA 2BCNA 1ARPA 4CCPA 2ODVA 3ZJ1A 5SX2A 1FEWA 4NVHB 1ZKEA 1BEPA 3FB2A 5A1LA 4MBQA 4H9PC 3N9QA 2XILA 2A72A 2CYPA 3VLIA 4BM1A 6ATJA 1S35A 1SHZC 1BEJA 2E3BA 2VCFX 3K3OA 5ADXL 4WNKA 7CCPA 3ZC1A 3IEEA 1MMGA 4JMSA 5JVDE 5LP6E 3AAAB 3RKOA 2RBXX 4I55E 1BGPA 3M2CA 3RYFE 2XJ8A 4A5GA 5SYKA 2KT9A 2YK0A 3ETVA 3OJAA 3PE0A 4WW0A 4EB6E 2CLYB 2GHKX 1ARXA 2EURA 5JQRA 3JC6C 4UELA 5HXHA 5JDNA 2X0LB 2EUOA 1IZNB 4OQ7A 3GWHA 3E22E 5JHZA 4H63H 5FMNA 5KQ3A 3MKDA 5HXRA 4ADZA 4EYUA 1ZEEA 2B0ZA 3EDUA 2H7OA 4BJNA 2CE7A 5LGUB 1U5PA 2RP4A 4FDQA 4CXYA 1ARUA 5LBQB 4CI3B 3CQGB 2PG8A 2XASB 1H7CA 2JPFA 4PNIA 3ZCYA 2V7LA 2XJ5A 2EUPA 1AEHA 3J7Yq 3O4XE 3UT5E 1GWUA 4O4HE 1UX4A 5SXQA 2VKHA 4CZRA 5DJQC 5IHYA 5JDFA 2VWAA 3C98B 1H5HA 4DBQA 4JM5A 3CX7B 3LG7A 2ZCAA 4IE4A 5FNEA 1MK8A 2A2FX 2LSJA 4O4JE 1IAPA 2LOPA 1YZPA 2N9DA 1AC8A 2DWGA 3O1HA 5FYMA 1YKEB 3KBUA 1LYCA 3IF8B 5FXVA 3UFEA 2W23A 2YEVC 2EHOD 3I9YA 3IHRA 4YLHA 4P0AA 1ZV4X 5LNKA 3PTRB 1FHFA 3M27A 4QXBB 3ZN1B 5BMVE 1AEOA 3ESLA 3S4UA 4GIWA 4DMVA 2D5UA 1G8XA 1BR0A 2KLQA 1MN1A 4G05A 2IC6A 1UX5A 4A56A 2CCAA 3N9MA 2VASA 1OAGA 3VKGA 2B1EA 4C91A 4NUUA 5SYJA 1PA2A 1MIYA 4O8SA 2JQQA 4XVAA 7ATJA 1MN2A 3NZQA 4FI5A 3M2EA 5CJHA 5L86A 2BVMA 2LHNA 1CCIA 3CKDA 3CWZB 5FY0A 5JDQA 3CMLA 1QGJA 3Q3UA 2LSGA 2X68A 5CICA 2BZBA 1V0HX 1YKHB 2EUTA 3FM1A 4A71A 4OHFA 4ZOLE 4AKIA 2NW9A 3M28A 2C5IT 1UCUA 3E08A 3HA4A 5SXSA 2ES0A 4ILUA 2YCGA 3CPZA 1QPAA 2L8KA 4XV7A 3O1IA 1AEEA 4XV5A 3V5SA 5L3DB 2CA5A 3LJCA 3ZPOA 4ZI3D 4XV6A 1H5LA 3LFMA 4JEHB 3U3IA 2WMOA 1WYBA 1GX2A 2DLRA 4JM9A 5KQ2A 5DABA 5AFUL 5LJNA 3AA7B 1BVAA 2Y48B 4JMWA 2D0TA 4OYKA 3M2GA 4TV9E 1MIVA 2DNXA 4TZ4C 3RPUA 2N18A 2MOZA 2L9QA 4P0BA 1CMPA 4TV8E 5KSFA 1H5GA 4OK0A 5JH7E 1H5EA 1BEKA 2Y5AA 4NUVA 4BLYA 5LYJE 2CCPA 2E3AA 2GHHX 2NOXA 5HWXA 4ISSA 5AL9A 4O4LE 3KBTA 5L05A 1AA4A 3FKGA 4GEDA 2XAQB 3CX8B 3N5LA 3J9X1 3E2NA 3N9PA 3PU8A 2VCSA 5SX6A 4PJLA 3UTKA 4E7ZA 4XV4A 2PCBA 2EUNA 1B85A 4OFZA 3HR0A 5SX0B 4CI2B 1ARYA 5JHYA 2P9BA 1CPGA 2GHEX 3OKQA 1B7TA 4GYSA 3EXBA 4C51A 4BM0A 5LGNB 2Z6EA 1HTJF 2V7MA 3PUSA 5SYLA 3K3NA 3IBPA 3NZPA 5LA6E 3B13A 1MKQA 4JPUA 5SXRA 1MIWA 2KINB 2VB6A 2IA8A 3PUQA 4XZCA 5H9EB 3NRYA 1STQA 1CCAA 2X9WA 4A78A 3UULA 3C4ZA 1CCCA 2VKAA 2NP9A 1FMWA 2AS3A 2XAHB 3OYXA 4XV8A 2QGSA 3DJBA 2X07A 5E0OA 5F8PA 1IYNA 1SJ2A 4MALA 1D0XA 2HPLA 4PFOA 3QK6A 4HN9A 4BAYB 3VLKA 5JRCB 1YYGA 3O9XA 2GB8A 2CMRA 3W15B 1HG2A 1GW2A 2BOQA 2W62A 4UVBB 2Q9QA 3Q2MA 5SW6A 4JPTA 3AB3B 4I43B 3UUXB 1SBMA 2E9XC 2VNXX 5J1GA 1AEMA 4CZOA 2IC9A 4PK5A 5KQIA 3RC8A 1EBEA 1HCHA 2MYSA 3BQIA 3KV9A 2WSSV 4L0RA 4DNDA 2AS4A 2K24A 1DJ5A 3GMIA 3UUNA 1CCGA 5FNBA 4KUMB 1APXA 2XI6A 4H63V 4P09A 3RIWA 2BVLA 5D6MA 2Q9QC 4HFVA 4IE7A 1LY9A 3KFWX 1QUUA 2B11A 2NWBA 4BM3A 3AA0B 4CXXA 4BLZA 1BR4A 3VLMA 1CCEA 2YLJA 3HKEE 4MHCA 2WD4A 2K5BB 4HE8A 3ZCHA 5H9FB 2V26A 2WWUA 2SPCA 3MJXA 1MNPA 5KQ6A 3LK2B 2PFVA 3AVRA 5LBMA 1ZBZA 4NVEA 4GYRA 3RX6A 4N78D 4KMCA 2VKDA 3SOLA 2J1DG 5CIEA 2CCDA 4ATJA 1LVFA 1U2LA 2G0UA 2JMKA 3C4WA 3DP7A 3E0ZA 4EYYR 2LHRA 5LGTB 3P8CD 5FNVE 1H5DA 4PFPA 3ZYMA 5JREA 5ABQA 3M2BA 5SX0A 1D1BA 2D2SA 3PURA 2RC0X 3RRWA 3M2AA 2C5KT 2JTIA 2X66A 4CI1B 5SYYA 1IJ6A 5HYAA 4PAEA 4JUYA 2E39A 2KXPB 3ZN0B 2AS1A 2Y8DA 1AESA 3OYZA 2V7JA 4K0UA 4J2CA 3QC9A 4U7UB 4AKRB 3A5XA 2ACXA 1DSPA 4X1KE 4USCA 2BDEA 4ASKA 2WMNA 2XTLA 5SYHA 2KMFA 2RA1A 3DTOA 2AS6A 3F2EA 3ZLIA 2RC1X 5JPRA 2E8IA 2RC2X 5HXSA 2DHRA 3N2GE 3ETUA 3Q5XA 3KVBA 3GN5A 3CCPA 2XQYA 3M23A 5KMGP 1ZHCA 1H5IA 1G73A 5HAXA 2XHEB 1W4YA 1H57A 3L09A 5DQWA 2B12A 5JRCA 5HXEA 3M2IA 4AQFC 5EJXA 3FBZA 4X1IE 1D0ZA 3ZJ2A 2E9XB 1VRBA 2NTYA 2L3LA 5SX3A 3EVYA 5CD4J 1NAFA 3P7IA 3ZYKA 4QX8B 3VU7H 3FXDB 3LK42 3MACA 3F57A 1ML2A 3AAEB 3HKDE 3ZMZB 3MK7C 1CPEA 4TN7B 3RYHE 1KK7A 3GA8A 1OWAA 2MBGA 2UXXB 4NVOB 1HS7A 4QHOA 3B57A 2Q9QB 5CA1E 1ARWA 2LSYA 4C90A 3AVSA 5EK3A 3MA9A 3M26A 3UT2A 3VLHA 2C5JA 2PBIA 2V7IA 4KP3C 1IJ5A 1HG5A 1SDQA 4JZAA 5EK4A 5CIDA 3PU3A 5J2TE 2ZMAA 2YU2A 4FCSA 1HX8A 3CCXA 2X08A 3X16A 1CCPA 4TUYE 2X9YA 1B82A 2W61A 4ZHQE 4JM8A 4A7MA 2OA5A 1U2JA 2WM9A 3N9LA 3CX6B 3UW8A 4JQKA 4CZQA 1BJ9A 1H5AA 5AMMA 2RBUX 3E2OA 1AEGA 5H6QB 3R6NA 4EOZB 3ZC0A 2IAKA 1H3JA 5ABOA 4P4QA 4CVJA 1OXZA 3F31A 3VLJA 3LBXA 4WBOA 2HPJA 4IE0A 5DQVA 5SW5A 1HCIA 5HXCA 3RRCA 1H55A 1E1HB 3ATJA 2IW5B 2VL8A 1ZBYA 5CIFA 5FXXA 3WI3A 3ONXA 4CVIA 4JQJA 4FEFA 2QA7A 4HEAA 2JMHA 2MTQA 3CQXC 1CCBA 4DBRA 4WBNE 2XAGB 4G63A 4KBMB 5L3FB 1CPDA 4QYZB 1HFAA 4GOUA 3Q5WA 1U75A 1UB2A 2CL4X 4JQMA 4AKGA 1FMVA 2CXFA 3I1AA 2W00A 2LM9A 3QUJA 3FBLA 1DJ1A 4O4IE 1EZ3A 5FY1A 3VHLA 2ANZA 1A2GA 1BEMA 4NVGB 2E9XD 2HH7A 2CM0A 4H7AA 1AC4A 2D0UA 2KNDA 2ZM0A 4I4TE 4CCXA 4M1PA 5EZYE 4FCNA 1DSOA 2CWYA 1BR1A 3C51A 1US7B 4JB4A 2ZLYA 3T8OA 2E9XA 2VO2X 3FJWA 2LE8A 2VNZX 2LSIA 3M2HA 2X67A 4NVCA 2LOSA 2ICVA 3GN5B 4ISTA 3I9WA 1AEQA 2Q9QD 5L3CB 1GZAA 4IDZA 1CPFA 5SX7A 3ANWB 1SA0E 1GWTA 4HKAA 5L3EB 2KWIB 4EIWA 4NVKB 2NW7A 3MXZA 1H5KA 2WAUA 4JM6A 4I50E 5CA0E 1DSEA 5HWYA 2CXLA 1S73A 3SRZA 4NVNB 2EUQA 5SYUA 3R99A 3NBXX 2VKOA 1CYFA 2RBTX 4YFSA 3RYCE 2LEHA 2AQDA 4EXTA 4TX5A 1CCKA 4AKLA 2XAJB 4DMWA 3ZMTB 1H5CA 4DO0A 1KRJA 1O3XA 3PUAA 1S6VA 3M2DA 2DCFA 3HL6A 2EUUA 4PK4A 4PJNA 2NW8A 4JMAA 3U78A 1MKRA 2B10A 5JR9B 2LT3A 4AQGA 1AEFA 4H9OC 1KOKA 4PJMA 4YHJA 5L3GB 4PK6A 1CUNA 3KV6A 4DVDA 4UEMA 4E7SA 4UV8B 4ZS2A 3MZKB 3FHNA 1CCJA 4BLLA 5KQ0A 1FIOA 2DWKA 2PCCA 3CVRA 1A2FA 3EUHA 3PDYA 3CQCB 4ANJA 5L3BB 2VCNA 3V5UA 4PW8A 3C4XA 4ERRA 2KWHA 2M67A 4IIJE 4PJJA 3N2OA 4UXNB 5ETWA 3K8PC 3LBXB 5SX1A 1LGAA 4NVJB 5CIHA 1RYCA 1T98A 3M8MA 3FXEB 3M2FA 5SYXA 2VKJA 3I0OA 4H9RC 3ZCGA 1KZMA 2CWOA 3ZEFB 5LHHB 3L3PA 1S94A 4QWNB 4JQNA 3WAKA 5LHGB 3H37A 4BJMA 1Y64B 4QXCB 3O1JA 5LOVE 3BK9A 4BLXA 2ZM8A 1DS4A 4NVLA 4CQIA 2H3RA 5FXWA 1JCIA 2GGNX 4YJ2E 5KDMC 2CCQA 4JEUB 4AQFA 5KSKA 1AEVA 3M5QA 4XAXB 4EAHA 1YD8G 3ZMVB 2JJ9A 1AENA 2ODUA 4BM4A 2X51A 1LY8A 1QSDA 1AEJA 4UVAB 3WXOA 5JDMA 4NFGA 4QX7B 2CEPA 3UUMA 3KVAA 1AEKA 3ANWA 2Y6XA 1KXNA 1V9DA 1MNDA 1OAFA 3M25A 4O2AE 4U74A 1BESA 3RC3A 1CK6A 4UVCB 4JLEA 2GK9A 4NVBA 4L9IA 1W4WA 3ZCIA 1MMDA 1MMAA 4OYJA 3TKLB 3HI2A 4H9NC 5FP3A 3OBVE 1D0YA 4BA9A 4C50A 3PUGA 1ITKA 4FJOA 4YJ3E 5LXTE 5EJTA 4NVAA 3N2KE 1AEDA 2X9XA 4HTEA 5JDHA 2W63A 4AXPA 1BEQA 5KQKA 4IHJE 4UF0A 5JR9A 4X20E 1CMQA 2RBZX 4JMZA 5ALAA 1Z0PA 3RIVA 2PJQA 2YINA 1GWOA 2Y6BA 1NWMX 2EHOA 1Z53A 1C8IA 2NTXA 4JPLA 2GHDX 3WA8A 3KV5A 2ATJA 5L02A 4MFRA 4Z8XA 5JQGE 3ZMSB 1KXMA 1H5MA 2RBYX 5IYZE 5LCYA 1AEUA 1YW0A 1DCCA 2RBWX 1D1AA 1U74A 5SYIA 5JR9C 4BLNA 3FMUA 3D0TA 1U4QA 4GK5E 3SWHA 1ARVA 5SW4A 3VKHA 2EUSA 3Q9DA 1D1CA 2JRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHC X;  4CZN A;  4NVI B;  2V23 A;  6CCP A;  1H5J A;  2RBV X;  1GZB A;  1QO4 A;  4BM2 A;  1AEB A;  3R98 A;  5SXT A;  1SOG A;  5CCP A;  4BLK A;  5AOG A;  5JHX A;  4A6Z A;  3HDL A;  4JMT A;  1U2K A;  1AET A;  4JN0 A;  5SXW A;  3FM4 A;  5KQH A;  5CIG A;  1JDR A;  4CZP A;  1LYK A;  1DSG A;  4NVF A;  4NVM B;  1YZR A;  2XIH A;  4NVD A;  3WNU A;  3M29 A;  1CCL A;  1B80 A;  1YYD A;  5CIB A;  4JMB A;  2Y6A A;  2V2E A;  1LLP A;  3FM6 A;  1H58 A;  1HSR A;  1H5F A;  5SYV A;  1CMU A;  1CMT A;  2XJ6 A;  5SYW A;  1ATJ A;  3VLL A;  2AS2 A;  5SXX A;  1SCH A;  5ABN A;  2XIF A;  4JMV A;  4CUO A;  2BCN A;  1ARP A;  4CCP A;  5SX2 A;  4NVH B;  1BEP A;  2XIL A;  2CYP A;  3VLI A;  4BM1 A;  6ATJ A;  1BEJ A;  2E3B A;  2VCF X;  7CCP A;  4JMS A;  2RBX X;  1BGP A;  3M2C A;  2XJ8 A;  4A5G A;  5SYK A;  2GHK X;  1ARX A;  2EUR A;  5JQR A;  2EUO A;  4OQ7 A;  5JHZ A;  5KQ3 A;  2B0Z A;  4FDQ A;  1ARU A;  3ZCY A;  2XJ5 A;  2EUP A;  1AEH A;  1GWU A;  5SXQ A;  4CZR A;  1H5H A;  4JM5 A;  5FNE A;  1MK8 A;  1YZP A;  1AC8 A;  1LYC A;  2W23 A;  1FHF A;  3M27 A;  1AEO A;  1MN1 A;  4G05 A;  2CCA A;  1OAG A;  5SYJ A;  1PA2 A;  4XVA A;  7ATJ A;  1MN2 A;  3M2E A;  5CJH A;  5L86 A;  1CCI A;  1QGJ A;  3Q3U A;  5CIC A;  1V0H X;  2EUT A;  3FM1 A;  4A71 A;  3M28 A;  5SXS A;  2YCG A;  1QPA A;  4XV7 A;  1AEE A;  4XV5 A;  4XV6 A;  1H5L A;  1GX2 A;  4JM9 A;  5KQ2 A;  1BVA A;  4JMW A;  3M2G A;  2N18 A;  1CMP A;  5KSF A;  1H5G A;  1H5E A;  1BEK A;  2Y5A A;  4BLY A;  2CCP A;  2E3A A;  2GHH X;  5AL9 A;  5L05 A;  1AA4 A;  3FKG A;  4GED A;  3E2N A;  2VCS A;  5SX6 A;  4XV4 A;  2PCB A;  2EUN A;  1B85 A;  5SX0 B;  1ARY A;  5JHY A;  1CPG A;  2GHE X;  3EXB A;  4C51 A;  4BM0 A;  5SYL A;  1MKQ A;  4JPU A;  5SXR A;  2IA8 A;  1STQ A;  1CCA A;  4A78 A;  1CCC A;  2VKA A;  2AS3 A;  4XV8 A;  2X07 A;  1IYN A;  1SJ2 A;  3VLK A;  1YYG A;  2GB8 A;  1GW2 A;  2BOQ A;  5SW6 A;  4JPT A;  1SBM A;  2VNX X;  1AEM A;  4CZO A;  5KQI A;  1EBE A;  1HCH A;  2AS4 A;  1DJ5 A;  1CCG A;  5FNB A;  1APX A;  2XI6 A;  3RIW A;  5D6M A;  1LY9 A;  2B11 A;  4BM3 A;  4BLZ A;  3VLM A;  1CCE A;  2YLJ A;  2WD4 A;  3ZCH A;  1MNP A;  5KQ6 A;  1ZBZ A;  4NVE A;  5CIE A;  2CCD A;  4ATJ A;  1U2L A;  1H5D A;  5ABQ A;  3M2B A;  5SX0 A;  2RC0 X;  3RRW A;  3M2A A;  2JTI A;  5SYY A;  4PAE A;  2E39 A;  2AS1 A;  1AES A;  1DSP A;  4USC A;  5SYH A;  2AS6 A;  2RC1 X;  5JPR A;  2RC2 X;  3CCP A;  3M23 A;  1H5I A;  1W4Y A;  1H57 A;  2B12 A;  3M2I A;  5EJX A;  5SX3 A;  1ML2 A;  1CPE A;  4NVO B;  1ARW A;  3M26 A;  3UT2 A;  3VLH A;  1SDQ A;  5CID A;  4FCS A;  3CCX A;  2X08 A;  3X16 A;  1CCP A;  1B82 A;  4JM8 A;  4A7M A;  1U2J A;  3UW8 A;  4JQK A;  4CZQ A;  1BJ9 A;  1H5A A;  5AMM A;  2RBU X;  3E2O A;  1AEG A;  1H3J A;  5ABO A;  4P4Q A;  4CVJ A;  3VLJ A;  5SW5 A;  1H55 A;  3ATJ A;  1ZBY A;  5CIF A;  4CVI A;  4JQJ A;  4FEF A;  1CCB A;  1CPD A;  1U75 A;  1UB2 A;  2CL4 X;  4JQM A;  1DJ1 A;  2ANZ A;  1A2G A;  1BEM A;  4NVG B;  1AC4 A;  4CCX A;  4FCN A;  1DSO A;  4JB4 A;  2VO2 X;  3FJW A;  2VNZ X;  3M2H A;  4NVC A;  2ICV A;  1AEQ A;  1GZA A;  1CPF A;  5SX7 A;  1GWT A;  4NVK B;  1H5K A;  4JM6 A;  1DSE A;  1S73 A;  4NVN B;  2EUQ A;  5SYU A;  3R99 A;  1CYF A;  2RBT X;  2AQD A;  1CCK A;  1H5C A;  1KRJ A;  1S6V A;  3M2D A;  2EUU A;  4JMA A;  1MKR A;  2B10 A;  1AEF A;  1KOK A;  1CCJ A;  4BLL A;  5KQ0 A;  2PCC A;  1A2F A;  2VCN A;  5SX1 A;  1LGA A;  4NVJ B;  5CIH A;  1RYC A;  3M8M A;  3M2F A;  5SYX A;  3ZCG A;  1KZM A;  4JQN A;  4BLX A;  1DS4 A;  4NVL A;  1JCI A;  2GGN X;  5KSK A;  1AEV A;  3M5Q A;  1AEN A;  4BM4 A;  1LY8 A;  1AEJ A;  3WXO A;  4NFG A;  2CEP A;  1AEK A;  1KXN A;  1OAF A;  3M25 A;  1BES A;  1CK6 A;  4NVB A;  1W4W A;  4C50 A;  1ITK A;  5EJT A;  4NVA A;  1AED A;  1BEQ A;  5KQK A;  1CMQ A;  2RBZ X;  4JMZ A;  5ALA A;  3RIV A;  1GWO A;  2Y6B A;  1Z53 A;  1C8I A;  4JPL A;  2GHD X;  2ATJ A;  5L02 A;  1KXM A;  1H5M A;  2RBY X;  1AEU A;  1DCC A;  2RBW X;  1U74 A;  5SYI A;  4BLN A;  3FMU A;  1ARV A;  5SW4 A;  2EUS A; 
#chains in the Genus database with same CATH topology
 3ONJ A;  4UV9 B;  5JTG A;  2GHC X;  3PV0 F;  4IE6 A;  4WYV A;  5TAO A;  3TLV A;  5SXT A;  3VR8 A;  4YSZ A;  4HFI A;  3RYI E;  1WR6 A;  2N2N A;  1VOM A;  2UXD T;  4JN0 A;  2N1G A;  3FM4 A;  5LG4 A;  4NVM B;  2I59 A;  4NVD A;  3M65 A;  1B80 A;  2WBL A;  1LLP A;  5C8Y E;  3RH3 A;  4B6X A;  4AQY T;  4X1Y E;  3I0Q A;  4ZI7 E;  3WAJ A;  4AKH A;  2CXD A;  2XJ6 A;  3VR9 A;  5BR8 T;  2LSK A;  4EZ4 A;  5SXX A;  2X9H A;  2W66 A;  4NIQ A;  5ABN A;  4AI6 A;  2BS4 A;  5CFB A;  5LHI B;  2EHO B;  4CUO A;  5SX2 A;  1ZKE A;  5A1L A;  4MBQ A;  4B3M T;  2XIL A;  4BM1 A;  1SHZ C;  1BEJ A;  2E3B A;  3UFG A;  4WNK A;  7CCP A;  3ZC1 A;  3IEE A;  4DR6 T;  5JVD E;  1UK5 A;  2IHR 1;  2RBX X;  1BGP A;  4A5G A;  5SYK A;  2KT9 A;  2YK0 A;  3ETV A;  2CLY B;  1ARX A;  5JQR A;  4GKJ T;  4UEL A;  1IZN B;  4EED A;  3GWH A;  2YKS A;  3E22 E;  4H63 H;  5FMN A;  5KQ3 A;  3MKD A;  4EYU A;  3EDU A;  1U5P A;  4FDQ A;  5LBQ B;  4CI3 B;  2PG8 A;  1H7C A;  4PNI A;  4O4H E;  4CZR A;  4LML A;  3C98 B;  4QH1 A;  2ZCA A;  1MK8 A;  4O4J E;  5AQI B;  2N9D A;  4LF9 T;  5FYM A;  3SFE A;  3IF8 B;  2W23 A;  2YEV C;  4P0A A;  1ZV4 X;  3M27 A;  5BMV E;  2CCA A;  3N9M A;  2VAS A;  1FJG T;  4NUU A;  4YTP A;  1PA2 A;  2XM1 A;  1MN2 A;  5CJH A;  2LHN A;  1CCI A;  3CWZ B;  5FY0 A;  2LSG A;  2BZB A;  3QB5 A;  2C5I T;  3CPZ A;  3O1I A;  4XV7 A;  4EEB A;  4XV5 A;  3LJC A;  3LFM A;  1GX2 A;  2Y48 B;  3M2G A;  2DNX A;  2N18 A;  4P0B A;  1CMP A;  1H5G A;  1BEK A;  4NUV A;  4BLY A;  3RIF A;  4ISS A;  1AA4 A;  3FKG A;  4GED A;  3CX8 B;  3J9X 1;  2VCS A;  4XV4 A;  2PCB A;  4OFZ A;  4GYS A;  5LGN B;  2Z6E A;  2V8S V;  2V7M A;  3UU3 A;  4JPU A;  2HHH T;  2IA8 A;  4XZC A;  5H9E B;  1XWM A;  1CCA A;  2BBJ A;  3C4Z A;  1HNX T;  2VKA A;  2NP9 A;  2XAH B;  4XV8 A;  3EAM A;  3LSV A;  1D0X A;  4BAY B;  3VLK A;  5JRC B;  1YYG A;  3W15 B;  2CMR A;  4DR4 T;  4KI0 F;  2Q9Q A;  3Q2M A;  4I43 B;  1YQ3 A;  2IC9 A;  5KQI A;  1HCH A;  4B3T T;  2AS4 A;  2K24 A;  4JYA T;  1CCG A;  2XI6 A;  2BVL A;  5D6M A;  4IE7 A;  2NWB A;  3FZL B;  4ILB A;  1BR4 A;  1CCE A;  2YLJ A;  5H9F B;  1MNP A;  3LK2 B;  2PFV A;  1OED B;  3RX6 A;  4N78 D;  2WCA A;  2J1D G;  4ATJ A;  2JMK A;  3DP7 A;  1U2L A;  2E2A A;  2G0U A;  2V6X A;  4EYY R;  5LGT B;  2LHR A;  2YN6 A;  5FNV E;  1H5D A;  4PFP A;  4JI2 T;  5ABQ A;  3P50 A;  2J47 A;  2UUA T;  3M2A A;  4CI1 B;  4LF5 T;  4U7I A;  1IJ6 A;  4PAE A;  4JUY A;  3ZN0 B;  2H88 A;  1AES A;  4K0U A;  4J2C A;  3QC9 A;  4X1K E;  2H89 A;  5HXS A;  2JIW A;  3ETU A;  3CCP A;  2XQY A;  1ZHC A;  2XHE B;  5DQW A;  5HXE A;  3FBZ A;  3ZJ2 A;  1VRB A;  3P7I A;  4QX8 B;  3VU7 H;  3LK4 2;  3F57 A;  1ML2 A;  3AAE B;  3MK7 C;  4TN7 B;  3RYH E;  1KK7 A;  3GA8 A;  2MBG A;  3PJA J;  5HCJ A;  1ARW A;  2LSY A;  5EK3 A;  3MA9 A;  3M26 A;  3UT2 A;  5J2T E;  2WZH A;  5L4E A;  3CCX A;  2X08 A;  4OX9 T;  1B82 A;  2W61 A;  4ZHQ E;  4JM8 A;  4A7M A;  2XJ7 A;  2WM9 A;  4JI6 T;  1AEG A;  4EOZ B;  3R6N A;  3VLJ A;  5HXC A;  3RRC A;  5SW5 A;  1HCI A;  1QLB A;  1ZBY A;  5FXX A;  4HFB A;  1IBM T;  3EI0 A;  4DBR A;  4KBM B;  4G63 A;  5AQV B;  1CPD A;  1HFA A;  3Q5W A;  1JNR A;  1UB2 A;  3I1A A;  4B3R T;  2CRB A;  1BEM A;  2I6H A;  2HH7 A;  2CM0 A;  4H7A A;  4I4T E;  4FCN A;  1T72 A;  3Q5D A;  3C51 A;  1DU2 A;  3QOF A;  3ANW B;  4KHP T;  5L3E B;  4EIW A;  2NW7 A;  1N32 T;  1H5K A;  2LKH A;  4X66 T;  3SRZ A;  3NBX X;  2EUQ A;  5SYU A;  4LF6 T;  4X65 T;  4EXT A;  5AQS B;  1CCK A;  5L47 A;  2XAJ B;  5J0Z A;  3ZT7 A;  3M2D A;  2VL0 A;  2EUU A;  2NW8 A;  4JMA A;  4HWC A;  2W2U A;  4H9O C;  1KOK A;  1CUN A;  2WDR A;  5FKY A;  3MZK B;  4BLL A;  2WDV A;  2PCC A;  3CQC B;  3RI5 A;  4ERR A;  3N2O A;  2IIU A;  3AE9 A;  1T98 A;  4NVJ B;  3FXE B;  1RYC A;  3M2F A;  3L3P A;  1S94 A;  4QWN B;  4BJM A;  3O1J A;  4BLX A;  1DS4 A;  4X5T A;  4CQI A;  5FXW A;  4JEU B;  5KSK A;  3M5Q A;  5AQF B;  4BM4 A;  4NFG A;  3ZST A;  5AQP B;  1KXN A;  1N34 T;  4U33 A;  4CN4 A;  4ILC A;  1MMA A;  3QB5 K;  3OBV E;  4BA9 A;  5LXT E;  3N2K E;  4IHJ E;  5ALA A;  3P4S A;  2Y6B A;  2NTX A;  1Z53 A;  4A98 A;  1H5M A;  5LCY A;  1DCC A;  5SYI A;  5JR9 C;  3D0T A;  3SWH A;  1ARV A;  3VKH A;  2EUS A;  2EHO C;  4NVI B;  2V23 A;  2W0G A;  2OV9 A;  4XBF B;  1H5J A;  4L5G A;  1WRD A;  4EZH A;  1SOG A;  2UXN B;  3AE8 A;  2CHN A;  1I6Z A;  4G2A A;  3KV4 A;  4GKK T;  4P1N A;  5L2L A;  2XUE A;  2CLY C;  4JMT A;  3R84 B;  1AET A;  5SXW A;  1JDR A;  2XIH A;  3ZYL A;  3WNU A;  4F6R C;  3M29 A;  3NRX A;  4UR9 A;  5CIB A;  4ZI2 D;  4JMB A;  2VK9 A;  2CBI A;  4MLK A;  1H5F A;  5CB4 E;  5ABF A;  4O2B E;  4PAG A;  4KX6 A;  2V7K A;  5M4Y A;  5SYW A;  2H7V C;  1Y01 A;  3LDQ B;  2AS2 A;  2LJL A;  2K48 A;  1LKX A;  3AA1 B;  1ARP A;  4NVH B;  4H9P C;  3N9Q A;  2CYP A;  2VCF X;  2IDO B;  2WB5 A;  3TLT A;  5LP6 E;  4DUZ T;  2QRX A;  3RKO A;  1ZOY A;  4I55 E;  2XQ8 A;  4JV5 T;  2GHK X;  3B5M A;  1YXR A;  2J4G A;  4CXY A;  4ZZC A;  3CQG B;  1X9B A;  3M3Z B;  3ZCY A;  2V7L A;  2XJ5 A;  2WU2 A;  5IHY A;  5JDF A;  2VWA A;  5AQM B;  1H5H A;  4DBQ A;  3LG7 A;  2LOP A;  1YZP A;  1AC8 A;  5FXV A;  3FZH B;  2VVN A;  2EHO D;  5LNK A;  3PTR B;  1FHF A;  3ZN1 B;  3S4U A;  4DMV A;  1G8X A;  5AQG B;  2IC6 A;  4A56 A;  2FJB A;  4C91 A;  3AE7 A;  2JQQ A;  2JQH A;  5LMU T;  4I0U A;  3FM1 A;  4HWF A;  3HA4 A;  3NVO A;  1KFY A;  2L8K A;  4XV6 A;  2WMO A;  4JM9 A;  5KQ2 A;  1OED E;  2D0T A;  4OYK A;  1MIV A;  5FL0 A;  2MOZ A;  5KSF A;  4OK0 A;  2Y5A A;  2WQY A;  2CCP A;  5HWX A;  5AL9 A;  4O4L E;  2XAQ B;  3N5L A;  3E2N A;  3PU8 A;  5SX6 A;  1VCS A;  1B85 A;  5AQU B;  1ARY A;  1VCT A;  2P9B A;  2GHE X;  1B7T A;  2AXD S;  2XQ7 A;  1HTJ F;  3PUS A;  3K3N A;  5LA6 E;  2KIN B;  2BKO A;  3AEF A;  3NRY A;  3UUL A;  3VRB A;  4TNW A;  2QGS A;  3DJB A;  5E0O A;  1IYN A;  1SJ2 A;  2HPL A;  3TLS A;  4PFO A;  1SE7 A;  4HFD A;  1HR0 T;  1HG2 A;  5SW6 A;  3AB3 B;  1AEM A;  4CZO A;  3RC8 A;  4TNV A;  3GMI A;  2HN1 A;  3RIW A;  4YTN A;  4CXX A;  3HKE E;  2LKG A;  2K5B B;  4HE8 A;  2V26 A;  3MJX A;  4DR5 T;  2BBH A;  1ABV A;  1WFD A;  5CIE A;  3M2B A;  5SX0 A;  3PUR A;  2RC0 X;  3RRW A;  2C5K T;  2JTI A;  3AE1 A;  3RKG A;  2KXP B;  2AS1 A;  2V5D A;  2V7J A;  4U7U B;  5AQN B;  2WZI A;  3A5X A;  2ACX A;  2BDE A;  2DHR A;  2VVS A;  4JI3 T;  4DV4 T;  1G73 A;  4JI1 T;  1W4Y A;  2B12 A;  3M2I A;  2D9D A;  5CD4 J;  3FXD B;  4ZZB A;  1OWA A;  3RF1 A;  1HS7 A;  1W9R A;  2XSA A;  5CA1 E;  2C5J A;  3TLW A;  2CBJ A;  2V7I A;  1IJ5 A;  1SDQ A;  4JZA A;  5EK4 A;  5CID A;  2FJE A;  3PUV F;  1CCP A;  2V6Y A;  1U2J A;  1XDO A;  1XDP A;  2LM2 A;  2XSB A;  1BJ9 A;  5AMM A;  3ZC0 A;  2YDQ A;  1OXZ A;  5ABO A;  4CVJ A;  4WBO A;  3F31 A;  5DQV A;  3LBX A;  3ATJ A;  4QH5 A;  3UU6 A;  4WBN E;  3FZF B;  2JMH A;  4U2Z A;  1U75 A;  5FVK A;  2W00 A;  3FBL A;  1DJ1 A;  4DR1 T;  1EZ3 A;  3T1H T;  1A2G A;  4NVG B;  2MPK A;  2ZM0 A;  5EZY E;  4HFE A;  1BR1 A;  1E7P A;  2E9X A;  2VO2 X;  3M2H A;  4IST A;  3GN5 B;  3AEE A;  1GZA A;  5SX7 A;  5AQH B;  1GWT A;  5CA0 E;  3MXZ A;  4IDP A;  2WAU A;  2CXL A;  1S73 A;  3R99 A;  1W0B A;  4YFS A;  2RBT X;  3RYC E;  2LEH A;  2AQD A;  4DV7 T;  3UU8 A;  4DMW A;  3ZMT B;  3PUA A;  2BO5 A;  3AE3 A;  3X1D A;  1AEF A;  4PJM A;  4DVD A;  4UV8 B;  4ZS2 A;  4YHH T;  4LF8 T;  4EV6 A;  1FIO A;  5L3B B;  2VCN A;  2KWH A;  4UXN B;  3P4P A;  5CIH A;  3M8M A;  1R8I A;  1KZM A;  2WWV A;  5LHG B;  1KEY A;  4QXC B;  4NVL A;  3RGL A;  2GGN X;  4AQF A;  1AEV A;  4EAH A;  3ZMV B;  4DR2 T;  2X51 A;  1LY8 A;  1QSD A;  4YSX A;  2CEP A;  1AEK A;  1V9D A;  4X62 T;  4NXN T;  3TLU A;  1I94 T;  1W4W A;  4OYJ A;  3HI2 A;  4H9N C;  3T1Y T;  2YDR A;  5EJT A;  2X9X A;  4COF A;  2W63 A;  5JDH A;  2UXB T;  5JR9 A;  2RBZ X;  2PJQ A;  3KV5 A;  2X0Y A;  1NWM X;  2EHO A;  4Z8X A;  4JPL A;  3WA8 A;  2UUB T;  2ATJ A;  5L02 A;  3AXJ A;  3VRA A;  1YW0 A;  2XQ5 A;  1D1A A;  4BLN A;  1JNZ A;  3P4Q A;  3EHZ A;  3UUB A;  5AQR B;  2JRK A;  1LRZ A;  3LK3 B;  3BQK A;  3CK6 A;  2YU1 A;  5F3J A;  4HGA A;  1LVK A;  4IE5 A;  1WR0 A;  5JDG A;  2RBV X;  1BR2 A;  1QO4 A;  3ABV A;  1N33 T;  1AEB A;  4IDN A;  5CCP A;  3KDS E;  4H9Q C;  2K9A A;  4LMJ A;  4QKN A;  3SS1 A;  4V1A v;  4A6Z A;  4H9S E;  3AA6 B;  2V5C A;  2A3D A;  3HDL A;  5FY7 A;  1U2K A;  3KIN B;  1AJ3 A;  5KQH A;  5CIG A;  1KNZ A;  4LFC T;  4CZP A;  1LYK A;  3K3Q C;  4NVF A;  2NR4 A;  5J2U E;  4ZI3 C;  4IGU A;  4U72 A;  1WLX A;  1CCL A;  1YYD A;  5AQQ B;  3K1S A;  5CGM A;  4ZS3 A;  4DID B;  5GON E;  2Y6A A;  1MNE A;  4Z91 A;  3ZMU B;  2BG9 B;  4YY3 T;  4CXW A;  1CMU A;  2BKP A;  5JDL A;  1CMT A;  1Z8U A;  2B76 A;  3HKB E;  1SCH A;  4UF0 B;  4ZI2 C;  2XIF A;  4JMV A;  3JC6 D;  1NEK A;  3ZJ1 A;  2BCN A;  4CCP A;  1BEP A;  2A72 A;  5ADX L;  4JI0 T;  3M2C A;  4LF4 T;  2EUR A;  5JDN A;  4U2Y A;  2X0L B;  5JHZ A;  3PUZ F;  2B0Z A;  4BJN A;  2CE7 A;  3AED A;  2RP4 A;  1NEN A;  1ARU A;  5IUX A;  2XAS B;  2JPF A;  4TWH A;  2ACZ A;  1GWU A;  1UX4 A;  2VKH A;  5DJQ C;  1XMO T;  3PUX F;  5FNE A;  3UU5 A;  2OLT A;  2XQ6 A;  2LSJ A;  3O1H A;  4CN6 A;  3UFE A;  2CHO A;  2I0M A;  3ESL A;  2LRL A;  5F5W A;  4DV2 T;  1UX5 A;  2YDS A;  5SYJ A;  1MIY A;  4O8S A;  7ATJ A;  3JAF A;  2XQ9 A;  2ZM6 T;  3NZQ A;  3M2E A;  5L86 A;  4IRE A;  3CML A;  1J5W A;  1J1J A;  1YKH B;  2EUT A;  5HEU A;  5ABG A;  4A71 A;  3M28 A;  1UCU A;  5SXS A;  1QPA A;  1AEE A;  3V5S A;  4ZI3 D;  2PTF A;  1H5L A;  2DLR A;  1T8B A;  5DAB A;  5AFU L;  5LJN A;  1BVA A;  4JMW A;  4TV9 E;  1XMQ T;  4TV8 E;  3FZM B;  2WU5 A;  2NOX A;  1WCR A;  3KBT A;  3N9P A;  1XNR T;  4PJL A;  4E7Z A;  4F8H A;  5SX0 B;  5HEH A;  5JHY A;  3SFD A;  4Q25 A;  5SYL A;  3IBP A;  3NZP A;  2VB6 A;  5SXR A;  3PUQ A;  2X9W A;  5L4H A;  3OYX A;  5F8P A;  4MAL A;  3QK6 A;  3O9X A;  3X1L F;  5AQL B;  2GB8 A;  4HWD A;  2BOQ A;  2W62 A;  2W67 A;  1L0V A;  2VNX X;  1EBE A;  4JI7 T;  4L0R A;  3KV9 A;  4JI5 T;  4DND A;  3UUN A;  4KUM B;  2WY2 A;  1APX A;  2VQE T;  4P09 A;  4U31 A;  4HFV A;  3KFW X;  2B11 A;  3AA0 B;  2QVA A;  5HCM A;  4MHC A;  3ZCH A;  2V6Y B;  3AE2 A;  2SPC A;  5KQ6 A;  3AVR A;  5LBM A;  1ZBZ A;  4NVE A;  4GYR A;  4KMC A;  3SOL A;  4TWD A;  3C4W A;  3Q5E A;  1D1B A;  2M6I A;  5SYY A;  2E39 A;  4DV0 T;  4AKR B;  1DSP A;  3ZLI A;  2XTL A;  5SYH A;  2RA1 A;  3DTO A;  3F2E A;  5JPR A;  3ZT5 A;  2RC2 X;  2OEB A;  4ZXL A;  1XNQ T;  3NWI A;  5KMG P;  3L09 A;  4X1I E;  2E9X B;  2NTY A;  2L3L A;  1UUR A;  3QNU A;  1CPE A;  2WSS S;  4QHO A;  3B57 A;  2Q9Q B;  4C90 A;  3AVS A;  3VLH A;  2PBI A;  1HG5 A;  2FBW A;  2YU2 A;  4FCS A;  3A8Y C;  4TUY E;  3UQ4 A;  2OA5 A;  2JQ9 A;  3UW8 A;  1KNP A;  2RBU X;  3E2O A;  5H6Q B;  2XM2 A;  4A97 A;  2IAK A;  1H3J A;  4P4Q A;  4KHZ F;  3JCF A;  2BS3 A;  1E1H B;  2IW5 B;  2VL8 A;  5CIF A;  3ONX A;  4CVI A;  1OED C;  2VQF T;  3CQX C;  2MTQ A;  4HFH A;  1CCB A;  3RQW A;  5L3F B;  4QYZ B;  1SUM B;  4GOU A;  2M6B A;  4X64 T;  4JQM A;  4AKG A;  1FMV A;  2CXF A;  5ABE A;  3QUJ A;  4O4I E;  3VHL A;  5C2T A;  4DR3 T;  4M1P A;  2KND A;  2XQA A;  4IL9 A;  4CCX A;  2UXC T;  1DSO A;  5HEO A;  4JB4 A;  2LE8 A;  2LSI A;  2VNZ X;  2X67 A;  2VUR A;  2LOS A;  2ICV A;  3OVU A;  3I9W A;  3ZKR A;  1SA0 E;  4ILA A;  2KWI B;  4NVK B;  2E5V A;  2W4X A;  3CIR A;  2FJD A;  1CYF A;  2VKO A;  3A7M A;  5HEG A;  3JAE A;  3ONL C;  4DO0 A;  4NPP A;  1O3X A;  2DCF A;  4NXM T;  5JR9 B;  2LT3 A;  4AQG A;  2X0H A;  5L3G B;  4YHJ A;  4PK6 A;  4DV6 T;  3KV6 A;  3FHN A;  3AXJ B;  3PDY A;  3CVR A;  2K3W A;  3EUH A;  4AIU A;  1N36 T;  3V5U A;  2KSR A;  4PW8 A;  4PJJ A;  2M67 A;  5ETW A;  1HNW T;  5SYX A;  2VKJ A;  3I0O A;  3ZEF B;  3ZCG A;  5LHH B;  3UU4 A;  4JQN A;  3WAK A;  1Y64 B;  3BK9 A;  2H3R A;  1JCI A;  2CCQ A;  4XAX B;  4WZX A;  2JJ9 A;  2ODU A;  4UVA B;  1AEJ A;  5JDM A;  3WXO A;  2E5L T;  3RLF F;  3UUM A;  2RPA A;  2Y6X A;  1MND A;  1OAF A;  4U74 A;  1BES A;  4UVC B;  2GK9 A;  4NVB A;  4L9I A;  2BS2 A;  3JAD A;  2BG9 E;  3TKL B;  3RIU C;  5FP3 A;  3PUG A;  1ITK A;  4FJO A;  4HTE A;  4AXP A;  1E2A A;  4K0K T;  4X20 E;  2BG9 C;  3RIV A;  1GWO A;  1C8I A;  1XZY A;  2GHD X;  4MFR A;  1KXM A;  1HNZ T;  2UUC T;  3PJA A;  2RBW X;  3FMU A;  2DL1 A;  4ZOL E;  4AKI A;  1D1C A;  2DI4 A;  4CZN A;  3BQL A;  6CCP A;  2KZ7 B;  2CEA A;  1W0A A;  4DR7 T;  2ZM2 A;  1GZB A;  4BM2 A;  3R98 A;  4BLK A;  5AOG A;  2C0S A;  5JHX A;  3AAI A;  5C3J A;  3H3M A;  3H3A A;  3L8R A;  5LJM A;  1WYC A;  3ZSS A;  4QXH B;  2V1D B;  1YQ4 A;  1DSG A;  4GK0 E;  5KX5 E;  1YZR A;  2FUP A;  3C50 A;  1MMN A;  4H79 A;  5FXZ A;  2V2E A;  4QH4 A;  1HF8 A;  3FM6 A;  1H58 A;  1HSR A;  5SYV A;  4UIG A;  5H6R B;  3N9N A;  4ZEY A;  3HKC E;  4CZZ B;  2XAF B;  3EDV A;  1ATJ A;  2XY8 B;  3VLL A;  3ZCJ A;  3N9O A;  5EK2 A;  2FJA A;  2R6G F;  1X79 A;  3EAB A;  2ODV A;  1FEW A;  3FB2 A;  1T7S A;  2QYW A;  3VLI A;  6ATJ A;  1S35 A;  3K3O A;  5AQO B;  1MMG A;  4JMS A;  3AEC A;  2BKN A;  4HFC A;  3AAA B;  3RYF E;  2XJ8 A;  3PE0 A;  4WW0 A;  4EB6 E;  3OJA A;  2XZE A;  1ZP0 A;  3JC6 C;  5HXH A;  2EUO A;  4OQ7 A;  4ADZ A;  5HXR A;  1ZEE A;  2H7O A;  5LGU B;  3UQ7 A;  2EUP A;  1AEH A;  3J7Y q;  1M7K A;  3O4X E;  3UT5 E;  5SXQ A;  4JM5 A;  3CX7 B;  1J5E T;  4IE4 A;  2A2F X;  1IAP A;  2DWG A;  3OPC A;  1YKE B;  3KBU A;  1LYC A;  4YLH A;  3I9Y A;  3IHR A;  3P4W A;  5CJ5 A;  4QXB B;  1AEO A;  4YXD A;  4GIW A;  5ABF B;  2D5U A;  1BR0 A;  2KLQ A;  1MN1 A;  4G05 A;  1OAG A;  3VKG A;  2B1E A;  2UU9 T;  4YT0 A;  4XVA A;  4FI5 A;  2BVM A;  3CKD A;  5JDQ A;  1QGJ A;  3Q3U A;  2X68 A;  5CIC A;  1V0H X;  4B3S T;  4OHF A;  4IT4 A;  2NW9 A;  3E08 A;  2ES0 A;  4ILU A;  2YCG A;  5L3D B;  2CA5 A;  3ZPO A;  3U3I A;  4JEH B;  1WYB A;  3AA7 B;  2JQK A;  4TZ4 C;  3RPU A;  2L9Q A;  1H5E A;  4TWF A;  5LYJ E;  2E3A A;  2GHH X;  2J62 A;  5L05 A;  3AEB A;  3UTK A;  2EUN A;  3HR0 A;  4CI2 B;  3OTO T;  1CPG A;  3OKQ A;  3EXB A;  4C51 A;  2ZOP A;  4BM0 A;  1UGO A;  3B13 A;  1MKQ A;  1MIW A;  1STQ A;  4A78 A;  1CCC A;  1FMW A;  2AS3 A;  3L39 A;  2X07 A;  2HN2 A;  4HN9 A;  2XPK A;  1GW2 A;  4UVB B;  3UUX B;  4JPT A;  1SBM A;  2E9X C;  3IA3 A;  5J1G A;  3AE5 A;  4PK5 A;  2MYS A;  3BQI A;  2WSS V;  1DJ5 A;  5FNB A;  4H63 V;  1W09 A;  2Q9Q C;  1LY9 A;  1QUU A;  4BM3 A;  4Z90 A;  4BLZ A;  3VLM A;  5IWA T;  2WD4 A;  2WWU A;  3PUY F;  2XQ3 A;  4DUY T;  2VKD A;  3E0Z A;  2CCD A;  1LVF A;  2IML A;  5HEJ A;  5JRE A;  3P8C D;  3ZYM A;  4IDQ A;  2D2S A;  1KNR A;  2IUB A;  2X66 A;  5HYA A;  2Y8D A;  3OYZ A;  4LF7 T;  4USC A;  4ASK A;  1HX1 B;  2WMN A;  2KMF A;  2AS6 A;  3RQU A;  2RC1 X;  4GKF A;  2E8I A;  3N2G E;  3Q5X A;  3KVB A;  5AQJ B;  3GN5 A;  4IDO A;  3M23 A;  3G06 A;  3FZK B;  1H5I A;  3ZT6 A;  5HAX A;  4LFA T;  3AEA A;  1H57 A;  5JRC A;  4AQF C;  5EJX A;  1D0Z A;  3ZYK A;  5SX3 A;  3EVY A;  1NAF A;  4CN1 A;  5AQT B;  1M62 A;  3MAC A;  4JI8 T;  3HKD E;  3ZMZ B;  2CPT A;  4YTM A;  2UXX B;  4NVO B;  1IBL T;  4LMK A;  4KP3 C;  4EGW A;  3PU3 A;  2ZMA A;  1HX8 A;  3X16 A;  2X9Y A;  3N9L A;  3CX6 B;  1OED A;  4JQK A;  4CZQ A;  5KXJ A;  5LG3 A;  4DV5 T;  1H5A A;  2MAW A;  2JMX A;  2HPJ A;  4HWI B;  4IE0 A;  1H55 A;  2LRK A;  1GQE A;  3WI3 A;  4JQJ A;  4FEF A;  2QA7 A;  4HEA A;  2XAG B;  4LFB T;  4AIS A;  2CL4 X;  2LM9 A;  1UUS A;  5FY1 A;  2ANZ A;  5FVL A;  2E9X D;  2D0U A;  1AC4 A;  2CWY A;  1US7 B;  2XQ4 A;  2ZLY A;  3T8O A;  3FJW A;  4NVC A;  1AEQ A;  4U3C A;  2Q9Q D;  5L3C B;  4IDZ A;  1CPF A;  4HKA A;  4I50 E;  2WDQ A;  4JM6 A;  1DSE A;  5HWY A;  4NVN B;  3PUW F;  3P4R A;  4IL4 A;  1CHU A;  4TX5 A;  4JI4 T;  4AKL A;  3AE4 A;  1H5C A;  3AE6 A;  1KRJ A;  1S6V A;  3HL6 A;  2A7U B;  4PK4 A;  4A5X A;  4PJN A;  4JBW F;  3U78 A;  1MKR A;  2B10 A;  5LMN T;  5LB7 B;  4UEM A;  4E7S A;  1CCJ A;  5KQ0 A;  2DWK A;  4ANJ A;  2WS3 A;  1A2F A;  3C4X A;  4IIJ E;  3K8P C;  3LBX B;  5SX1 A;  1LGA A;  4H9R C;  4DV3 T;  2CWO A;  3H37 A;  5LOV E;  5AQK B;  3NKZ A;  2ZM8 A;  1IBK T;  2A9U A;  5KDM C;  4YJ2 E;  5ABH A;  1YD8 G;  1AEN A;  4QX7 B;  3KVA A;  1KF6 A;  3RIU A;  2LLY A;  3ANW A;  3AEG A;  4O2A E;  3M25 A;  3RC3 A;  4YSY A;  1CK6 A;  4JLE A;  3ZCI A;  2BG9 A;  1MMD A;  1D0Y A;  4C50 A;  4YJ3 E;  4U7Y A;  4NVA A;  1AED A;  1BEQ A;  3RHW A;  5FL1 A;  5KQK A;  4UF0 A;  1CMQ A;  4JMZ A;  1Z0P A;  4DV1 T;  3C64 A;  2YIN A;  4HWH A;  5JQG E;  2AE9 A;  3ZMS B;  2F4V T;  2WP9 A;  2RBY X;  5IYZ E;  3RIA A;  1AEU A;  2YOE A;  1U74 A;  4GK5 E;  1U4Q A;  5SW4 A;  3Q9D A;  5JH7 E; 
#chains in the Genus database with same CATH homology
 2DI4 A;  2EHO C;  1LRZ A;  3LK3 B;  4UV9 B;  2GHC X;  3BQK A;  4CZN A;  5F3J A;  2YU1 A;  3BQL A;  4NVI B;  4IE6 A;  2V23 A;  2W0G A;  6CCP A;  4HGA A;  1LVK A;  2KZ7 B;  2CEA A;  4IE5 A;  4XBF B;  1H5J A;  4L5G A;  2RBV X;  1GZB A;  1BR2 A;  1WRD A;  1QO4 A;  4BM2 A;  2ZM2 A;  5TAO A;  5JDG A;  1AEB A;  3R98 A;  5SXT A;  4EZH A;  1SOG A;  5CCP A;  3KDS E;  2K9A A;  4H9Q C;  4BLK A;  4QKN A;  5AOG A;  2C0S A;  2UXN B;  3SS1 A;  5JHX A;  3AAI A;  4V1A v;  4A6Z A;  4H9S E;  3AA6 B;  3H3A A;  4G2A A;  2A3D A;  3KV4 A;  3RYI E;  3HDL A;  5FY7 A;  1WR6 A;  2XUE A;  2CLY C;  2N2N A;  1VOM A;  5L2L A;  4JMT A;  1U2K A;  3R84 B;  1AET A;  4JN0 A;  5SXW A;  3KIN B;  2N1G A;  5LJM A;  1WYC A;  1AJ3 A;  3FM4 A;  4QXH B;  5KQH A;  5CIG A;  2V1D B;  1JDR A;  5LG4 A;  1KNZ A;  4CZP A;  1LYK A;  3K3Q C;  1DSG A;  4GK0 E;  5KX5 E;  4NVF A;  4NVM B;  1YZR A;  2XIH A;  3C50 A;  3ZYL A;  2I59 A;  5J2U E;  4ZI3 C;  4NVD A;  3WNU A;  1MMN A;  4IGU A;  3M29 A;  4F6R C;  3M65 A;  4H79 A;  4U72 A;  3NRX A;  5FXZ A;  1WLX A;  1CCL A;  1B80 A;  1YYD A;  5CIB A;  4ZS3 A;  4ZI2 D;  4JMB A;  2WBL A;  3C64 A;  5GON E;  2Y6A A;  2V2E A;  1LLP A;  1HF8 A;  1MNE A;  3FM6 A;  1H58 A;  3ZMU B;  5C8Y E;  2VK9 A;  1HSR A;  4MLK A;  1H5F A;  3RH3 A;  4B6X A;  4CXW A;  5SYV A;  5CB4 E;  4O2B E;  4X1Y E;  4PAG A;  1CMU A;  4UIG A;  3I0Q A;  5H6R B;  3N9N A;  4ZI7 E;  3WAJ A;  5JDL A;  4AKH A;  2CXD A;  1CMT A;  3HKC E;  4CZZ B;  2V7K A;  2XJ6 A;  5SYW A;  2H7V C;  2XAF B;  1ATJ A;  2LSK A;  3EDV A;  5M4Y A;  4EZ4 A;  3VLL A;  2AS2 A;  5SXX A;  2X9H A;  3HKB E;  3ZCJ A;  1SCH A;  4UF0 B;  5ABN A;  3N9O A;  5EK2 A;  4AI6 A;  2LJL A;  2K48 A;  4ZI2 C;  2XIF A;  4JMV A;  1LKX A;  1X79 A;  2EHO B;  3AA1 B;  3JC6 D;  5LHI B;  4CUO A;  2BCN A;  1ARP A;  4CCP A;  2ODV A;  3ZJ1 A;  5SX2 A;  1FEW A;  4NVH B;  1ZKE A;  1BEP A;  3FB2 A;  5A1L A;  4MBQ A;  4H9P C;  3N9Q A;  2XIL A;  2A72 A;  2CYP A;  3VLI A;  4BM1 A;  6ATJ A;  1S35 A;  1SHZ C;  1BEJ A;  2E3B A;  2VCF X;  3K3O A;  5ADX L;  4WNK A;  7CCP A;  3ZC1 A;  3IEE A;  1MMG A;  4JMS A;  5JVD E;  5LP6 E;  3AAA B;  3RKO A;  2RBX X;  4I55 E;  1BGP A;  3M2C A;  3RYF E;  2XJ8 A;  4A5G A;  5SYK A;  2KT9 A;  2YK0 A;  3ETV A;  3OJA A;  3PE0 A;  4WW0 A;  4EB6 E;  2CLY B;  2GHK X;  1ARX A;  2EUR A;  5JQR A;  3JC6 C;  4UEL A;  5HXH A;  5JDN A;  2X0L B;  2EUO A;  1IZN B;  4OQ7 A;  3GWH A;  3E22 E;  5JHZ A;  4H63 H;  5FMN A;  5KQ3 A;  3MKD A;  5HXR A;  4ADZ A;  4EYU A;  1ZEE A;  2B0Z A;  3EDU A;  2H7O A;  4BJN A;  2CE7 A;  5LGU B;  1U5P A;  2RP4 A;  4FDQ A;  4CXY A;  1ARU A;  5LBQ B;  4CI3 B;  3CQG B;  2PG8 A;  2XAS B;  1H7C A;  2JPF A;  4PNI A;  3ZCY A;  2V7L A;  2XJ5 A;  2EUP A;  1AEH A;  3J7Y q;  3O4X E;  3UT5 E;  1GWU A;  4O4H E;  1UX4 A;  5SXQ A;  2VKH A;  4CZR A;  5DJQ C;  5IHY A;  5JDF A;  2VWA A;  3C98 B;  1H5H A;  4DBQ A;  4JM5 A;  3CX7 B;  3LG7 A;  2ZCA A;  4IE4 A;  5FNE A;  1MK8 A;  2A2F X;  2LSJ A;  4O4J E;  1IAP A;  2LOP A;  1YZP A;  2N9D A;  1AC8 A;  2DWG A;  3O1H A;  5FYM A;  1YKE B;  3KBU A;  1LYC A;  3IF8 B;  5FXV A;  3UFE A;  2W23 A;  2YEV C;  2EHO D;  3I9Y A;  3IHR A;  4YLH A;  4P0A A;  1ZV4 X;  5LNK A;  3PTR B;  1FHF A;  3M27 A;  4QXB B;  3ZN1 B;  5BMV E;  1AEO A;  3ESL A;  3S4U A;  4GIW A;  4DMV A;  2D5U A;  1G8X A;  1BR0 A;  2KLQ A;  1MN1 A;  4G05 A;  2IC6 A;  1UX5 A;  4A56 A;  2CCA A;  3N9M A;  2VAS A;  1OAG A;  3VKG A;  2B1E A;  4C91 A;  4NUU A;  5SYJ A;  1PA2 A;  1MIY A;  4O8S A;  2JQQ A;  4XVA A;  7ATJ A;  1MN2 A;  3NZQ A;  4FI5 A;  3M2E A;  5CJH A;  5L86 A;  2BVM A;  2LHN A;  1CCI A;  3CKD A;  3CWZ B;  5FY0 A;  5JDQ A;  3CML A;  1QGJ A;  3Q3U A;  2LSG A;  2X68 A;  5CIC A;  2BZB A;  1V0H X;  1YKH B;  2EUT A;  3FM1 A;  4A71 A;  4OHF A;  4ZOL E;  4AKI A;  2NW9 A;  3M28 A;  2C5I T;  1UCU A;  3E08 A;  3HA4 A;  5SXS A;  2ES0 A;  4ILU A;  2YCG A;  3CPZ A;  1QPA A;  2L8K A;  4XV7 A;  3O1I A;  1AEE A;  4XV5 A;  3V5S A;  5L3D B;  2CA5 A;  3LJC A;  3ZPO A;  4ZI3 D;  4XV6 A;  1H5L A;  3LFM A;  4JEH B;  3U3I A;  2WMO A;  1WYB A;  1GX2 A;  2DLR A;  4JM9 A;  5KQ2 A;  5DAB A;  5AFU L;  5LJN A;  3AA7 B;  1BVA A;  2Y48 B;  4JMW A;  2D0T A;  4OYK A;  3M2G A;  4TV9 E;  1MIV A;  2DNX A;  4TZ4 C;  3RPU A;  2N18 A;  2MOZ A;  2L9Q A;  4P0B A;  1CMP A;  4TV8 E;  5KSF A;  1H5G A;  4OK0 A;  5JH7 E;  1H5E A;  1BEK A;  2Y5A A;  4NUV A;  4BLY A;  5LYJ E;  2CCP A;  2E3A A;  2GHH X;  2NOX A;  5HWX A;  4ISS A;  5AL9 A;  4O4L E;  3KBT A;  5L05 A;  1AA4 A;  3FKG A;  4GED A;  2XAQ B;  3CX8 B;  3N5L A;  3J9X 1;  3E2N A;  3N9P A;  3PU8 A;  2VCS A;  5SX6 A;  4PJL A;  3UTK A;  4E7Z A;  4XV4 A;  2PCB A;  2EUN A;  1B85 A;  4OFZ A;  3HR0 A;  5SX0 B;  4CI2 B;  1ARY A;  5JHY A;  2P9B A;  1CPG A;  2GHE X;  3OKQ A;  1B7T A;  4GYS A;  3EXB A;  4C51 A;  4BM0 A;  5LGN B;  2Z6E A;  1HTJ F;  2V7M A;  3PUS A;  5SYL A;  3K3N A;  3IBP A;  3NZP A;  5LA6 E;  3B13 A;  1MKQ A;  4JPU A;  5SXR A;  1MIW A;  2KIN B;  2VB6 A;  2IA8 A;  3PUQ A;  4XZC A;  5H9E B;  3NRY A;  1STQ A;  1CCA A;  2X9W A;  4A78 A;  3UUL A;  3C4Z A;  1CCC A;  2VKA A;  2NP9 A;  1FMW A;  2AS3 A;  2XAH B;  3OYX A;  4XV8 A;  2QGS A;  3DJB A;  2X07 A;  5E0O A;  5F8P A;  1IYN A;  1SJ2 A;  4MAL A;  1D0X A;  2HPL A;  4PFO A;  3QK6 A;  4HN9 A;  4BAY B;  3VLK A;  5JRC B;  1YYG A;  3O9X A;  2GB8 A;  2CMR A;  3W15 B;  1HG2 A;  1GW2 A;  2BOQ A;  2W62 A;  4UVB B;  2Q9Q A;  3Q2M A;  5SW6 A;  4JPT A;  3AB3 B;  4I43 B;  3UUX B;  1SBM A;  2E9X C;  2VNX X;  5J1G A;  1AEM A;  4CZO A;  2IC9 A;  4PK5 A;  5KQI A;  3RC8 A;  1EBE A;  1HCH A;  2MYS A;  3BQI A;  3KV9 A;  2WSS V;  4L0R A;  4DND A;  2AS4 A;  2K24 A;  1DJ5 A;  3GMI A;  3UUN A;  1CCG A;  5FNB A;  4KUM B;  1APX A;  2XI6 A;  4H63 V;  4P09 A;  3RIW A;  2BVL A;  5D6M A;  2Q9Q C;  4HFV A;  4IE7 A;  1LY9 A;  3KFW X;  1QUU A;  2B11 A;  2NWB A;  4BM3 A;  3AA0 B;  4CXX A;  4BLZ A;  1BR4 A;  3VLM A;  1CCE A;  2YLJ A;  3HKE E;  4MHC A;  2WD4 A;  2K5B B;  4HE8 A;  3ZCH A;  5H9F B;  2V26 A;  2WWU A;  2SPC A;  3MJX A;  1MNP A;  5KQ6 A;  3LK2 B;  2PFV A;  3AVR A;  5LBM A;  1ZBZ A;  4NVE A;  4GYR A;  3RX6 A;  4N78 D;  4KMC A;  2VKD A;  3SOL A;  2J1D G;  5CIE A;  2CCD A;  4ATJ A;  1LVF A;  1U2L A;  2G0U A;  2JMK A;  3C4W A;  3DP7 A;  3E0Z A;  4EYY R;  2LHR A;  5LGT B;  3P8C D;  5FNV E;  1H5D A;  4PFP A;  3ZYM A;  5JRE A;  5ABQ A;  3M2B A;  5SX0 A;  1D1B A;  2D2S A;  3PUR A;  2RC0 X;  3RRW A;  3M2A A;  2C5K T;  2JTI A;  2X66 A;  4CI1 B;  5SYY A;  1IJ6 A;  5HYA A;  4PAE A;  4JUY A;  2E39 A;  2KXP B;  3ZN0 B;  2AS1 A;  2Y8D A;  1AES A;  3OYZ A;  2V7J A;  4K0U A;  4J2C A;  3QC9 A;  4U7U B;  4AKR B;  3A5X A;  2ACX A;  1DSP A;  4X1K E;  4USC A;  2BDE A;  4ASK A;  2WMN A;  2XTL A;  5SYH A;  2KMF A;  2RA1 A;  3DTO A;  2AS6 A;  3F2E A;  3ZLI A;  2RC1 X;  5JPR A;  2E8I A;  2RC2 X;  5HXS A;  2DHR A;  3N2G E;  3ETU A;  3Q5X A;  3KVB A;  3GN5 A;  3CCP A;  2XQY A;  3M23 A;  5KMG P;  1ZHC A;  1H5I A;  1G73 A;  5HAX A;  2XHE B;  1W4Y A;  1H57 A;  3L09 A;  5DQW A;  2B12 A;  5JRC A;  5HXE A;  3M2I A;  4AQF C;  5EJX A;  3FBZ A;  4X1I E;  1D0Z A;  3ZJ2 A;  2E9X B;  1VRB A;  2NTY A;  2L3L A;  5SX3 A;  3EVY A;  5CD4 J;  1NAF A;  3P7I A;  3ZYK A;  4QX8 B;  3VU7 H;  3FXD B;  3LK4 2;  3MAC A;  3F57 A;  1ML2 A;  3AAE B;  3HKD E;  3ZMZ B;  3MK7 C;  1CPE A;  4TN7 B;  3RYH E;  1KK7 A;  3GA8 A;  1OWA A;  2MBG A;  2UXX B;  4NVO B;  1HS7 A;  4QHO A;  3B57 A;  2Q9Q B;  5CA1 E;  1ARW A;  2LSY A;  4C90 A;  3AVS A;  5EK3 A;  3MA9 A;  3M26 A;  3UT2 A;  3VLH A;  2C5J A;  2PBI A;  2V7I A;  4KP3 C;  1IJ5 A;  1HG5 A;  1SDQ A;  4JZA A;  5EK4 A;  5CID A;  3PU3 A;  5J2T E;  2ZMA A;  2YU2 A;  4FCS A;  1HX8 A;  3CCX A;  2X08 A;  3X16 A;  1CCP A;  4TUY E;  2X9Y A;  1B82 A;  2W61 A;  4ZHQ E;  4JM8 A;  4A7M A;  2OA5 A;  1U2J A;  2WM9 A;  3N9L A;  3CX6 B;  3UW8 A;  4JQK A;  4CZQ A;  1BJ9 A;  1H5A A;  5AMM A;  2RBU X;  3E2O A;  1AEG A;  5H6Q B;  3R6N A;  4EOZ B;  3ZC0 A;  2IAK A;  1H3J A;  5ABO A;  4P4Q A;  4CVJ A;  1OXZ A;  3F31 A;  3VLJ A;  3LBX A;  4WBO A;  2HPJ A;  4IE0 A;  5DQV A;  5SW5 A;  1HCI A;  5HXC A;  3RRC A;  1H55 A;  1E1H B;  3ATJ A;  2IW5 B;  2VL8 A;  1ZBY A;  5CIF A;  5FXX A;  3WI3 A;  3ONX A;  4CVI A;  4JQJ A;  4FEF A;  2QA7 A;  4HEA A;  2JMH A;  2MTQ A;  3CQX C;  1CCB A;  4DBR A;  4WBN E;  2XAG B;  4G63 A;  4KBM B;  5L3F B;  1CPD A;  4QYZ B;  1HFA A;  4GOU A;  3Q5W A;  1U75 A;  1UB2 A;  2CL4 X;  4JQM A;  4AKG A;  1FMV A;  2CXF A;  3I1A A;  2W00 A;  2LM9 A;  3QUJ A;  3FBL A;  1DJ1 A;  4O4I E;  1EZ3 A;  5FY1 A;  3VHL A;  2ANZ A;  1A2G A;  1BEM A;  4NVG B;  2E9X D;  2HH7 A;  2CM0 A;  4H7A A;  1AC4 A;  2D0U A;  2KND A;  2ZM0 A;  4I4T E;  4CCX A;  4M1P A;  5EZY E;  4FCN A;  1DSO A;  2CWY A;  1BR1 A;  3C51 A;  1US7 B;  4JB4 A;  2ZLY A;  3T8O A;  2E9X A;  2VO2 X;  3FJW A;  2LE8 A;  2VNZ X;  2LSI A;  3M2H A;  2X67 A;  4NVC A;  2LOS A;  2ICV A;  3GN5 B;  4IST A;  3I9W A;  1AEQ A;  2Q9Q D;  5L3C B;  1GZA A;  4IDZ A;  1CPF A;  5SX7 A;  3ANW B;  1SA0 E;  1GWT A;  4HKA A;  5L3E B;  2KWI B;  4EIW A;  4NVK B;  2NW7 A;  3MXZ A;  1H5K A;  2WAU A;  4JM6 A;  4I50 E;  5CA0 E;  1DSE A;  5HWY A;  2CXL A;  1S73 A;  3SRZ A;  4NVN B;  2EUQ A;  5SYU A;  3R99 A;  3NBX X;  2VKO A;  1CYF A;  2RBT X;  4YFS A;  3RYC E;  2LEH A;  2AQD A;  4EXT A;  4TX5 A;  1CCK A;  4AKL A;  2XAJ B;  4DMW A;  3ZMT B;  1H5C A;  4DO0 A;  1KRJ A;  1O3X A;  3PUA A;  1S6V A;  3M2D A;  2DCF A;  3HL6 A;  2EUU A;  4PK4 A;  4PJN A;  2NW8 A;  4JMA A;  3U78 A;  1MKR A;  2B10 A;  5JR9 B;  2LT3 A;  4AQG A;  1AEF A;  4H9O C;  1KOK A;  4PJM A;  4YHJ A;  5L3G B;  4PK6 A;  1CUN A;  3KV6 A;  4DVD A;  4UEM A;  4E7S A;  4UV8 B;  4ZS2 A;  3MZK B;  3FHN A;  1CCJ A;  4BLL A;  5KQ0 A;  1FIO A;  2DWK A;  2PCC A;  3CVR A;  1A2F A;  3EUH A;  3PDY A;  3CQC B;  4ANJ A;  5L3B B;  2VCN A;  3V5U A;  4PW8 A;  3C4X A;  4ERR A;  2KWH A;  2M67 A;  4IIJ E;  4PJJ A;  3N2O A;  4UXN B;  5ETW A;  3K8P C;  3LBX B;  5SX1 A;  1LGA A;  4NVJ B;  5CIH A;  1RYC A;  1T98 A;  3M8M A;  3FXE B;  3M2F A;  5SYX A;  2VKJ A;  3I0O A;  4H9R C;  3ZCG A;  1KZM A;  2CWO A;  3ZEF B;  5LHH B;  3L3P A;  1S94 A;  4QWN B;  4JQN A;  3WAK A;  5LHG B;  3H37 A;  4BJM A;  1Y64 B;  4QXC B;  3O1J A;  5LOV E;  3BK9 A;  4BLX A;  2ZM8 A;  1DS4 A;  4NVL A;  4CQI A;  2H3R A;  5FXW A;  1JCI A;  2GGN X;  4YJ2 E;  5KDM C;  2CCQ A;  4JEU B;  4AQF A;  5KSK A;  1AEV A;  3M5Q A;  4XAX B;  4EAH A;  1YD8 G;  3ZMV B;  2JJ9 A;  1AEN A;  2ODU A;  4BM4 A;  2X51 A;  1LY8 A;  1QSD A;  1AEJ A;  4UVA B;  3WXO A;  5JDM A;  4NFG A;  4QX7 B;  2CEP A;  3UUM A;  3KVA A;  1AEK A;  3ANW A;  2Y6X A;  1KXN A;  1V9D A;  1MND A;  1OAF A;  3M25 A;  4O2A E;  4U74 A;  1BES A;  3RC3 A;  1CK6 A;  4UVC B;  4JLE A;  2GK9 A;  4NVB A;  4L9I A;  1W4W A;  3ZCI A;  1MMD A;  1MMA A;  4OYJ A;  3TKL B;  3HI2 A;  4H9N C;  5FP3 A;  3OBV E;  1D0Y A;  4BA9 A;  4C50 A;  3PUG A;  1ITK A;  4FJO A;  4YJ3 E;  5LXT E;  5EJT A;  4NVA A;  3N2K E;  1AED A;  2X9X A;  4HTE A;  5JDH A;  2W63 A;  4AXP A;  1BEQ A;  5KQK A;  4IHJ E;  4UF0 A;  5JR9 A;  4X20 E;  1CMQ A;  2RBZ X;  4JMZ A;  5ALA A;  1Z0P A;  3RIV A;  2PJQ A;  2YIN A;  1GWO A;  2Y6B A;  1NWM X;  2EHO A;  1Z53 A;  1C8I A;  2NTX A;  4JPL A;  2GHD X;  3WA8 A;  3KV5 A;  2ATJ A;  5L02 A;  4MFR A;  4Z8X A;  5JQG E;  3ZMS B;  1KXM A;  1H5M A;  2RBY X;  5IYZ E;  5LCY A;  1AEU A;  1YW0 A;  1DCC A;  2RBW X;  1D1A A;  1U74 A;  5SYI A;  5JR9 C;  4BLN A;  3FMU A;  3D0T A;  1U4Q A;  4GK5 E;  3SWH A;  1ARV A;  5SW4 A;  3VKH A;  2EUS A;  3Q9D A;  1D1C A;  2JRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...