3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
1GZAA 1ARVA 3M5QA 3Q3UA 5CIFA 4JPTA 4NVGB 1CCAA 4JPLA 5KQ6A 4FCNA 3FM6A 5KSFA 5SX6A 1AETA 1V0HX 1GWTA 2VCNA 1H3JA 1ITKA 3RIVA 1U75A 1W4WA 3M27A 1BVAA 1BEKA 1FHFA 2VNXX 3VLLA 5SW4A 1AEEA 2EUNA 3M28A 2EUUA 1H58A 1JCIA 2E3BA 1C8IA 5AMMA 2RC0X 2GHHX 1BGPA 4BM2A 4A6ZA 2XILA 3FKGA 1BEMA 1UB2A 5SYLA 4BM0A 5FNBA 4JMTA 1CCJA 1SBMA 2VNZX 2CL4X 5CIHA 2YCGA 2N18A 4JPUA 1AENA 2YLJA 1GWOA 4CZRA 5KQ0A 1Z53A 5CIDA 4BLLA 1KOKA 4C50A 1OAGA 1AEGA 1QGJA 4XVAA 1OAFA 4NVMB 4NVBA 2RBUX 5SXWA 4NVNB 4NVDA 1U2KA 4CZQA 3M2HA 1AEUA 1CCBA 1H5LA 1LLPA 5ALAA 1DJ1A 1U2LA 1MN2A 1GW2A 1MK8A 4JQJA 1CPFA 5JPRA 1B82A 1AEJA 1DSOA 5ABNA 1CCLA 3HDLA 5SYVA 2IA8A 5SX0B 4NFGA 4USCA 1SOGA 3FM1A 2RC1X 5SYWA 1H5CA 1CCGA 4GEDA 1H5JA 4OQ7A 5SYJA 4BM1A 4JB4A 1YZPA 4CZPA 1AC4A 3WNUA 3M29A 4G05A 1CMTA 1SDQA 1YYGA 3M26A 4A71A 4JMSA 2WD4A 5SYXA 2B10A 4CVJA 1RYCA 4PAEA 3X16A 1QO4A 1SJ2A 1H5GA 2EUSA 2RBZX 4NVFA 1CCCA 5SX2A 2BOQA 3M2IA 4JMVA 2PCCA 3M2AA 4NVEA 1H5FA 3FMUA 1BESA 3VLKA 1A2GA 2XJ8A 4P4QA 1AEKA 4FEFA 1CYFA 3E2NA 4JN0A 1AEOA 1B85A 2XJ5A 4BM3A 1ZBZA 3M25A 5SXSA 3R99A 5KQ3A 2VKAA 2ICVA 1LYCA 3FM4A 4JM9A 5SX0A 5L02A 2JTIA 3M2FA 1HSRA 3M8MA 3R98A 5JQRA 1S6VA 4CZNA 2RC2X 1EBEA 2EURA 2X08A 2W23A 1AEQA 4JMAA 5CIGA 1PA2A 4BLZA 5EJTA 4A5GA 3CCXA 1CK6A 1ARYA 3M2CA 4A78A 1DSGA 1KRJA 2CCPA 5SYKA 1AEBA 3M2GA 1H5IA 1ZBYA 1CCIA 5KQKA 2EUTA 2BCNA 5ABOA 2AQDA 3FJWA 1H5DA 4NVJB 4BLYA 5SXTA 1CCKA 2B0ZA 1KXMA 4FCSA 5SX1A 1LYKA 2E3AA 2GHCX 5JHXA 3CCPA 4CCXA 4XV8A 2GGNX 1BJ9A 2PCBA 5SX7A 5SYYA 1U74A 5CIBA 2AS3A 1ARXA 2AS2A 3VLJA 5KSKA 1S73A 2CEPA 4XV6A 1ML2A 2XJ6A 5AL9A 4NVHB 4BLKA 4CVIA 5SYUA 5JHZA 1ARPA 1AA4A 1AEFA 2GB8A 2GHEX 4JMBA 1KZMA 4NVIB 4CUOA 2RBTX 2V23A 4FDQA 2CCDA 1AEMA 2VCFX 1CPEA 1CPDA 5KQHA 1CCEA 5CJHA 3M23A 2V2EA 2RBWX 4XV5A 2X07A 4NVKB 1AEVA 3WXOA 1ARUA 4JM8A 1KXNA 1H5EA 2CCAA 3M2EA 1DSEA 4BM4A 2EUOA 2XI6A 4BLXA 1MKQA 1BEQA 5ABQA 1A2FA 5CICA 4JQMA 1H5AA 3ZCHA 4CCPA 5CCPA 4JM5A 2RBXX 5D6MA 5EJXA 4C51A 2EUQA 2AS4A 2Y6AA 3M2BA 5SW5A 1LY9A 1ARWA 2RBYX 2Y6BA 1CMPA 3EXBA 5SXRA 3UW8A 5FNEA 5KQIA 5L86A 1GX2A 2GHKX 3RRWA 1AESA 4NVCA 4XV4A 5SXXA 1ATJA 1DJ5A 1GWUA 5SYHA 1AC8A 2B11A 1SCHA 3UT2A 4BLNA 3ZCYA 5SYIA 1QPAA 4A7MA 3ZCGA 1B80A 2CYPA 3VLMA 5KQ2A 1AEHA 1BEPA 1CMQA 1DSPA 4NVAA 3E2OA 5L05A 1MNPA 3VLIA 2AS1A 5AOGA 1AEDA 1DCCA 3RIWA 4XV7A 1JDRA 2GHDX 6CCPA 4NVLA 1IYNA 1H5KA 4CZOA 1MKRA 1H5MA 2ATJA 1CPGA 4JMZA 3VLHA 3M2DA 4JMWA 2EUPA 1H57A 2E39A 1H5HA 1BEJA 1APXA 4NVOB 2AS6A 2VCSA 1CCPA 1STQA 1W4YA 1YYDA 2RBVX 1MN1A 2VO2X 2Y5AA 2XIHA 4ATJA 1LGAA 4JQKA 5JHYA 3ATJA 5CIEA 1YZRA 5SX3A 1HCHA 7CCPA 2ANZA 2XIFA 6ATJA 5SW6A 5SXQA 1DS4A 1GZBA 1H55A 2B12A 1CMUA 4JM6A 1U2JA 7ATJA 1LY8A 4JQNA
chains in the Genus database with same CATH superfamily
2KWIB 1ARVA 5CIFA 3W15B 3EABA 5IYZE 4YSYA 2YU2A 3ZKRA 5JDGA 3FM6A 2XZEA 1Y64B 3O1IA 5KSFA 3CKDA 2WBLA 2DWKA 4HFEA 1AETA 2LRKA 3OPCA 4XZCA 1D0YA 2UXXB 4O8SA 4CZZB 5JDQA 1FMWA 1HF8A 1LVFA 3RIVA 2M6IA 2BDEA 1IJ6A 3OYXA 5JQGE 2LRLA 1BEKA 3IHRA 2IAKA 4HN9A 4H9SE 2DL1A 1C8IA 2RC0X 1OEDB 2V7KA 1BGPA 3PUGA 4BM2A 3N2GE 2XILA 3SRZA 3WAKA 3PJAJ 4JMTA 2X68A 1SBMA 5ETWA 3RGLA 1AENA 5H9FB 3NBXX 4Z8XA 1GWOA 3MJXA 5JR9A 2OLTA 3FXEB 1IBMT 1KOKA 4C50A 1OAGA 2WP9A 4XVAA 4CN4A 3NZQA 4NVBA 3BQKA 2RBUX 4E7SA 2YOEA 3M2HA 5ALAA 3HA4A 3H37A 2HHHT 4DR1T 3M3ZB 5FY0A 2XQ5A 5JPRA 3E22E 3QB5K 1DSOA 5JDNA 3K3NA 1G73A 1HCIA 3K1SA 3WAJA 5SX0B 4DR2T 4QH5A 5JR9C 1MMGA 3AECA 3FM1A 3CQXC 2HH7A 5SYWA 4BJNA 1H5CA 2K5BB 3G06A 4GEDA 3AE1A 1QUUA 2CM0A 2D0TA 4P0BA 3ZJ1A 1AC4A 3WNUA 3M29A 3OKQA 4G05A 2ZOPA 3ANWA 1SDQA 4OHFA 1YYGA 5CB4E 1RYCA 2WSSV 4TV9E 2FUPA 2ODUA 4AKLA 4NXNT 2K9AA 1QO4A 2WWUA 3AEFA 2V1DB 5J2UE 2XSBA 5SX2A 2V7MA 2WDVA 1MIVA 5IUXA 2PCCA 4EZHA 4B3RT 2YINA 4O4IE 1H5FA 3FMUA 1A2GA 2XJ8A 4FEFA 3HL6A 3IF8B 4HFBA 4QXBB 2KSRA 3JADA 1CUNA 2VB6A 3RPUA 3CWZB 2N9DA 3MACA 2ICVA 1VRBA 1VOMA 3FM4A 2IW5B 3N9LA 3M8MA 5JQRA 2NR4A 4WNKA 1S6VA 2J1DG 2EHOC 2RC2X 1US7B 1EBEA 3KVBA 5CFBA 1I6ZA 1W0BA 2WMOA 1AEQA 4Z91A 3E08A 3RIUC 4GIWA 4BLZA 2X9HA 4ZXLA 5HWYA 3N2KE 3CCXA 1MNEA 5FXZA 1KRJA 5SYKA 2IC9A 1XNRT 2WMNA 5AQIB 5ABOA 2DNXA 2J47A 1T7SA 5ABFA 4EAHA 5SXTA 3ETVA 3KBTA 5FY1A 4EB6E 3RIFA 1KXMA 2KT9A 4F6RC 2W62A 3MKDA 4YTMA 2X9XA 3N9PA 2LHRA 2GGNX 3RYIE 3ZMUB 5SX7A 2E8IA 2VVSA 5C8YE 5KSKA 4UVAB 3PUSA 1WR0A 1YD8G 2P9BA 5AL9A 2D9DA 3ESLA 2V5DA 4BLKA 1YXRA 2A9UA 1WCRA 4TWHA 2HN1A 1JNZA 1HS7A 2GB8A 2GHEX 4JMBA 4JUYA 4O4LE 4CUOA 2RBTX 3RIUA 2JQHA 2LKHA 1IBKT 2XTLA 4AQFA 4GKJT 1WYCA 3UU3A 1I94T 3R6NA 5CJHA 4NPPA 4KHZF 2V6YB 3RYHE 4XV5A 1R8IA 2L8KA 4JEHB 2X07A 4A97A 3OJAA 1J5WA 4EXTA 2CXFA 3FHNA 5FXVA 4YSXA 4I0UA 3VR9A 4EIWA 2EHOB 3C64A 4EV6A 4L0RA 5CICA 4HFVA 4JQMA 4PJMA 5KXJA 1H5AA 1YQ4A 1SHZC 1J1JA 2CLYB 2H3RA 2XM2A 2V6YA 3KDSE 1CMPA 2LKGA 5LYJE 5H6QB 1GX2A 2QYWA 1XZYA 4F8HA 5EK2A 4NVCA 4NIQA 1HG2A 2J62A 4WW0A 3CVRA 3UU8A 3ZT7A 2NW8A 5AQKB 4PJJA 1NAFA 3AA0B 2KINB 1QPAA 2Y48B 4L9IA 1IBLT 3FZLB 4U7IA 1AEHA 5L3BB 2K48A 1CMQA 3E2OA 2LSJA 4LF5T 5LOVE 1MNPA 3DJBA 1HR0T 2VK9A 2RA1A 4H9PC 1AEDA 2VL8A 5JDLA 1DCCA 2EHOA 3N9NA 4ZHQE 2BKNA 1NEKA 2GHDX 2E9XD 1IYNA 2X51A 2NW9A 1H5MA 4YHHT 4DV1T 5LGNB 3EHZA 5JRCB 4OYKA 4IE0A 5DQVA 4JMZA 2XAHB 4H9QC 4KHPT 5FXWA 4GYSA 3KFWX 3U3IA 2EUPA 4J2CA 5LGUB 3MZKB 2E39A 3PUZF 3VKGA 1N36T 4EEDA 3E0ZA 3P8CD 4NUVA 2RBVX 3KV9A 3CK6A 4OX9T 4EZ4A 1M62A 5KMGP 4O2BE 3SWHA 4ATJA 2E9XA 3LSVA 4QH4A 2E9XC 4DR6T 3VRBA 4LF4T 2E2AA 5C2TA 2XQ3A 1YZRA 3ZMSB 5LHGB 4UEMA 4TN7B 1UGOA 2HPJA 5M4YA 4HTEA 6ATJA 3N9MA 2H88A 2LM9A 2AXDS 4AI6A 1GZAA 3M5QA 4CXYA 4NVGB 3I9YA 4I50E 1S94A 4DR5T 4X1YE 3AXJA 3LK2B 5HXSA 5SX6A 1WYBA 3AE8A 5HXHA 1KNPA 4IGUA 5BR8T 3O1HA 4KP3C 2CHNA 2VCNA 3NRYA 4IE5A 2XQYA 1XDPA 2WZHA 1H7CA 3P50A 4IIJE 5LA6E 5J2TE 1U75A 4YFSA 4FI5A 1ZP0A 4DIDB 4ZEYA 3M27A 5AQFB 3PTRB 2BG9A 2UXNB 5SW4A 4HWHA 2PBIA 2EUUA 1WFDA 4PW8A 1MMDA 2OEBA 4JLEA 2V7JA 4PK5A 2IDOB 2V7IA 3UFGA 3K8PC 4DBRA 1KNRA 3ZMTB 2R6GF 2WM9A 2IC6A 3ZEFB 3KVAA 3QK6A 3DP7A 2YCGA 3ZN0B 3PUQA 5F3JA 2YLJA 5LHHB 4CZRA 4YLHA 3ZSTA 2WCAA 2ODVA 2HPLA 2KNDA 1AEGA 3I1AA 4ZI3D 5FY7A 3NRXA 4JI6T 3AVRA 1CCBA 4AISA 1U2LA 2MBGA 1GW2A 5HEJA 1HG5A 3QUJA 2CBIA 1LVKA 5F5WA 2D0UA 4XBFB 4H9OC 5ABEA 3IBPA 2RP4A 3HDLA 2K3WA 1Z8UA 4DV6T 2IA8A 4EYUA 5HWXA 2X0LB 1X79A 5HAXA 4G2AA 5L3GB 4JI8T 4DUYT 2YKSA 4AQGA 1SE7A 5HYAA 4OQ7A 2IUBA 3RQUA 4TWFA 3AE9A 4JB4A 1YZPA 2AE9A 4DV2T 5J0ZA 4ZI2D 5ABFB 3X1LF 5SYXA 3UUNA 2JQ9A 5JREA 2PTFA 5AQSB 2LEHA 2EUSA 3KINB 3Q5EA 1BR2A 4MFRA 4NVFA 2EHOD 2CE7A 2NTYA 3M2IA 5LG4A 4ILAA 4CN1A 2D2SA 3ZSSA 3T8OA 3QNUA 1UUSA 4TNVA 3ANWB 3S4UA 1ZBZA 2QRXA 2XJ7A 2I59A 2YN6A 5AQRB 4M1PA 2VKJA 1LYCA 5L02A 3R98A 4CZNA 4A56A 2EURA 3AVSA 2L9QA 4TNWA 5L2LA 3P4SA 5HCMA 2W23A 4JMAA 3V5SA 3ZN1B 1CK6A 5C3JA 4A78A 2JMHA 3PUWF 1DSGA 2CCPA 2BG9C 4X5TA 4QH1A 3RLFF 2JQQA 1HX1B 1XMOT 2IMLA 2FJDA 2EUTA 2BCNA 4IDQA 2AQDA 2CWOA 3ZCJA 1H5DA 5J1GA 3GN5B 4ISSA 3VHLA 1XNQT 5JHXA 3KV5A 1BJ9A 2VL0A 3LK42 5SYYA 1U74A 3VLJA 2AS3A 2AS2A 2CEPA 4XV6A 1ML2A 4B3ST 4JI4T 3NWIA 5FMNA 2E5VA 4LMJA 5JHZA 2Q9QC 3N2OA 1ARPA 3PUAA 1AEFA 4DMWA 4ILUA 3RIAA 1KZMA 4NVIB 4ZI3C 2V23A 2QGSA 4FDQA 4KBMB 3PU8A 4IE7A 1AEMA 2VCFX 3OVUA 1LKXA 4BJMA 1ZV4X 3RH3A 2N1GA 3C51A 4U72A 4NVKB 3D0TA 3A7MA 1AEVA 2V7LA 5AQQB 1T98A 3EAMA 2CBJA 3M2EA 1DSEA 2OV9A 2WZIA 2VQFT 2XI6A 4BLXA 1ABVA 3AE6A 1MKQA 1IJ5A 1BEQA 2H89A 3EDVA 3QOFA 3Q5WA 3KV6A 1OEDE 5L3EB 2WQYA 3SS1A 4FJOA 3ZCHA 4CCPA 2RBXX 5D6MA 4C51A 3C98B 2Y8DA 3KV4A 2EUQA 1UK5A 3M2BA 1UX5A 3UU4A 1ARWA 2RBYX 4H9NC 3UW8A 5L86A 5KQIA 3NVOA 3RRWA 3QB5A 2C5JA 3B57A 2X67A 2B11A 4CI3B 1VCTA 3PV0F 5L3CB 1J5ET 4UF0B 1D0XA 3P4PA 2XPKA 3F2EA 3HKEE 5SYIA 1U5PA 2NW7A 3ABVA 3VLMA 4UXNB 1BEPA 4HFDA 1DSPA 5L05A 3K3QC 1UCUA 4PFPA 3AXJB 5AOGA 2B1EA 4NUUA 4Q25A 3L39A 2FJEA 3RKOA 1JDRA 2LT3A 4AXPA 3ZJ2A 3CX7B 3ONXA 1N33T 4I4TE 4QHOA 4H63H 4IREA 2FJBA 4U74A 2V26A 3M2DA 2OA5A 5LG3A 2JRKA 4ERRA 4DR4T 5DABA 4HWDA 1OEDA 2E5LT 3IA3A 3UUXB 2BZBA 1STQA 2LJLA 1N34T 4H7AA 3MA9A 4Z90A 4U7UB 1YW0A 3ONLC 4C91A 4NXMT 2YDRA 4HWCA 3JC6D 2RPAA 1ZHCA 3BQLA 4AKGA 3ATJA 2CXLA 4IHJE 4MALA 1D0ZA 2LE8A 5LJMA 3HI2A 1CMUA 4JM6A 1KF6A 4ZOLE 2HN2A 3FZFB 2X9WA 1E7PA 4JPLA 2F4VT 5ABGA 2A72A 2W4XA 2CPTA 2VWAA 3ZLIA 2BVLA 3UT5E 4IDNA 4HFCA 4X1KE 5AQLB 5FL1A 3ZCIA 4WBNE 4KUMB 1H3JA 4U2YA 4TUYE 5AQPB 4YHJA 2KXPB 1W4WA 4TX5A 4DV3T 3Q5DA 1G8XA 1BVAA 2I0MA 5AQHB 2UUCT 2VNXX 5FVKA 5FXXA 1AEEA 4IL4A 2WS3A 2VASA 5AMMA 4MBQA 4AIUA 1FMVA 4XAXB 3PURA 4A6ZA 3GA8A 1UB2A 5SYLA 3AEEA 4BM0A 5FNBA 5L3FB 2VQET 1CCJA 2H7OA 4GK5E 3T1HT 3OTOT 3PJAA 2CL4X 2KLQA 4KI0F 2XUEA 1HNXT 1Z53A 5CIDA 4BLLA 1QGJA 2XQ9A 1OAFA 2NWBA 3SFDA 3RYFE 1T8BA 2C5KT 4NVDA 2BG9E 4CZQA 1AEUA 5BMVE 1DJ1A 2VVNA 1MK8A 3R84B 2JJ9A 4JQJA 4CI1B 4U33A 2W0GA 4TWDA 5L4EA 1V9DA 2WU5A 2L3LA 3P7IA 3CIRA 4GYRA 1CCLA 2XAQB 2JMXA 4GOUA 5SYVA 5LBMA 2BBHA 4ZZBA 3IEEA 4NFGA 3EI0A 4USCA 5AQJB 2XSAA 1IZNB 2Q9QD 4O2AE 2W2UA 3O9XA 1CCGA 5TAOA 1H5JA 3UFEA 2PFVA 4L5GA 4QXCB 2UUBT 3X1DA 4YY3T 3MK7C 2MTQA 4JMSA 3LBXA 2WD4A 4CVJA 3ZPOA 4PK6A 4PAEA 5LXTE 3AA6B 3X16A 1XDOA 1H5GA 5JR9B 4ZI2C 3FZKB 5H9EB 3OYZA 4K0KT 3RKGA 2BOQA 4AQYT 3TLVA 1WLXA 4IE6A 3M2AA 4NVEA 3P4QA 3UQ4A 3VLKA 4OFZA 4DVDA 4P4QA 4DR3T 1JNRA 4JN0A 4O4HE 1B85A 2XJ5A 4BM3A 3RI5A 3DTOA 5EK3A 4QXHB 5A1LA 4EYYR 3L8RA 2VKAA 4B3TT 2MPKA 2DWGA 4UVCB 2CHOA 5LMUT 2MOZA 2NOXA 4JM9A 4DO0A 5SX0A 2YDQA 3M2FA 4EGWA 1FIOA 2XAGB 5JDMA 1MNDA 3OBVE 3RYCE 2X08A 4UR9A 3WA8A 1MMAA 2BVMA 4QX8B 5ADXL 2IHR1 2BG9B 3ZYLA 2UXDT 1KFYA 1AJ3A 2CMRA 3ZMVB 1ARYA 1OWAA 2CXDA 2NTXA 3M2GA 1ZBYA 2LSIA 2PJQA 4TV8E 5KQKA 3FBLA 3AEGA 4ZS2A 4NVJB 4HGAA 4UVBB 3PUYF 4PFOA 2B0ZA 2MYSA 1MIYA 5SX1A 1LYKA 2DI4A 5IHYA 5LNKA 2GHCX 3CMLA 3CCPA 1HFAA 4CCXA 3H3AA 4LF6T 2UXCT 2PCBA 1WRDA 5L4HA 2CCQA 1FEWA 2H7VC 2XAJB 3VRAA 2KWHA 1S35A 2A2FX 4NVHB 4YXDA 5LHIB 4UF0A 4JBWF 2X0YA 4CXWA 1M7KA 3ETUA 1SA0E 3RRCA 3N5LA 2XQ6A 2VKHA 2WDQA 3BQIA 2V2EA 3J7Yq 4U2ZA 3N9QA 3B13A 2D5UA 3ZC0A 3AB3B 4UV9B 4ASKA 3WXOA 2KMFA 3C50A 4JM8A 3CPZA 2UXBT 4O4JE 4KMCA 1H5EA 4UELA 2V5CA 3AE4A 3ZT5A 1A2FA 2JIWA 4X64T 4LFCT 2CA5A 3ZC1A 1IAPA 1XWMA 1Y01A 4ADZA 1T72A 5CCPA 3TLUA 3FB2A 5EJXA 3UU6A 2LLYA 3M65A 3JC6C 2AS4A 2Y6AA 2LM2A 5IWAT 3LDQB 1LY9A 4JI3T 4JYAT 2ZM6T 2ES0A 1UURA 3T1YT 3EXBA 5SXRA 3I0OA 5JTGA 3GWHA 1DU2A 3AA1B 1HNZT 1AESA 1W9RA 2Z6EA 1QSDA 1ATJA 4AQFC 4DV7T 5DQWA 2XAFB 1SCHA 4BLNA 4GK0E 2FBWA 1BR4A 4ILBA 3LG7A 4A7MA 3ZCGA 1B80A 3LJCA 3AE2A 2M6BA 3NKZA 4NVAA 3HKDE 3PUXF 3C4ZA 2AS1A 4IT4A 1W0AA 3RIWA 3V5UA 5ABHA 4BA9A 4JZAA 4DMVA 1H5KA 4CZOA 5LP6E 2JQKA 5KDMC 2JMKA 1CPGA 3A5XA 3Q5XA 2JPFA 3VLHA 4YSZA 4ZI7E 3ZT6A 4CI2B 3K3OA 4X66T 2UUAT 1H5HA 1BEJA 3U78A 1HTJF 1D1AA 4NVOB 3RHWA 2AS6A 2W63A 4QWNB 1CCPA 4JI0T 1W4YA 1KK7A 5AQMB 2VO2X 2XIHA 2VKOA 3HKCE 4JI7T 3RX6A 4JQKA 2LHNA 2XQ4A 3JAFA 2LSKA 3O4XE 4LMKA 3C4WA 3B5MA 3AE7A 4P1NA 2X0HA 5HXEA 3TLSA 5SX3A 1MIWA 7CCPA 3ZYKA 5SW6A 5HEHA 5SXQA 4WZXA 2LSYA 4HE8A 1GZBA 2V6XA 1NENA 2Q9QB 3RQWA 3AAAB 7ATJA 4EOZB 2C0SA 3Q3UA 4HWIB 4JPTA 5HEUA 1CCAA 5KQ6A 4FCNA 2W67A 5CA0E 2BS2A 3I9WA 4PJLA 2YU1A 4QKNA 3VU7H 3WI3A 1V0HX 1GWTA 1Z0PA 5LBQB 4IE4A 5JDFA 1ITKA 4H9RC 5E0OA 1FHFA 2ZM2A 4MLKA 3VLLA 5AQTB 3UQ7A 4HEAA 2EUNA 3M28A 1H58A 3FZHB 1JCIA 2E3BA 3QC9A 2GHHX 4CXXA 5AQOB 1FJGT 3FKGA 1BEMA 2LOSA 4JI1T 5FKYA 5HEGA 2V8SV 3L3PA 4IDZA 5JVDE 2VNZX 4YTNA 5CIHA 2N18A 4JPUA 3TKLB 3PDYA 4GKFA 3AEBA 3UUMA 5KQ0A 4ZS3A 5FL0A 4U31A 2DHRA 4I55E 4NVMB 2Y6XA 3F31A 3O1JA 3CQGB 5SXWA 2J4GA 4NVNB 1U2KA 3L09A 1OXZA 1H5LA 1LLPA 4HKAA 4BAYB 1D1CA 1D1BA 3CX8B 4A5XA 1MN2A 3UUBA 3AAIA 5FP3A 3EVYA 1CPFA 3I0QA 4HFIA 5FNVE 1B82A 1AEJA 5ABNA 3H3MA 4GKKT 4EEBA 2DCFA 3AA7B 1N32T 3UU5A 5CD4J 1SOGA 2RC1X 4ZZCA 1WR6A 4PNIA 1E2AA 4K0UA 4OYJA 5SYJA 4BM1A 4LF9T 5AQVB 2LOPA 4CZPA 4JV5T 4AKHA 3VR8A 1E1HB 4A98A 1CMTA 4UIGA 1U4QA 3M26A 4A71A 3EDUA 2ACZA 2B10A 4IDPA 2WDRA 1SJ2A 4DV4T 3AAEB 2WB5A 2RBZX 3LBXB 3RF1A 1XMQT 3NZPA 1CCCA 4YTPA 4H63V 3J9X1 4HWFA 2XY8B 1NWMX 3JCFA 4JMVA 1BESA 1AEKA 1CYFA 3E2NA 2YDSA 3BK9A 1AEOA 5LB7B 4X65T 2LSGA 3M25A 5SXSA 4MHCA 3R99A 1ZOYA 3F57A 5KQ3A 1YKEB 5HXCA 5LCYA 1W09A 5LMNT 2JTIA 1HSRA 2E9XB 2XQ8A 5L47A 5CIGA 4H79A 1PA2A 3N9OA 3UTKA 2WY2A 5EJTA 4A5GA 3P4RA 3M2CA 1QLBA 3HR0A 4LFAT 4JEUB 4TZ4C 2A7UB 1AEBA 1H5IA 1CCIA 5JDHA 2W66A 5AQUB 1O3XA 4LF7T 3FJWA 4BLYA 1UX4A 4LFBT 2ZM0A 2GK9A 1CCKA 2WAUA 3LFMA 2KZ7B 4FCSA 2E3AA 4IL9A 2WSSS 4XV8A 4OK0A 4AKRB 5CIBA 1ARXA 1MMNA 2WU2A 1S73A 2QVAA 3CX6B 2SPCA 2XJ6A 2X66A 4QX7B 2C5IT 2CWYA 4CVIA 1HX8A 2FJAA 5AQGB 4LF8T 3TLTA 1X9BA 1BR1A 3CQCB 5SYUA 1AA4A 3LK3B 3RC3A 4B6XA 2XQ7A 5CJ5A 5JH7E 2CCDA 4HFHA 1CPEA 2BKPA 1CPDA 5KQHA 3KBUA 1CCEA 3M23A 3JAEA 3PU3A 2RBWX 4U3CA 4AKIA 5LJNA 4YT0A 4I43B 5EK4A 2WWVA 5JRCA 1ARUA 2CLYC 3A8YC 5HXRA 1KXNA 4IDOA 1YQ3A 2A3DA 2CCAA 2ACXA 1OEDC 2N2NA 4BM4A 2Q9QA 2BS3A 2EUOA 2ZLYA 2W61A 2ZMAA 2ZCAA 4WYVA 5ABQA 1SUMB 1BR0A 4V1Av 2BS4A 2CRBA 2VKDA 4G63A 1ZKEA 4C90A 3AE5A 5AQNB 3UULA 1B7TA 4JM5A 4JI2T 2UU9T 4U7YA 4PK4A 2VURA 4PAGA 3FXDB 5SW5A 2IIUA 4E7ZA 2Y6BA 5FYMA 5FNEA 2YK0A 2BBJA 2GHKX 4DBQA 4XV4A 1YKHB 1L0VA 5SXXA 1DJ5A 1GWUA 5HEOA 5SYHA 4COFA 2G0UA 1VCSA 1AC8A 3UT2A 1KEYA 3FBZA 2W00A 3ZCYA 2XM1A 4ANJA 4ISTA 3ZYMA 4JI5T 3SOLA 2CYPA 3PE0A 5KQ2A 4DV0T 4X1IE 3Q2MA 5DJQC 4P09A 3VLIA 5KX5E 4DUZT 2X9YA 2YEVC 2PG8A 2M67A 1ZEEA 4WBOA 4XV7A 4N78D 3GN5A 3EUHA 3ZMZB 1KNZA 2NP9A 3AEAA 6CCPA 4NVLA 2DLRA 4PJNA 4DNDA 2BKOA 5CGMA 4KX6A 4B3MT 3MXZA 1MKRA 1CHUA 4X20E 2QA7A 2ATJA 1EZ3A 5GONE 3AE3A 3P4WA 4JMWA 3FZMB 1H57A 1GQEA 3PUVF 2B76A 5H6RB 3VKHA 5EZYE 1APXA 3AEDA 2XQAA 2ZM8A 3C4XA 4DR7T 2VCSA 2CEAA 4UV8B 1YYDA 4X62T 4DV5T 3TLWA 1MN1A 2Y5AA 1HNWT 3ONJA 3RC8A 4QYZB 4CN6A 2I6HA 2XASB 5HCJA 1LGAA 3GMIA 4YJ2E 4CQIA 5JHYA 4YJ3E 3SFEA 5FVLA 5CIEA 5F8PA 2XHEB 1HCHA 2ANZA 2XIFA 1LRZA 4ILCA 3Q9DA 2BO5A 1DS4A 3HKBE 5LGTB 1H55A 2B12A 5L3DB 4LMLA 2MAWA 1U2JA 5CA1E 4P0AA 2K24A 1LY8A 4JQNA 5AFUL
chains in the Genus database with same CATH topology
2KWIB 1GZAA 1ARVA 3M5QA 3Q3UA 5CIFA 4JPTA 5IYZE 2X9WA 4NVGB 1CCAA 2YU2A 3W15B 4CXYA 4JPLA 5KQ6A 3I9YA 2A72A 4FCNA 5JDGA 2VWAA 3FM6A 3ZLIA 5CA0E 4I50E 1S94A 1Y64B 3O1IA 5KSFA 2BVLA 4X1YE 3I9WA 3LK2B 5HXSA 3UT5E 5SX6A 3CKDA 1WYBA 2WBLA 4PJLA 5HXHA 2DWKA 2YU1A 4QKNA 4IGUA 3VU7H 1AETA 3WI3A 4XZCA 1V0HX 1GWTA 1D0YA 3O1HA 4KP3C 4X1KE 2UXXB 4O8SA 2VCNA 1Z0PA 3ZCIA 3NRYA 4IE5A 5LBQB 4WBNE 4KUMB 4CZZB 5JDQA 1H3JA 1FMWA 4IE4A 1HF8A 1LVFA 2XQYA 4TUYE 5JDFA 1ITKA 3RIVA 1H7CA 4IIJE 2BDEA 5LA6E 1IJ6A 3OYXA 5JQGE 4YHJA 1U75A 1W4WA 2KXPB 4FI5A 4H9RC 4TX5A 4YFSA 3M27A 1G8XA 1BVAA 3PTRB 1BEKA 1FHFA 5E0OA 2VNXX 2ZM2A 4MLKA 3VLLA 3IHRA 2UXNB 5FXXA 5SW4A 1AEEA 4HEAA 2EUNA 3M28A 2IAKA 2EUUA 2PBIA 1H58A 4HN9A 4H9SE 1JCIA 2VASA 2E3BA 4PW8A 1C8IA 5AMMA 4MBQA 1FMVA 2RC0X 3QC9A 2GHHX 1MMDA 4XAXB 4CXXA 2V7KA 4JLEA 3PURA 2V7JA 1BGPA 4PK5A 2V7IA 3PUGA 4BM2A 4A6ZA 3K8PC 3N2GE 2XILA 3FKGA 3GA8A 3SRZA 4DBRA 1BEMA 1UB2A 5SYLA 2LOSA 3WAKA 4BM0A 5FNBA 3ZMTB 4JMTA 3L3PA 5L3FB 2WM9A 1CCJA 4IDZA 2X68A 1SBMA 2H7OA 2IC6A 4GK5E 5ETWA 3ZEFB 3KVAA 5JVDE 2VNZX 2CL4X 3QK6A 3DP7A 5CIHA 2YCGA 2KLQA 2N18A 4JPUA 3PUQA 2XUEA 3TKLB 3ZN0B 1AENA 5H9FB 3NBXX 3PDYA 2YLJA 1GWOA 4Z8XA 3UUMA 5F3JA 4CZRA 5LHHB 4YLHA 5KQ0A 1Z53A 5CIDA 3MJXA 2ODVA 4ZS3A 4BLLA 5JR9A 3FXEB 2HPLA 1KOKA 4C50A 1OAGA 2KNDA 2DHRA 1AEGA 1QGJA 4XVAA 3I1AA 4I55E 1OAFA 4NVMB 2Y6XA 3F31A 3NZQA 4ZI3D 4NVBA 5FY7A 3BQKA 2RBUX 3NRXA 2NWBA 3CQGB 3O1JA 3RYFE 5SXWA 2C5KT 4NVNB 4E7SA 4NVDA 1U2KA 3AVRA 4CZQA 3L09A 3M2HA 1AEUA 1CCBA 1H5LA 1LLPA 5ALAA 1OXZA 4HKAA 3HA4A 4BAYB 1D1CA 3H37A 5BMVE 1D1BA 1DJ1A 1U2LA 3CX8B 2MBGA 1MN2A 5FY0A 1GW2A 1MK8A 3R84B 3AAIA 1HG5A 4JQJA 2JJ9A 3EVYA 3QUJA 1CPFA 1LVKA 3I0QA 5FP3A 4CI1B 2D0UA 2W0GA 4XBFB 4H9OC 1V9DA 5FNVE 5JPRA 1B82A 3E22E 1AEJA 1DSOA 2L3LA 5ABNA 3P7IA 5JDNA 4GYRA 1CCLA 3IBPA 3K3NA 2RP4A 1G73A 2XAQB 3HDLA 1HCIA 4GOUA 3WAJA 5SYVA 5LBMA 3IEEA 2IA8A 5SX0B 4NFGA 2DCFA 3AA7B 4EYUA 5HWXA 5JR9C 4F6RC 2X0LB 4USCA 1IZNB 1MMGA 1X79A 5J2TE 5HAXA 2Q9QD 5CD4J 1SOGA 3FM1A 4G2AA 5L3GB 2RC1X 3CQXC 2HH7A 5SYWA 4BJNA 1H5CA 2K5BB 4O2AE 3O9XA 1CCGA 4GEDA 1WR6A 4AQGA 4PNIA 5HYAA 5TAOA 1H5JA 1QUUA 4OQ7A 3UFEA 4K0UA 2PFVA 4L5GA 4OYJA 2CM0A 2D0TA 4QXCB 5SYJA 4BM1A 4JB4A 1YZPA 4P0BA 3ZJ1A 2LOPA 4CZPA 1AC4A 4AKHA 3WNUA 1E1HB 3M29A 3OKQA 4G05A 1CMTA 4UIGA 1U4QA 3ANWA 1SDQA 4OHFA 3MK7C 4ZI2D 1YYGA 3M26A 4A71A 2MTQA 4JMSA 3EDUA 3LBXA 2WD4A 5SYXA 2B10A 4CVJA 1RYCA 5CB4E 3ZPOA 3UUNA 2WSSV 4PK6A 5JREA 4PAEA 4TV9E 5LXTE 2ODUA 3AA6B 3X16A 4AKLA 5JRCA 2K9AA 1QO4A 1SJ2A 2LEHA 2WWUA 3AAEB 1H5GA 5JR9B 2EUSA 2RBZX 3KINB 4ZI2C 2V1DB 3LBXB 5J2UE 5H9EB 1BR2A 4MFRA 4NVFA 1CCCA 5SX2A 2EHOD 2CE7A 3NZPA 3OYZA 4H63V 2BOQA 3J9X1 2NTYA 2V7MA 1MIVA 3M2IA 1NWMX 5LG4A 4JMVA 1WLXA 2PCCA 4IE6A 3M2AA 4EZHA 2YINA 4NVEA 4O4IE 1H5FA 3FMUA 1BESA 3VLKA 1A2GA 2XJ8A 2D2SA 4OFZA 4DVDA 4P4QA 3T8OA 1AEKA 4FEFA 3HL6A 1CYFA 3E2NA 4JN0A 3ANWB 3S4UA 3BK9A 3IF8B 4O4HE 1AEOA 1B85A 4QXBB 2LSGA 2XJ5A 4BM3A 1ZBZA 1CUNA 3M25A 5SXSA 2VB6A 3R99A 3CWZB 4MHCA 3F57A 3RPUA 2N9DA 3DTOA 5EK3A 4QXHB 3MACA 5A1LA 2I59A 4EYYR 5KQ3A 4M1PA 2VKAA 2ICVA 1VRBA 1VOMA 1YKEB 2DWGA 4UVCB 5HXCA 5LCYA 2MOZA 2VKJA 1LYCA 2NOXA 3FM4A 4JM9A 4DO0A 5SX0A 5L02A 2JTIA 3M2FA 2IW5B 3N9LA 1HSRA 3M8MA 3R98A 5JQRA 1S6VA 2E9XB 4CZNA 2J1DG 4WNKA 2EHOC 2RC2X 4A56A 1FIOA 1US7B 2XAGB 5JDMA 1MNDA 1EBEA 3KVBA 3OBVE 2EURA 2X08A 3RYCE 3AVSA 2L9QA 5L2LA 2W23A 2WMOA 1AEQA 3WA8A 1MMAA 2BVMA 4JMAA 5CIGA 4QX8B 5ADXL 3E08A 4H79A 1PA2A 3V5SA 3ZYLA 3ZN1B 4GIWA 4BLZA 2X9HA 3N9OA 3UTKA 2CMRA 1AJ3A 5HWYA 5EJTA 4A5GA 3CCXA 1CK6A 3N2KE 1ARYA 3M2CA 1MNEA 5FXZA 4A78A 2JMHA 3ZMVB 1DSGA 1KRJA 2CCPA 1OWAA 3HR0A 4JEUB 5SYKA 2CXDA 2NTXA 1AEBA 3M2GA 2IC9A 1H5IA 2JQQA 1ZBYA 2LSIA 4TZ4C 2WMNA 2PJQA 1CCIA 4H9PC 5KQKA 4TV8E 2EUTA 2BCNA 5ABOA 2DNXA 3FBLA 5JDHA 1O3XA 2AQDA 2CWOA 3ZCJA 3FJWA 1H5DA 4NVJB 4ZS2A 5J1GA 4EAHA 4BLYA 1UX4A 5SXTA 2ZM0A 3ETVA 4HGAA 4UVBB 3KBTA 5FY1A 4EB6E 4PFOA 2GK9A 1CCKA 2WAUA 2B0ZA 2MYSA 3LFMA 1KXMA 1MIYA 2KZ7B 3GN5B 4FCSA 2KT9A 5SX1A 4ISSA 1LYKA 2DI4A 2E3AA 5IHYA 2W62A 2GHCX 3VHLA 5JHXA 3MKDA 5LNKA 2X9XA 3N9PA 3CMLA 3CCPA 1HFAA 4CCXA 2LHRA 3H3AA 4XV8A 2GGNX 3KV5A 1BJ9A 2PCBA 3RYIE 4OK0A 3ZMUB 1WRDA 5SX7A 2CCQA 3LK42 4AKRB 5SYYA 1U74A 5CIBA 2AS3A 1ARXA 2AS2A 3VLJA 1FEWA 1MMNA 2E8IA 2H7VC 5KSKA 1S73A 2CEPA 4XV6A 2KWHA 2XAJB 4UVAB 5C8YE 3PUSA 3CX6B 1ML2A 1S35A 1YD8G 2XJ6A 5AL9A 2A2FX 2P9BA 2SPCA 3ESLA 4NVHB 2X66A 5LHIB 4BLKA 2C5IT 2CWYA 4QX7B 4CVIA 1HX8A 4UF0A 5FMNA 4CXWA 1BR1A 3CQCB 5SYUA 5JHZA 2Q9QC 3ETUA 3N2OA 1SA0E 1HS7A 1ARPA 1AA4A 1AEFA 2GB8A 2GHEX 3PUAA 3RRCA 3LK3B 4JMBA 4JUYA 4ILUA 4O4LE 1KZMA 4NVIB 4ZI3C 4CUOA 2RBTX 2V23A 3RC3A 4B6XA 2QGSA 4DMWA 3N5LA 4FDQA 4KBMB 3PU8A 2XTLA 4AQFA 5JH7E 2CCDA 1WYCA 4IE7A 1AEMA 2VCFX 1CPEA 2VKHA 1CPDA 5KQHA 3KBUA 3R6NA 1CCEA 5CJHA 3M23A 1LKXA 4BJMA 3PU3A 3BQIA 1ZV4X 2V2EA 2RBWX 3RH3A 4XV5A 2N1GA 3RYHE 3J7Yq 3N9QA 2L8KA 3B13A 4JEHB 4AKIA 3C51A 2D5UA 4U72A 2X07A 5LJNA 4NVKB 3D0TA 3AB3B 4I43B 3OJAA 4UV9B 5EK4A 1AEVA 2CXFA 4ASKA 3WXOA 4EXTA 1ARUA 2CLYC 2KMFA 3C50A 3FHNA 4JM8A 1KXNA 2V7LA 5FXVA 1T98A 5HXRA 3CPZA 4O4JE 4KMCA 1H5EA 2CCAA 2A3DA 3M2EA 1DSEA 2ACXA 2N2NA 4BM4A 2Q9QA 2EUOA 2ZLYA 2W61A 2ZMAA 2XI6A 4UELA 4BLXA 1MKQA 1IJ5A 1BEQA 2ZCAA 4EIWA 3EDVA 2EHOB 5ABQA 3Q5WA 1A2FA 3C64A 3KV6A 5L3EB 2CA5A 4L0RA 3ZC1A 4V1Av 5CICA 1BR0A 1IAPA 2VKDA 3SS1A 4G63A 4HFVA 4JQMA 1ZKEA 4PJMA 4C90A 2YEVC 4FJOA 1H5AA 3ZCHA 3UULA 1SHZC 1B7TA 4ADZA 4CCPA 5CCPA 2CLYB 2H3RA 3FB2A 4JM5A 2RBXX 5D6MA 5EJXA 4C51A 3C98B 3M65A 2Y8DA 3JC6C 3KV4A 2EUQA 4PK4A 2AS4A 2Y6AA 4PAGA 3M2BA 1UX5A 5SW5A 1LY9A 3FXDB 4E7ZA 1ARWA 2RBYX 2Y6BA 2ES0A 4H9NC 3KDSE 1CMPA 3EXBA 5SXRA 3UW8A 5FNEA 5KQIA 5L86A 2YK0A 3GWHA 3I0OA 5FYMA 5H6QB 5LYJE 1GX2A 3AA1B 2GHKX 3RRWA 4DBQA 1AESA 4NVCA 4XV4A 1YKHB 5EK2A 2Z6EA 5SXXA 1ATJA 1HG2A 1QSDA 1DJ5A 4AQFC 1GWUA 2C5JA 4WW0A 5DQWA 3CVRA 3B57A 5SYHA 2XAFB 2G0UA 2X67A 1AC8A 2B11A 1SCHA 3UT2A 4BLNA 2NW8A 4CI3B 4PJJA 4GK0E 5L3CB 1D0XA 1NAFA 3ZCYA 2W00A 3AA0B 3FBZA 4UF0B 1BR4A 3F2EA 3HKEE 4ANJA 5SYIA 2KINB 1U5PA 1QPAA 4ISTA 3LG7A 2NW7A 4A7MA 2Y48B 3ZCGA 3ZYMA 4L9IA 1B80A 2CYPA 3PE0A 3VLMA 3LJCA 5KQ2A 4UXNB 3SOLA 1AEHA 1BEPA 5L3BB 2K48A 1CMQA 1DSPA 4NVAA 3E2OA 5L05A 2LSJA 3K3QC 3HKDE 1MNPA 3Q2MA 4P09A 4X1IE 5DJQC 3VLIA 5LOVE 3C4ZA 1UCUA 3DJBA 2AS1A 5KX5E 2X9YA 4PFPA 2VK9A 2PG8A 5AOGA 1AEDA 2B1EA 2RA1A 2M67A 1ZEEA 2VL8A 1DCCA 2EHOA 3RIWA 4NUUA 5JDLA 3N9NA 4WBOA 3V5UA 4ZHQE 4XV7A 4N78D 3GN5A 3EUHA 3ZMZB 1KNZA 4BA9A 2NP9A 1JDRA 2GHDX 4JZAA 6CCPA 2LT3A 3RKOA 4NVLA 2DLRA 4PJNA 4AXPA 4DNDA 2E9XD 4DMVA 1IYNA 3ZJ2A 1H5KA 2X51A 3CX7B 2NW9A 4CZOA 3MXZA 5LP6E 1MKRA 1H5MA 3ONXA 4X20E 2QA7A 5LGNB 2ATJA 1EZ3A 4I4TE 4QHOA 5KDMC 2JMKA 1CPGA 3A5XA 3Q5XA 4H63H 4OYKA 4IE0A 5GONE 5JRCB 5DQVA 2JPFA 4JMZA 3VLHA 4U74A 2XAHB 4H9QC 2V26A 5FXWA 3M2DA 4JMWA 2OA5A 4ZI7E 4CI2B 2JRKA 3K3OA 3KFWX 2EUPA 1H57A 4GYSA 4J2CA 3MZKB 3U3IA 4ERRA 5LGUB 2E39A 5DABA 5H6RB 3VKHA 1H5HA 1BEJA 5EZYE 3VKGA 1APXA 3U78A 1HTJF 1D1AA 2ZM8A 3C4XA 3ZC0A 3E0ZA 3UUXB 2BZBA 4NVOB 2AS6A 2VCSA 2W63A 4QWNB 1CCPA 1STQA 2CEAA 2LJLA 3P8CD 4NUVA 1W4YA 1YYDA 4UV8B 2RBVX 1KK7A 3KV9A 1MN1A 2VO2X 2Y5AA 4EZ4A 4H7AA 3MA9A 5KMGP 2XIHA 3RC8A 4QYZB 4O2BE 3SWHA 2VKOA 4ATJA 3HKCE 4U7UB 1YW0A 2E9XA 1LGAA 2XASB 3GMIA 4JQKA 3RX6A 4C91A 2LHNA 3JC6D 4CQIA 5JHYA 4YJ3E 2E9XC 4YJ2E 1ZHCA 2LSKA 3BQLA 3O4XE 3C4WA 4AKGA 3ATJA 5CIEA 2CXLA 4EOZB 5F8PA 2XHEB 4IHJE 4MALA 1YZRA 3ZMSB 5HXEA 5LHGB 5SX3A 1D0ZA 4UEMA 4TN7B 2LE8A 1HCHA 1MIWA 2HPJA 5M4YA 7CCPA 2ANZA 4HTEA 2XIFA 3ZYKA 6ATJA 3N9MA 1LRZA 3Q9DA 2LM9A 5SW6A 5SXQA 1DS4A 3HKBE 2LSYA 4HE8A 5LGTB 1GZBA 5LJMA 1H55A 2B12A 3HI2A 5L3DB 1CMUA 4JM6A 4ZOLE 1U2JA 5CA1E 2Q9QB 4P0AA 2K24A 4AI6A 3AAAB 7ATJA 1LY8A 2C0SA 4JQNA 5AFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZA A;  1ARV A;  3M5Q A;  3Q3U A;  5CIF A;  4JPT A;  4NVG B;  1CCA A;  4JPL A;  5KQ6 A;  4FCN A;  3FM6 A;  5KSF A;  5SX6 A;  1AET A;  1V0H X;  1GWT A;  2VCN A;  1H3J A;  1ITK A;  3RIV A;  1U75 A;  1W4W A;  3M27 A;  1BVA A;  1BEK A;  1FHF A;  2VNX X;  3VLL A;  5SW4 A;  1AEE A;  2EUN A;  3M28 A;  2EUU A;  1H58 A;  1JCI A;  2E3B A;  1C8I A;  5AMM A;  2RC0 X;  2GHH X;  1BGP A;  4BM2 A;  4A6Z A;  2XIL A;  3FKG A;  1BEM A;  1UB2 A;  5SYL A;  4BM0 A;  5FNB A;  4JMT A;  1CCJ A;  1SBM A;  2VNZ X;  2CL4 X;  5CIH A;  2YCG A;  2N18 A;  4JPU A;  1AEN A;  2YLJ A;  1GWO A;  4CZR A;  5KQ0 A;  1Z53 A;  5CID A;  4BLL A;  1KOK A;  4C50 A;  1OAG A;  1AEG A;  1QGJ A;  4XVA A;  1OAF A;  4NVM B;  4NVB A;  2RBU X;  5SXW A;  4NVN B;  4NVD A;  1U2K A;  4CZQ A;  3M2H A;  1AEU A;  1CCB A;  1H5L A;  1LLP A;  5ALA A;  1DJ1 A;  1U2L A;  1MN2 A;  1GW2 A;  1MK8 A;  4JQJ A;  1CPF A;  5JPR A;  1B82 A;  1AEJ A;  1DSO A;  5ABN A;  1CCL A;  3HDL A;  5SYV A;  2IA8 A;  5SX0 B;  4NFG A;  4USC A;  1SOG A;  3FM1 A;  2RC1 X;  5SYW A;  1H5C A;  1CCG A;  4GED A;  1H5J A;  4OQ7 A;  5SYJ A;  4BM1 A;  4JB4 A;  1YZP A;  4CZP A;  1AC4 A;  3WNU A;  3M29 A;  4G05 A;  1CMT A;  1SDQ A;  1YYG A;  3M26 A;  4A71 A;  4JMS A;  2WD4 A;  5SYX A;  2B10 A;  4CVJ A;  1RYC A;  4PAE A;  3X16 A;  1QO4 A;  1SJ2 A;  1H5G A;  2EUS A;  2RBZ X;  4NVF A;  1CCC A;  5SX2 A;  2BOQ A;  3M2I A;  4JMV A;  2PCC A;  3M2A A;  4NVE A;  1H5F A;  3FMU A;  1BES A;  3VLK A;  1A2G A;  2XJ8 A;  4P4Q A;  1AEK A;  4FEF A;  1CYF A;  3E2N A;  4JN0 A;  1AEO A;  1B85 A;  2XJ5 A;  4BM3 A;  1ZBZ A;  3M25 A;  5SXS A;  3R99 A;  5KQ3 A;  2VKA A;  2ICV A;  1LYC A;  3FM4 A;  4JM9 A;  5SX0 A;  5L02 A;  2JTI A;  3M2F A;  1HSR A;  3M8M A;  3R98 A;  5JQR A;  1S6V A;  4CZN A;  2RC2 X;  1EBE A;  2EUR A;  2X08 A;  2W23 A;  1AEQ A;  4JMA A;  5CIG A;  1PA2 A;  4BLZ A;  5EJT A;  4A5G A;  3CCX A;  1CK6 A;  1ARY A;  3M2C A;  4A78 A;  1DSG A;  1KRJ A;  2CCP A;  5SYK A;  1AEB A;  3M2G A;  1H5I A;  1ZBY A;  1CCI A;  5KQK A;  2EUT A;  2BCN A;  5ABO A;  2AQD A;  3FJW A;  1H5D A;  4NVJ B;  4BLY A;  5SXT A;  1CCK A;  2B0Z A;  1KXM A;  4FCS A;  5SX1 A;  1LYK A;  2E3A A;  2GHC X;  5JHX A;  3CCP A;  4CCX A;  4XV8 A;  2GGN X;  1BJ9 A;  2PCB A;  5SX7 A;  5SYY A;  1U74 A;  5CIB A;  2AS3 A;  1ARX A;  2AS2 A;  3VLJ A;  5KSK A;  1S73 A;  2CEP A;  4XV6 A;  1ML2 A;  2XJ6 A;  5AL9 A;  4NVH B;  4BLK A;  4CVI A;  5SYU A;  5JHZ A;  1ARP A;  1AA4 A;  1AEF A;  2GB8 A;  2GHE X;  4JMB A;  1KZM A;  4NVI B;  4CUO A;  2RBT X;  2V23 A;  4FDQ A;  2CCD A;  1AEM A;  2VCF X;  1CPE A;  1CPD A;  5KQH A;  1CCE A;  5CJH A;  3M23 A;  2V2E A;  2RBW X;  4XV5 A;  2X07 A;  4NVK B;  1AEV A;  3WXO A;  1ARU A;  4JM8 A;  1KXN A;  1H5E A;  2CCA A;  3M2E A;  1DSE A;  4BM4 A;  2EUO A;  2XI6 A;  4BLX A;  1MKQ A;  1BEQ A;  5ABQ A;  1A2F A;  5CIC A;  4JQM A;  1H5A A;  3ZCH A;  4CCP A;  5CCP A;  4JM5 A;  2RBX X;  5D6M A;  5EJX A;  4C51 A;  2EUQ A;  2AS4 A;  2Y6A A;  3M2B A;  5SW5 A;  1LY9 A;  1ARW A;  2RBY X;  2Y6B A;  1CMP A;  3EXB A;  5SXR A;  3UW8 A;  5FNE A;  5KQI A;  5L86 A;  1GX2 A;  2GHK X;  3RRW A;  1AES A;  4NVC A;  4XV4 A;  5SXX A;  1ATJ A;  1DJ5 A;  1GWU A;  5SYH A;  1AC8 A;  2B11 A;  1SCH A;  3UT2 A;  4BLN A;  3ZCY A;  5SYI A;  1QPA A;  4A7M A;  3ZCG A;  1B80 A;  2CYP A;  3VLM A;  5KQ2 A;  1AEH A;  1BEP A;  1CMQ A;  1DSP A;  4NVA A;  3E2O A;  5L05 A;  1MNP A;  3VLI A;  2AS1 A;  5AOG A;  1AED A;  1DCC A;  3RIW A;  4XV7 A;  1JDR A;  2GHD X;  6CCP A;  4NVL A;  1IYN A;  1H5K A;  4CZO A;  1MKR A;  1H5M A;  2ATJ A;  1CPG A;  4JMZ A;  3VLH A;  3M2D A;  4JMW A;  2EUP A;  1H57 A;  2E39 A;  1H5H A;  1BEJ A;  1APX A;  4NVO B;  2AS6 A;  2VCS A;  1CCP A;  1STQ A;  1W4Y A;  1YYD A;  2RBV X;  1MN1 A;  2VO2 X;  2Y5A A;  2XIH A;  4ATJ A;  1LGA A;  4JQK A;  5JHY A;  3ATJ A;  5CIE A;  1YZR A;  5SX3 A;  1HCH A;  7CCP A;  2ANZ A;  2XIF A;  6ATJ A;  5SW6 A;  5SXQ A;  1DS4 A;  1GZB A;  1H55 A;  2B12 A;  1CMU A;  4JM6 A;  1U2J A;  7ATJ A;  1LY8 A;  4JQN A; 
#chains in the Genus database with same CATH topology
 2KWI B;  1ARV A;  5CIF A;  3W15 B;  3EAB A;  5IYZ E;  4YSY A;  2YU2 A;  3ZKR A;  5JDG A;  3FM6 A;  2XZE A;  1Y64 B;  3O1I A;  5KSF A;  3CKD A;  2WBL A;  2DWK A;  4HFE A;  1AET A;  2LRK A;  3OPC A;  4XZC A;  1D0Y A;  2UXX B;  4O8S A;  4CZZ B;  5JDQ A;  1FMW A;  1HF8 A;  1LVF A;  3RIV A;  2M6I A;  2BDE A;  1IJ6 A;  3OYX A;  5JQG E;  2LRL A;  1BEK A;  3IHR A;  2IAK A;  4HN9 A;  4H9S E;  2DL1 A;  1C8I A;  2RC0 X;  1OED B;  2V7K A;  1BGP A;  3PUG A;  4BM2 A;  3N2G E;  2XIL A;  3SRZ A;  3WAK A;  3PJA J;  4JMT A;  2X68 A;  1SBM A;  5ETW A;  3RGL A;  1AEN A;  5H9F B;  3NBX X;  4Z8X A;  1GWO A;  3MJX A;  5JR9 A;  2OLT A;  3FXE B;  1IBM T;  1KOK A;  4C50 A;  1OAG A;  2WP9 A;  4XVA A;  4CN4 A;  3NZQ A;  4NVB A;  3BQK A;  2RBU X;  4E7S A;  2YOE A;  3M2H A;  5ALA A;  3HA4 A;  3H37 A;  2HHH T;  4DR1 T;  3M3Z B;  5FY0 A;  2XQ5 A;  5JPR A;  3E22 E;  3QB5 K;  1DSO A;  5JDN A;  3K3N A;  1G73 A;  1HCI A;  3K1S A;  3WAJ A;  5SX0 B;  4DR2 T;  4QH5 A;  5JR9 C;  1MMG A;  3AEC A;  3FM1 A;  3CQX C;  2HH7 A;  5SYW A;  4BJN A;  1H5C A;  2K5B B;  3G06 A;  4GED A;  3AE1 A;  1QUU A;  2CM0 A;  2D0T A;  4P0B A;  3ZJ1 A;  1AC4 A;  3WNU A;  3M29 A;  3OKQ A;  4G05 A;  2ZOP A;  3ANW A;  1SDQ A;  4OHF A;  1YYG A;  5CB4 E;  1RYC A;  2WSS V;  4TV9 E;  2FUP A;  2ODU A;  4AKL A;  4NXN T;  2K9A A;  1QO4 A;  2WWU A;  3AEF A;  2V1D B;  5J2U E;  2XSB A;  5SX2 A;  2V7M A;  2WDV A;  1MIV A;  5IUX A;  2PCC A;  4EZH A;  4B3R T;  2YIN A;  4O4I E;  1H5F A;  3FMU A;  1A2G A;  2XJ8 A;  4FEF A;  3HL6 A;  3IF8 B;  4HFB A;  4QXB B;  2KSR A;  3JAD A;  1CUN A;  2VB6 A;  3RPU A;  3CWZ B;  2N9D A;  3MAC A;  2ICV A;  1VRB A;  1VOM A;  3FM4 A;  2IW5 B;  3N9L A;  3M8M A;  5JQR A;  2NR4 A;  4WNK A;  1S6V A;  2J1D G;  2EHO C;  2RC2 X;  1US7 B;  1EBE A;  3KVB A;  5CFB A;  1I6Z A;  1W0B A;  2WMO A;  1AEQ A;  4Z91 A;  3E08 A;  3RIU C;  4GIW A;  4BLZ A;  2X9H A;  4ZXL A;  5HWY A;  3N2K E;  3CCX A;  1MNE A;  5FXZ A;  1KRJ A;  5SYK A;  2IC9 A;  1XNR T;  2WMN A;  5AQI B;  5ABO A;  2DNX A;  2J47 A;  1T7S A;  5ABF A;  4EAH A;  5SXT A;  3ETV A;  3KBT A;  5FY1 A;  4EB6 E;  3RIF A;  1KXM A;  2KT9 A;  4F6R C;  2W62 A;  3MKD A;  4YTM A;  2X9X A;  3N9P A;  2LHR A;  2GGN X;  3RYI E;  3ZMU B;  5SX7 A;  2E8I A;  2VVS A;  5C8Y E;  5KSK A;  4UVA B;  3PUS A;  1WR0 A;  1YD8 G;  2P9B A;  5AL9 A;  2D9D A;  3ESL A;  2V5D A;  4BLK A;  1YXR A;  2A9U A;  1WCR A;  4TWH A;  2HN1 A;  1JNZ A;  1HS7 A;  2GB8 A;  2GHE X;  4JMB A;  4JUY A;  4O4L E;  4CUO A;  2RBT X;  3RIU A;  2JQH A;  2LKH A;  1IBK T;  2XTL A;  4AQF A;  4GKJ T;  1WYC A;  3UU3 A;  1I94 T;  3R6N A;  5CJH A;  4NPP A;  4KHZ F;  2V6Y B;  3RYH E;  4XV5 A;  1R8I A;  2L8K A;  4JEH B;  2X07 A;  4A97 A;  3OJA A;  1J5W A;  4EXT A;  2CXF A;  3FHN A;  5FXV A;  4YSX A;  4I0U A;  3VR9 A;  4EIW A;  2EHO B;  3C64 A;  4EV6 A;  4L0R A;  5CIC A;  4HFV A;  4JQM A;  4PJM A;  5KXJ A;  1H5A A;  1YQ4 A;  1SHZ C;  1J1J A;  2CLY B;  2H3R A;  2XM2 A;  2V6Y A;  3KDS E;  1CMP A;  2LKG A;  5LYJ E;  5H6Q B;  1GX2 A;  2QYW A;  1XZY A;  4F8H A;  5EK2 A;  4NVC A;  4NIQ A;  1HG2 A;  2J62 A;  4WW0 A;  3CVR A;  3UU8 A;  3ZT7 A;  2NW8 A;  5AQK B;  4PJJ A;  1NAF A;  3AA0 B;  2KIN B;  1QPA A;  2Y48 B;  4L9I A;  1IBL T;  3FZL B;  4U7I A;  1AEH A;  5L3B B;  2K48 A;  1CMQ A;  3E2O A;  2LSJ A;  4LF5 T;  5LOV E;  1MNP A;  3DJB A;  1HR0 T;  2VK9 A;  2RA1 A;  4H9P C;  1AED A;  2VL8 A;  5JDL A;  1DCC A;  2EHO A;  3N9N A;  4ZHQ E;  2BKN A;  1NEK A;  2GHD X;  2E9X D;  1IYN A;  2X51 A;  2NW9 A;  1H5M A;  4YHH T;  4DV1 T;  5LGN B;  3EHZ A;  5JRC B;  4OYK A;  4IE0 A;  5DQV A;  4JMZ A;  2XAH B;  4H9Q C;  4KHP T;  5FXW A;  4GYS A;  3KFW X;  3U3I A;  2EUP A;  4J2C A;  5LGU B;  3MZK B;  2E39 A;  3PUZ F;  3VKG A;  1N36 T;  4EED A;  3E0Z A;  3P8C D;  4NUV A;  2RBV X;  3KV9 A;  3CK6 A;  4OX9 T;  4EZ4 A;  1M62 A;  5KMG P;  4O2B E;  3SWH A;  4ATJ A;  2E9X A;  3LSV A;  4QH4 A;  2E9X C;  4DR6 T;  3VRB A;  4LF4 T;  2E2A A;  5C2T A;  2XQ3 A;  1YZR A;  3ZMS B;  5LHG B;  4UEM A;  4TN7 B;  1UGO A;  2HPJ A;  5M4Y A;  4HTE A;  6ATJ A;  3N9M A;  2H88 A;  2LM9 A;  2AXD S;  4AI6 A;  1GZA A;  3M5Q A;  4CXY A;  4NVG B;  3I9Y A;  4I50 E;  1S94 A;  4DR5 T;  4X1Y E;  3AXJ A;  3LK2 B;  5HXS A;  5SX6 A;  1WYB A;  3AE8 A;  5HXH A;  1KNP A;  4IGU A;  5BR8 T;  3O1H A;  4KP3 C;  2CHN A;  2VCN A;  3NRY A;  4IE5 A;  2XQY A;  1XDP A;  2WZH A;  1H7C A;  3P50 A;  4IIJ E;  5LA6 E;  5J2T E;  1U75 A;  4YFS A;  4FI5 A;  1ZP0 A;  4DID B;  4ZEY A;  3M27 A;  5AQF B;  3PTR B;  2BG9 A;  2UXN B;  5SW4 A;  4HWH A;  2PBI A;  2EUU A;  1WFD A;  4PW8 A;  1MMD A;  2OEB A;  4JLE A;  2V7J A;  4PK5 A;  2IDO B;  2V7I A;  3UFG A;  3K8P C;  4DBR A;  1KNR A;  3ZMT B;  2R6G F;  2WM9 A;  2IC6 A;  3ZEF B;  3KVA A;  3QK6 A;  3DP7 A;  2YCG A;  3ZN0 B;  3PUQ A;  5F3J A;  2YLJ A;  5LHH B;  4CZR A;  4YLH A;  3ZST A;  2WCA A;  2ODV A;  2HPL A;  2KND A;  1AEG A;  3I1A A;  4ZI3 D;  5FY7 A;  3NRX A;  4JI6 T;  3AVR A;  1CCB A;  4AIS A;  1U2L A;  2MBG A;  1GW2 A;  5HEJ A;  1HG5 A;  3QUJ A;  2CBI A;  1LVK A;  5F5W A;  2D0U A;  4XBF B;  4H9O C;  5ABE A;  3IBP A;  2RP4 A;  3HDL A;  2K3W A;  1Z8U A;  4DV6 T;  2IA8 A;  4EYU A;  5HWX A;  2X0L B;  1X79 A;  5HAX A;  4G2A A;  5L3G B;  4JI8 T;  4DUY T;  2YKS A;  4AQG A;  1SE7 A;  5HYA A;  4OQ7 A;  2IUB A;  3RQU A;  4TWF A;  3AE9 A;  4JB4 A;  1YZP A;  2AE9 A;  4DV2 T;  5J0Z A;  4ZI2 D;  5ABF B;  3X1L F;  5SYX A;  3UUN A;  2JQ9 A;  5JRE A;  2PTF A;  5AQS B;  2LEH A;  2EUS A;  3KIN B;  3Q5E A;  1BR2 A;  4MFR A;  4NVF A;  2EHO D;  2CE7 A;  2NTY A;  3M2I A;  5LG4 A;  4ILA A;  4CN1 A;  2D2S A;  3ZSS A;  3T8O A;  3QNU A;  1UUS A;  4TNV A;  3ANW B;  3S4U A;  1ZBZ A;  2QRX A;  2XJ7 A;  2I59 A;  2YN6 A;  5AQR B;  4M1P A;  2VKJ A;  1LYC A;  5L02 A;  3R98 A;  4CZN A;  4A56 A;  2EUR A;  3AVS A;  2L9Q A;  4TNW A;  5L2L A;  3P4S A;  5HCM A;  2W23 A;  4JMA A;  3V5S A;  3ZN1 B;  1CK6 A;  5C3J A;  4A78 A;  2JMH A;  3PUW F;  1DSG A;  2CCP A;  2BG9 C;  4X5T A;  4QH1 A;  3RLF F;  2JQQ A;  1HX1 B;  1XMO T;  2IML A;  2FJD A;  2EUT A;  2BCN A;  4IDQ A;  2AQD A;  2CWO A;  3ZCJ A;  1H5D A;  5J1G A;  3GN5 B;  4ISS A;  3VHL A;  1XNQ T;  5JHX A;  3KV5 A;  1BJ9 A;  2VL0 A;  3LK4 2;  5SYY A;  1U74 A;  3VLJ A;  2AS3 A;  2AS2 A;  2CEP A;  4XV6 A;  1ML2 A;  4B3S T;  4JI4 T;  3NWI A;  5FMN A;  2E5V A;  4LMJ A;  5JHZ A;  2Q9Q C;  3N2O A;  1ARP A;  3PUA A;  1AEF A;  4DMW A;  4ILU A;  3RIA A;  1KZM A;  4NVI B;  4ZI3 C;  2V23 A;  2QGS A;  4FDQ A;  4KBM B;  3PU8 A;  4IE7 A;  1AEM A;  2VCF X;  3OVU A;  1LKX A;  4BJM A;  1ZV4 X;  3RH3 A;  2N1G A;  3C51 A;  4U72 A;  4NVK B;  3D0T A;  3A7M A;  1AEV A;  2V7L A;  5AQQ B;  1T98 A;  3EAM A;  2CBJ A;  3M2E A;  1DSE A;  2OV9 A;  2WZI A;  2VQF T;  2XI6 A;  4BLX A;  1ABV A;  3AE6 A;  1MKQ A;  1IJ5 A;  1BEQ A;  2H89 A;  3EDV A;  3QOF A;  3Q5W A;  3KV6 A;  1OED E;  5L3E B;  2WQY A;  3SS1 A;  4FJO A;  3ZCH A;  4CCP A;  2RBX X;  5D6M A;  4C51 A;  3C98 B;  2Y8D A;  3KV4 A;  2EUQ A;  1UK5 A;  3M2B A;  1UX5 A;  3UU4 A;  1ARW A;  2RBY X;  4H9N C;  3UW8 A;  5L86 A;  5KQI A;  3NVO A;  3RRW A;  3QB5 A;  2C5J A;  3B57 A;  2X67 A;  2B11 A;  4CI3 B;  1VCT A;  3PV0 F;  5L3C B;  1J5E T;  4UF0 B;  1D0X A;  3P4P A;  2XPK A;  3F2E A;  3HKE E;  5SYI A;  1U5P A;  2NW7 A;  3ABV A;  3VLM A;  4UXN B;  1BEP A;  4HFD A;  1DSP A;  5L05 A;  3K3Q C;  1UCU A;  4PFP A;  3AXJ B;  5AOG A;  2B1E A;  4NUU A;  4Q25 A;  3L39 A;  2FJE A;  3RKO A;  1JDR A;  2LT3 A;  4AXP A;  3ZJ2 A;  3CX7 B;  3ONX A;  1N33 T;  4I4T E;  4QHO A;  4H63 H;  4IRE A;  2FJB A;  4U74 A;  2V26 A;  3M2D A;  2OA5 A;  5LG3 A;  2JRK A;  4ERR A;  4DR4 T;  5DAB A;  4HWD A;  1OED A;  2E5L T;  3IA3 A;  3UUX B;  2BZB A;  1STQ A;  2LJL A;  1N34 T;  4H7A A;  3MA9 A;  4Z90 A;  4U7U B;  1YW0 A;  3ONL C;  4C91 A;  4NXM T;  2YDR A;  4HWC A;  3JC6 D;  2RPA A;  1ZHC A;  3BQL A;  4AKG A;  3ATJ A;  2CXL A;  4IHJ E;  4MAL A;  1D0Z A;  2LE8 A;  5LJM A;  3HI2 A;  1CMU A;  4JM6 A;  1KF6 A;  4ZOL E;  2HN2 A;  3FZF B;  2X9W A;  1E7P A;  4JPL A;  2F4V T;  5ABG A;  2A72 A;  2W4X A;  2CPT A;  2VWA A;  3ZLI A;  2BVL A;  3UT5 E;  4IDN A;  4HFC A;  4X1K E;  5AQL B;  5FL1 A;  3ZCI A;  4WBN E;  4KUM B;  1H3J A;  4U2Y A;  4TUY E;  5AQP B;  4YHJ A;  2KXP B;  1W4W A;  4TX5 A;  4DV3 T;  3Q5D A;  1G8X A;  1BVA A;  2I0M A;  5AQH B;  2UUC T;  2VNX X;  5FVK A;  5FXX A;  1AEE A;  4IL4 A;  2WS3 A;  2VAS A;  5AMM A;  4MBQ A;  4AIU A;  1FMV A;  4XAX B;  3PUR A;  4A6Z A;  3GA8 A;  1UB2 A;  5SYL A;  3AEE A;  4BM0 A;  5FNB A;  5L3F B;  2VQE T;  1CCJ A;  2H7O A;  4GK5 E;  3T1H T;  3OTO T;  3PJA A;  2CL4 X;  2KLQ A;  4KI0 F;  2XUE A;  1HNX T;  1Z53 A;  5CID A;  4BLL A;  1QGJ A;  2XQ9 A;  1OAF A;  2NWB A;  3SFD A;  3RYF E;  1T8B A;  2C5K T;  4NVD A;  2BG9 E;  4CZQ A;  1AEU A;  5BMV E;  1DJ1 A;  2VVN A;  1MK8 A;  3R84 B;  2JJ9 A;  4JQJ A;  4CI1 B;  4U33 A;  2W0G A;  4TWD A;  5L4E A;  1V9D A;  2WU5 A;  2L3L A;  3P7I A;  3CIR A;  4GYR A;  1CCL A;  2XAQ B;  2JMX A;  4GOU A;  5SYV A;  5LBM A;  2BBH A;  4ZZB A;  3IEE A;  4NFG A;  3EI0 A;  4USC A;  5AQJ B;  2XSA A;  1IZN B;  2Q9Q D;  4O2A E;  2W2U A;  3O9X A;  1CCG A;  5TAO A;  1H5J A;  3UFE A;  2PFV A;  4L5G A;  4QXC B;  2UUB T;  3X1D A;  4YY3 T;  3MK7 C;  2MTQ A;  4JMS A;  3LBX A;  2WD4 A;  4CVJ A;  3ZPO A;  4PK6 A;  4PAE A;  5LXT E;  3AA6 B;  3X16 A;  1XDO A;  1H5G A;  5JR9 B;  4ZI2 C;  3FZK B;  5H9E B;  3OYZ A;  4K0K T;  3RKG A;  2BOQ A;  4AQY T;  3TLV A;  1WLX A;  4IE6 A;  3M2A A;  4NVE A;  3P4Q A;  3UQ4 A;  3VLK A;  4OFZ A;  4DVD A;  4P4Q A;  4DR3 T;  1JNR A;  4JN0 A;  4O4H E;  1B85 A;  2XJ5 A;  4BM3 A;  3RI5 A;  3DTO A;  5EK3 A;  4QXH B;  5A1L A;  4EYY R;  3L8R A;  2VKA A;  4B3T T;  2MPK A;  2DWG A;  4UVC B;  2CHO A;  5LMU T;  2MOZ A;  2NOX A;  4JM9 A;  4DO0 A;  5SX0 A;  2YDQ A;  3M2F A;  4EGW A;  1FIO A;  2XAG B;  5JDM A;  1MND A;  3OBV E;  3RYC E;  2X08 A;  4UR9 A;  3WA8 A;  1MMA A;  2BVM A;  4QX8 B;  5ADX L;  2IHR 1;  2BG9 B;  3ZYL A;  2UXD T;  1KFY A;  1AJ3 A;  2CMR A;  3ZMV B;  1ARY A;  1OWA A;  2CXD A;  2NTX A;  3M2G A;  1ZBY A;  2LSI A;  2PJQ A;  4TV8 E;  5KQK A;  3FBL A;  3AEG A;  4ZS2 A;  4NVJ B;  4HGA A;  4UVB B;  3PUY F;  4PFO A;  2B0Z A;  2MYS A;  1MIY A;  5SX1 A;  1LYK A;  2DI4 A;  5IHY A;  5LNK A;  2GHC X;  3CML A;  3CCP A;  1HFA A;  4CCX A;  3H3A A;  4LF6 T;  2UXC T;  2PCB A;  1WRD A;  5L4H A;  2CCQ A;  1FEW A;  2H7V C;  2XAJ B;  3VRA A;  2KWH A;  1S35 A;  2A2F X;  4NVH B;  4YXD A;  5LHI B;  4UF0 A;  4JBW F;  2X0Y A;  4CXW A;  1M7K A;  3ETU A;  1SA0 E;  3RRC A;  3N5L A;  2XQ6 A;  2VKH A;  2WDQ A;  3BQI A;  2V2E A;  3J7Y q;  4U2Z A;  3N9Q A;  3B13 A;  2D5U A;  3ZC0 A;  3AB3 B;  4UV9 B;  4ASK A;  3WXO A;  2KMF A;  3C50 A;  4JM8 A;  3CPZ A;  2UXB T;  4O4J E;  4KMC A;  1H5E A;  4UEL A;  2V5C A;  3AE4 A;  3ZT5 A;  1A2F A;  2JIW A;  4X64 T;  4LFC T;  2CA5 A;  3ZC1 A;  1IAP A;  1XWM A;  1Y01 A;  4ADZ A;  1T72 A;  5CCP A;  3TLU A;  3FB2 A;  5EJX A;  3UU6 A;  2LLY A;  3M65 A;  3JC6 C;  2AS4 A;  2Y6A A;  2LM2 A;  5IWA T;  3LDQ B;  1LY9 A;  4JI3 T;  4JYA T;  2ZM6 T;  2ES0 A;  1UUR A;  3T1Y T;  3EXB A;  5SXR A;  3I0O A;  5JTG A;  3GWH A;  1DU2 A;  3AA1 B;  1HNZ T;  1AES A;  1W9R A;  2Z6E A;  1QSD A;  1ATJ A;  4AQF C;  4DV7 T;  5DQW A;  2XAF B;  1SCH A;  4BLN A;  4GK0 E;  2FBW A;  1BR4 A;  4ILB A;  3LG7 A;  4A7M A;  3ZCG A;  1B80 A;  3LJC A;  3AE2 A;  2M6B A;  3NKZ A;  4NVA A;  3HKD E;  3PUX F;  3C4Z A;  2AS1 A;  4IT4 A;  1W0A A;  3RIW A;  3V5U A;  5ABH A;  4BA9 A;  4JZA A;  4DMV A;  1H5K A;  4CZO A;  5LP6 E;  2JQK A;  5KDM C;  2JMK A;  1CPG A;  3A5X A;  3Q5X A;  2JPF A;  3VLH A;  4YSZ A;  4ZI7 E;  3ZT6 A;  4CI2 B;  3K3O A;  4X66 T;  2UUA T;  1H5H A;  1BEJ A;  3U78 A;  1HTJ F;  1D1A A;  4NVO B;  3RHW A;  2AS6 A;  2W63 A;  4QWN B;  1CCP A;  4JI0 T;  1W4Y A;  1KK7 A;  5AQM B;  2VO2 X;  2XIH A;  2VKO A;  3HKC E;  4JI7 T;  3RX6 A;  4JQK A;  2LHN A;  2XQ4 A;  3JAF A;  2LSK A;  3O4X E;  4LMK A;  3C4W A;  3B5M A;  3AE7 A;  4P1N A;  2X0H A;  5HXE A;  3TLS A;  5SX3 A;  1MIW A;  7CCP A;  3ZYK A;  5SW6 A;  5HEH A;  5SXQ A;  4WZX A;  2LSY A;  4HE8 A;  1GZB A;  2V6X A;  1NEN A;  2Q9Q B;  3RQW A;  3AAA B;  7ATJ A;  4EOZ B;  2C0S A;  3Q3U A;  4HWI B;  4JPT A;  5HEU A;  1CCA A;  5KQ6 A;  4FCN A;  2W67 A;  5CA0 E;  2BS2 A;  3I9W A;  4PJL A;  2YU1 A;  4QKN A;  3VU7 H;  3WI3 A;  1V0H X;  1GWT A;  1Z0P A;  5LBQ B;  4IE4 A;  5JDF A;  1ITK A;  4H9R C;  5E0O A;  1FHF A;  2ZM2 A;  4MLK A;  3VLL A;  5AQT B;  3UQ7 A;  4HEA A;  2EUN A;  3M28 A;  1H58 A;  3FZH B;  1JCI A;  2E3B A;  3QC9 A;  2GHH X;  4CXX A;  5AQO B;  1FJG T;  3FKG A;  1BEM A;  2LOS A;  4JI1 T;  5FKY A;  5HEG A;  2V8S V;  3L3P A;  4IDZ A;  5JVD E;  2VNZ X;  4YTN A;  5CIH A;  2N18 A;  4JPU A;  3TKL B;  3PDY A;  4GKF A;  3AEB A;  3UUM A;  5KQ0 A;  4ZS3 A;  5FL0 A;  4U31 A;  2DHR A;  4I55 E;  4NVM B;  2Y6X A;  3F31 A;  3O1J A;  3CQG B;  5SXW A;  2J4G A;  4NVN B;  1U2K A;  3L09 A;  1OXZ A;  1H5L A;  1LLP A;  4HKA A;  4BAY B;  1D1C A;  1D1B A;  3CX8 B;  4A5X A;  1MN2 A;  3UUB A;  3AAI A;  5FP3 A;  3EVY A;  1CPF A;  3I0Q A;  4HFI A;  5FNV E;  1B82 A;  1AEJ A;  5ABN A;  3H3M A;  4GKK T;  4EEB A;  2DCF A;  3AA7 B;  1N32 T;  3UU5 A;  5CD4 J;  1SOG A;  2RC1 X;  4ZZC A;  1WR6 A;  4PNI A;  1E2A A;  4K0U A;  4OYJ A;  5SYJ A;  4BM1 A;  4LF9 T;  5AQV B;  2LOP A;  4CZP A;  4JV5 T;  4AKH A;  3VR8 A;  1E1H B;  4A98 A;  1CMT A;  4UIG A;  1U4Q A;  3M26 A;  4A71 A;  3EDU A;  2ACZ A;  2B10 A;  4IDP A;  2WDR A;  1SJ2 A;  4DV4 T;  3AAE B;  2WB5 A;  2RBZ X;  3LBX B;  3RF1 A;  1XMQ T;  3NZP A;  1CCC A;  4YTP A;  4H63 V;  3J9X 1;  4HWF A;  2XY8 B;  1NWM X;  3JCF A;  4JMV A;  1BES A;  1AEK A;  1CYF A;  3E2N A;  2YDS A;  3BK9 A;  1AEO A;  5LB7 B;  4X65 T;  2LSG A;  3M25 A;  5SXS A;  4MHC A;  3R99 A;  1ZOY A;  3F57 A;  5KQ3 A;  1YKE B;  5HXC A;  5LCY A;  1W09 A;  5LMN T;  2JTI A;  1HSR A;  2E9X B;  2XQ8 A;  5L47 A;  5CIG A;  4H79 A;  1PA2 A;  3N9O A;  3UTK A;  2WY2 A;  5EJT A;  4A5G A;  3P4R A;  3M2C A;  1QLB A;  3HR0 A;  4LFA T;  4JEU B;  4TZ4 C;  2A7U B;  1AEB A;  1H5I A;  1CCI A;  5JDH A;  2W66 A;  5AQU B;  1O3X A;  4LF7 T;  3FJW A;  4BLY A;  1UX4 A;  4LFB T;  2ZM0 A;  2GK9 A;  1CCK A;  2WAU A;  3LFM A;  2KZ7 B;  4FCS A;  2E3A A;  4IL9 A;  2WSS S;  4XV8 A;  4OK0 A;  4AKR B;  5CIB A;  1ARX A;  1MMN A;  2WU2 A;  1S73 A;  2QVA A;  3CX6 B;  2SPC A;  2XJ6 A;  2X66 A;  4QX7 B;  2C5I T;  2CWY A;  4CVI A;  1HX8 A;  2FJA A;  5AQG B;  4LF8 T;  3TLT A;  1X9B A;  1BR1 A;  3CQC B;  5SYU A;  1AA4 A;  3LK3 B;  3RC3 A;  4B6X A;  2XQ7 A;  5CJ5 A;  5JH7 E;  2CCD A;  4HFH A;  1CPE A;  2BKP A;  1CPD A;  5KQH A;  3KBU A;  1CCE A;  3M23 A;  3JAE A;  3PU3 A;  2RBW X;  4U3C A;  4AKI A;  5LJN A;  4YT0 A;  4I43 B;  5EK4 A;  2WWV A;  5JRC A;  1ARU A;  2CLY C;  3A8Y C;  5HXR A;  1KXN A;  4IDO A;  1YQ3 A;  2A3D A;  2CCA A;  2ACX A;  1OED C;  2N2N A;  4BM4 A;  2Q9Q A;  2BS3 A;  2EUO A;  2ZLY A;  2W61 A;  2ZMA A;  2ZCA A;  4WYV A;  5ABQ A;  1SUM B;  1BR0 A;  4V1A v;  2BS4 A;  2CRB A;  2VKD A;  4G63 A;  1ZKE A;  4C90 A;  3AE5 A;  5AQN B;  3UUL A;  1B7T A;  4JM5 A;  4JI2 T;  2UU9 T;  4U7Y A;  4PK4 A;  2VUR A;  4PAG A;  3FXD B;  5SW5 A;  2IIU A;  4E7Z A;  2Y6B A;  5FYM A;  5FNE A;  2YK0 A;  2BBJ A;  2GHK X;  4DBQ A;  4XV4 A;  1YKH B;  1L0V A;  5SXX A;  1DJ5 A;  1GWU A;  5HEO A;  5SYH A;  4COF A;  2G0U A;  1VCS A;  1AC8 A;  3UT2 A;  1KEY A;  3FBZ A;  2W00 A;  3ZCY A;  2XM1 A;  4ANJ A;  4IST A;  3ZYM A;  4JI5 T;  3SOL A;  2CYP A;  3PE0 A;  5KQ2 A;  4DV0 T;  4X1I E;  3Q2M A;  5DJQ C;  4P09 A;  3VLI A;  5KX5 E;  4DUZ T;  2X9Y A;  2YEV C;  2PG8 A;  2M67 A;  1ZEE A;  4WBO A;  4XV7 A;  4N78 D;  3GN5 A;  3EUH A;  3ZMZ B;  1KNZ A;  2NP9 A;  3AEA A;  6CCP A;  4NVL A;  2DLR A;  4PJN A;  4DND A;  2BKO A;  5CGM A;  4KX6 A;  4B3M T;  3MXZ A;  1MKR A;  1CHU A;  4X20 E;  2QA7 A;  2ATJ A;  1EZ3 A;  5GON E;  3AE3 A;  3P4W A;  4JMW A;  3FZM B;  1H57 A;  1GQE A;  3PUV F;  2B76 A;  5H6R B;  3VKH A;  5EZY E;  1APX A;  3AED A;  2XQA A;  2ZM8 A;  3C4X A;  4DR7 T;  2VCS A;  2CEA A;  4UV8 B;  1YYD A;  4X62 T;  4DV5 T;  3TLW A;  1MN1 A;  2Y5A A;  1HNW T;  3ONJ A;  3RC8 A;  4QYZ B;  4CN6 A;  2I6H A;  2XAS B;  5HCJ A;  1LGA A;  3GMI A;  4YJ2 E;  4CQI A;  5JHY A;  4YJ3 E;  3SFE A;  5FVL A;  5CIE A;  5F8P A;  2XHE B;  1HCH A;  2ANZ A;  2XIF A;  1LRZ A;  4ILC A;  3Q9D A;  2BO5 A;  1DS4 A;  3HKB E;  5LGT B;  1H55 A;  2B12 A;  5L3D B;  4LML A;  2MAW A;  1U2J A;  5CA1 E;  4P0A A;  2K24 A;  1LY8 A;  4JQN A;  5AFU L; 
#chains in the Genus database with same CATH homology
 2KWI B;  1GZA A;  1ARV A;  3M5Q A;  3Q3U A;  5CIF A;  4JPT A;  5IYZ E;  2X9W A;  4NVG B;  1CCA A;  2YU2 A;  3W15 B;  4CXY A;  4JPL A;  5KQ6 A;  3I9Y A;  2A72 A;  4FCN A;  5JDG A;  2VWA A;  3FM6 A;  3ZLI A;  5CA0 E;  4I50 E;  1S94 A;  1Y64 B;  3O1I A;  5KSF A;  2BVL A;  4X1Y E;  3I9W A;  3LK2 B;  5HXS A;  3UT5 E;  5SX6 A;  3CKD A;  1WYB A;  2WBL A;  4PJL A;  5HXH A;  2DWK A;  2YU1 A;  4QKN A;  4IGU A;  3VU7 H;  1AET A;  3WI3 A;  4XZC A;  1V0H X;  1GWT A;  1D0Y A;  3O1H A;  4KP3 C;  4X1K E;  2UXX B;  4O8S A;  2VCN A;  1Z0P A;  3ZCI A;  3NRY A;  4IE5 A;  5LBQ B;  4WBN E;  4KUM B;  4CZZ B;  5JDQ A;  1H3J A;  1FMW A;  4IE4 A;  1HF8 A;  1LVF A;  2XQY A;  4TUY E;  5JDF A;  1ITK A;  3RIV A;  1H7C A;  4IIJ E;  2BDE A;  5LA6 E;  1IJ6 A;  3OYX A;  5JQG E;  4YHJ A;  1U75 A;  1W4W A;  2KXP B;  4FI5 A;  4H9R C;  4TX5 A;  4YFS A;  3M27 A;  1G8X A;  1BVA A;  3PTR B;  1BEK A;  1FHF A;  5E0O A;  2VNX X;  2ZM2 A;  4MLK A;  3VLL A;  3IHR A;  2UXN B;  5FXX A;  5SW4 A;  1AEE A;  4HEA A;  2EUN A;  3M28 A;  2IAK A;  2EUU A;  2PBI A;  1H58 A;  4HN9 A;  4H9S E;  1JCI A;  2VAS A;  2E3B A;  4PW8 A;  1C8I A;  5AMM A;  4MBQ A;  1FMV A;  2RC0 X;  3QC9 A;  2GHH X;  1MMD A;  4XAX B;  4CXX A;  2V7K A;  4JLE A;  3PUR A;  2V7J A;  1BGP A;  4PK5 A;  2V7I A;  3PUG A;  4BM2 A;  4A6Z A;  3K8P C;  3N2G E;  2XIL A;  3FKG A;  3GA8 A;  3SRZ A;  4DBR A;  1BEM A;  1UB2 A;  5SYL A;  2LOS A;  3WAK A;  4BM0 A;  5FNB A;  3ZMT B;  4JMT A;  3L3P A;  5L3F B;  2WM9 A;  1CCJ A;  4IDZ A;  2X68 A;  1SBM A;  2H7O A;  2IC6 A;  4GK5 E;  5ETW A;  3ZEF B;  3KVA A;  5JVD E;  2VNZ X;  2CL4 X;  3QK6 A;  3DP7 A;  5CIH A;  2YCG A;  2KLQ A;  2N18 A;  4JPU A;  3PUQ A;  2XUE A;  3TKL B;  3ZN0 B;  1AEN A;  5H9F B;  3NBX X;  3PDY A;  2YLJ A;  1GWO A;  4Z8X A;  3UUM A;  5F3J A;  4CZR A;  5LHH B;  4YLH A;  5KQ0 A;  1Z53 A;  5CID A;  3MJX A;  2ODV A;  4ZS3 A;  4BLL A;  5JR9 A;  3FXE B;  2HPL A;  1KOK A;  4C50 A;  1OAG A;  2KND A;  2DHR A;  1AEG A;  1QGJ A;  4XVA A;  3I1A A;  4I55 E;  1OAF A;  4NVM B;  2Y6X A;  3F31 A;  3NZQ A;  4ZI3 D;  4NVB A;  5FY7 A;  3BQK A;  2RBU X;  3NRX A;  2NWB A;  3CQG B;  3O1J A;  3RYF E;  5SXW A;  2C5K T;  4NVN B;  4E7S A;  4NVD A;  1U2K A;  3AVR A;  4CZQ A;  3L09 A;  3M2H A;  1AEU A;  1CCB A;  1H5L A;  1LLP A;  5ALA A;  1OXZ A;  4HKA A;  3HA4 A;  4BAY B;  1D1C A;  3H37 A;  5BMV E;  1D1B A;  1DJ1 A;  1U2L A;  3CX8 B;  2MBG A;  1MN2 A;  5FY0 A;  1GW2 A;  1MK8 A;  3R84 B;  3AAI A;  1HG5 A;  4JQJ A;  2JJ9 A;  3EVY A;  3QUJ A;  1CPF A;  1LVK A;  3I0Q A;  5FP3 A;  4CI1 B;  2D0U A;  2W0G A;  4XBF B;  4H9O C;  1V9D A;  5FNV E;  5JPR A;  1B82 A;  3E22 E;  1AEJ A;  1DSO A;  2L3L A;  5ABN A;  3P7I A;  5JDN A;  4GYR A;  1CCL A;  3IBP A;  3K3N A;  2RP4 A;  1G73 A;  2XAQ B;  3HDL A;  1HCI A;  4GOU A;  3WAJ A;  5SYV A;  5LBM A;  3IEE A;  2IA8 A;  5SX0 B;  4NFG A;  2DCF A;  3AA7 B;  4EYU A;  5HWX A;  5JR9 C;  4F6R C;  2X0L B;  4USC A;  1IZN B;  1MMG A;  1X79 A;  5J2T E;  5HAX A;  2Q9Q D;  5CD4 J;  1SOG A;  3FM1 A;  4G2A A;  5L3G B;  2RC1 X;  3CQX C;  2HH7 A;  5SYW A;  4BJN A;  1H5C A;  2K5B B;  4O2A E;  3O9X A;  1CCG A;  4GED A;  1WR6 A;  4AQG A;  4PNI A;  5HYA A;  5TAO A;  1H5J A;  1QUU A;  4OQ7 A;  3UFE A;  4K0U A;  2PFV A;  4L5G A;  4OYJ A;  2CM0 A;  2D0T A;  4QXC B;  5SYJ A;  4BM1 A;  4JB4 A;  1YZP A;  4P0B A;  3ZJ1 A;  2LOP A;  4CZP A;  1AC4 A;  4AKH A;  3WNU A;  1E1H B;  3M29 A;  3OKQ A;  4G05 A;  1CMT A;  4UIG A;  1U4Q A;  3ANW A;  1SDQ A;  4OHF A;  3MK7 C;  4ZI2 D;  1YYG A;  3M26 A;  4A71 A;  2MTQ A;  4JMS A;  3EDU A;  3LBX A;  2WD4 A;  5SYX A;  2B10 A;  4CVJ A;  1RYC A;  5CB4 E;  3ZPO A;  3UUN A;  2WSS V;  4PK6 A;  5JRE A;  4PAE A;  4TV9 E;  5LXT E;  2ODU A;  3AA6 B;  3X16 A;  4AKL A;  5JRC A;  2K9A A;  1QO4 A;  1SJ2 A;  2LEH A;  2WWU A;  3AAE B;  1H5G A;  5JR9 B;  2EUS A;  2RBZ X;  3KIN B;  4ZI2 C;  2V1D B;  3LBX B;  5J2U E;  5H9E B;  1BR2 A;  4MFR A;  4NVF A;  1CCC A;  5SX2 A;  2EHO D;  2CE7 A;  3NZP A;  3OYZ A;  4H63 V;  2BOQ A;  3J9X 1;  2NTY A;  2V7M A;  1MIV A;  3M2I A;  1NWM X;  5LG4 A;  4JMV A;  1WLX A;  2PCC A;  4IE6 A;  3M2A A;  4EZH A;  2YIN A;  4NVE A;  4O4I E;  1H5F A;  3FMU A;  1BES A;  3VLK A;  1A2G A;  2XJ8 A;  2D2S A;  4OFZ A;  4DVD A;  4P4Q A;  3T8O A;  1AEK A;  4FEF A;  3HL6 A;  1CYF A;  3E2N A;  4JN0 A;  3ANW B;  3S4U A;  3BK9 A;  3IF8 B;  4O4H E;  1AEO A;  1B85 A;  4QXB B;  2LSG A;  2XJ5 A;  4BM3 A;  1ZBZ A;  1CUN A;  3M25 A;  5SXS A;  2VB6 A;  3R99 A;  3CWZ B;  4MHC A;  3F57 A;  3RPU A;  2N9D A;  3DTO A;  5EK3 A;  4QXH B;  3MAC A;  5A1L A;  2I59 A;  4EYY R;  5KQ3 A;  4M1P A;  2VKA A;  2ICV A;  1VRB A;  1VOM A;  1YKE B;  2DWG A;  4UVC B;  5HXC A;  5LCY A;  2MOZ A;  2VKJ A;  1LYC A;  2NOX A;  3FM4 A;  4JM9 A;  4DO0 A;  5SX0 A;  5L02 A;  2JTI A;  3M2F A;  2IW5 B;  3N9L A;  1HSR A;  3M8M A;  3R98 A;  5JQR A;  1S6V A;  2E9X B;  4CZN A;  2J1D G;  4WNK A;  2EHO C;  2RC2 X;  4A56 A;  1FIO A;  1US7 B;  2XAG B;  5JDM A;  1MND A;  1EBE A;  3KVB A;  3OBV E;  2EUR A;  2X08 A;  3RYC E;  3AVS A;  2L9Q A;  5L2L A;  2W23 A;  2WMO A;  1AEQ A;  3WA8 A;  1MMA A;  2BVM A;  4JMA A;  5CIG A;  4QX8 B;  5ADX L;  3E08 A;  4H79 A;  1PA2 A;  3V5S A;  3ZYL A;  3ZN1 B;  4GIW A;  4BLZ A;  2X9H A;  3N9O A;  3UTK A;  2CMR A;  1AJ3 A;  5HWY A;  5EJT A;  4A5G A;  3CCX A;  1CK6 A;  3N2K E;  1ARY A;  3M2C A;  1MNE A;  5FXZ A;  4A78 A;  2JMH A;  3ZMV B;  1DSG A;  1KRJ A;  2CCP A;  1OWA A;  3HR0 A;  4JEU B;  5SYK A;  2CXD A;  2NTX A;  1AEB A;  3M2G A;  2IC9 A;  1H5I A;  2JQQ A;  1ZBY A;  2LSI A;  4TZ4 C;  2WMN A;  2PJQ A;  1CCI A;  4H9P C;  5KQK A;  4TV8 E;  2EUT A;  2BCN A;  5ABO A;  2DNX A;  3FBL A;  5JDH A;  1O3X A;  2AQD A;  2CWO A;  3ZCJ A;  3FJW A;  1H5D A;  4NVJ B;  4ZS2 A;  5J1G A;  4EAH A;  4BLY A;  1UX4 A;  5SXT A;  2ZM0 A;  3ETV A;  4HGA A;  4UVB B;  3KBT A;  5FY1 A;  4EB6 E;  4PFO A;  2GK9 A;  1CCK A;  2WAU A;  2B0Z A;  2MYS A;  3LFM A;  1KXM A;  1MIY A;  2KZ7 B;  3GN5 B;  4FCS A;  2KT9 A;  5SX1 A;  4ISS A;  1LYK A;  2DI4 A;  2E3A A;  5IHY A;  2W62 A;  2GHC X;  3VHL A;  5JHX A;  3MKD A;  5LNK A;  2X9X A;  3N9P A;  3CML A;  3CCP A;  1HFA A;  4CCX A;  2LHR A;  3H3A A;  4XV8 A;  2GGN X;  3KV5 A;  1BJ9 A;  2PCB A;  3RYI E;  4OK0 A;  3ZMU B;  1WRD A;  5SX7 A;  2CCQ A;  3LK4 2;  4AKR B;  5SYY A;  1U74 A;  5CIB A;  2AS3 A;  1ARX A;  2AS2 A;  3VLJ A;  1FEW A;  1MMN A;  2E8I A;  2H7V C;  5KSK A;  1S73 A;  2CEP A;  4XV6 A;  2KWH A;  2XAJ B;  4UVA B;  5C8Y E;  3PUS A;  3CX6 B;  1ML2 A;  1S35 A;  1YD8 G;  2XJ6 A;  5AL9 A;  2A2F X;  2P9B A;  2SPC A;  3ESL A;  4NVH B;  2X66 A;  5LHI B;  4BLK A;  2C5I T;  2CWY A;  4QX7 B;  4CVI A;  1HX8 A;  4UF0 A;  5FMN A;  4CXW A;  1BR1 A;  3CQC B;  5SYU A;  5JHZ A;  2Q9Q C;  3ETU A;  3N2O A;  1SA0 E;  1HS7 A;  1ARP A;  1AA4 A;  1AEF A;  2GB8 A;  2GHE X;  3PUA A;  3RRC A;  3LK3 B;  4JMB A;  4JUY A;  4ILU A;  4O4L E;  1KZM A;  4NVI B;  4ZI3 C;  4CUO A;  2RBT X;  2V23 A;  3RC3 A;  4B6X A;  2QGS A;  4DMW A;  3N5L A;  4FDQ A;  4KBM B;  3PU8 A;  2XTL A;  4AQF A;  5JH7 E;  2CCD A;  1WYC A;  4IE7 A;  1AEM A;  2VCF X;  1CPE A;  2VKH A;  1CPD A;  5KQH A;  3KBU A;  3R6N A;  1CCE A;  5CJH A;  3M23 A;  1LKX A;  4BJM A;  3PU3 A;  3BQI A;  1ZV4 X;  2V2E A;  2RBW X;  3RH3 A;  4XV5 A;  2N1G A;  3RYH E;  3J7Y q;  3N9Q A;  2L8K A;  3B13 A;  4JEH B;  4AKI A;  3C51 A;  2D5U A;  4U72 A;  2X07 A;  5LJN A;  4NVK B;  3D0T A;  3AB3 B;  4I43 B;  3OJA A;  4UV9 B;  5EK4 A;  1AEV A;  2CXF A;  4ASK A;  3WXO A;  4EXT A;  1ARU A;  2CLY C;  2KMF A;  3C50 A;  3FHN A;  4JM8 A;  1KXN A;  2V7L A;  5FXV A;  1T98 A;  5HXR A;  3CPZ A;  4O4J E;  4KMC A;  1H5E A;  2CCA A;  2A3D A;  3M2E A;  1DSE A;  2ACX A;  2N2N A;  4BM4 A;  2Q9Q A;  2EUO A;  2ZLY A;  2W61 A;  2ZMA A;  2XI6 A;  4UEL A;  4BLX A;  1MKQ A;  1IJ5 A;  1BEQ A;  2ZCA A;  4EIW A;  3EDV A;  2EHO B;  5ABQ A;  3Q5W A;  1A2F A;  3C64 A;  3KV6 A;  5L3E B;  2CA5 A;  4L0R A;  3ZC1 A;  4V1A v;  5CIC A;  1BR0 A;  1IAP A;  2VKD A;  3SS1 A;  4G63 A;  4HFV A;  4JQM A;  1ZKE A;  4PJM A;  4C90 A;  2YEV C;  4FJO A;  1H5A A;  3ZCH A;  3UUL A;  1SHZ C;  1B7T A;  4ADZ A;  4CCP A;  5CCP A;  2CLY B;  2H3R A;  3FB2 A;  4JM5 A;  2RBX X;  5D6M A;  5EJX A;  4C51 A;  3C98 B;  3M65 A;  2Y8D A;  3JC6 C;  3KV4 A;  2EUQ A;  4PK4 A;  2AS4 A;  2Y6A A;  4PAG A;  3M2B A;  1UX5 A;  5SW5 A;  1LY9 A;  3FXD B;  4E7Z A;  1ARW A;  2RBY X;  2Y6B A;  2ES0 A;  4H9N C;  3KDS E;  1CMP A;  3EXB A;  5SXR A;  3UW8 A;  5FNE A;  5KQI A;  5L86 A;  2YK0 A;  3GWH A;  3I0O A;  5FYM A;  5H6Q B;  5LYJ E;  1GX2 A;  3AA1 B;  2GHK X;  3RRW A;  4DBQ A;  1AES A;  4NVC A;  4XV4 A;  1YKH B;  5EK2 A;  2Z6E A;  5SXX A;  1ATJ A;  1HG2 A;  1QSD A;  1DJ5 A;  4AQF C;  1GWU A;  2C5J A;  4WW0 A;  5DQW A;  3CVR A;  3B57 A;  5SYH A;  2XAF B;  2G0U A;  2X67 A;  1AC8 A;  2B11 A;  1SCH A;  3UT2 A;  4BLN A;  2NW8 A;  4CI3 B;  4PJJ A;  4GK0 E;  5L3C B;  1D0X A;  1NAF A;  3ZCY A;  2W00 A;  3AA0 B;  3FBZ A;  4UF0 B;  1BR4 A;  3F2E A;  3HKE E;  4ANJ A;  5SYI A;  2KIN B;  1U5P A;  1QPA A;  4IST A;  3LG7 A;  2NW7 A;  4A7M A;  2Y48 B;  3ZCG A;  3ZYM A;  4L9I A;  1B80 A;  2CYP A;  3PE0 A;  3VLM A;  3LJC A;  5KQ2 A;  4UXN B;  3SOL A;  1AEH A;  1BEP A;  5L3B B;  2K48 A;  1CMQ A;  1DSP A;  4NVA A;  3E2O A;  5L05 A;  2LSJ A;  3K3Q C;  3HKD E;  1MNP A;  3Q2M A;  4P09 A;  4X1I E;  5DJQ C;  3VLI A;  5LOV E;  3C4Z A;  1UCU A;  3DJB A;  2AS1 A;  5KX5 E;  2X9Y A;  4PFP A;  2VK9 A;  2PG8 A;  5AOG A;  1AED A;  2B1E A;  2RA1 A;  2M67 A;  1ZEE A;  2VL8 A;  1DCC A;  2EHO A;  3RIW A;  4NUU A;  5JDL A;  3N9N A;  4WBO A;  3V5U A;  4ZHQ E;  4XV7 A;  4N78 D;  3GN5 A;  3EUH A;  3ZMZ B;  1KNZ A;  4BA9 A;  2NP9 A;  1JDR A;  2GHD X;  4JZA A;  6CCP A;  2LT3 A;  3RKO A;  4NVL A;  2DLR A;  4PJN A;  4AXP A;  4DND A;  2E9X D;  4DMV A;  1IYN A;  3ZJ2 A;  1H5K A;  2X51 A;  3CX7 B;  2NW9 A;  4CZO A;  3MXZ A;  5LP6 E;  1MKR A;  1H5M A;  3ONX A;  4X20 E;  2QA7 A;  5LGN B;  2ATJ A;  1EZ3 A;  4I4T E;  4QHO A;  5KDM C;  2JMK A;  1CPG A;  3A5X A;  3Q5X A;  4H63 H;  4OYK A;  4IE0 A;  5GON E;  5JRC B;  5DQV A;  2JPF A;  4JMZ A;  3VLH A;  4U74 A;  2XAH B;  4H9Q C;  2V26 A;  5FXW A;  3M2D A;  4JMW A;  2OA5 A;  4ZI7 E;  4CI2 B;  2JRK A;  3K3O A;  3KFW X;  2EUP A;  1H57 A;  4GYS A;  4J2C A;  3MZK B;  3U3I A;  4ERR A;  5LGU B;  2E39 A;  5DAB A;  5H6R B;  3VKH A;  1H5H A;  1BEJ A;  5EZY E;  3VKG A;  1APX A;  3U78 A;  1HTJ F;  1D1A A;  2ZM8 A;  3C4X A;  3ZC0 A;  3E0Z A;  3UUX B;  2BZB A;  4NVO B;  2AS6 A;  2VCS A;  2W63 A;  4QWN B;  1CCP A;  1STQ A;  2CEA A;  2LJL A;  3P8C D;  4NUV A;  1W4Y A;  1YYD A;  4UV8 B;  2RBV X;  1KK7 A;  3KV9 A;  1MN1 A;  2VO2 X;  2Y5A A;  4EZ4 A;  4H7A A;  3MA9 A;  5KMG P;  2XIH A;  3RC8 A;  4QYZ B;  4O2B E;  3SWH A;  2VKO A;  4ATJ A;  3HKC E;  4U7U B;  1YW0 A;  2E9X A;  1LGA A;  2XAS B;  3GMI A;  4JQK A;  3RX6 A;  4C91 A;  2LHN A;  3JC6 D;  4CQI A;  5JHY A;  4YJ3 E;  2E9X C;  4YJ2 E;  1ZHC A;  2LSK A;  3BQL A;  3O4X E;  3C4W A;  4AKG A;  3ATJ A;  5CIE A;  2CXL A;  4EOZ B;  5F8P A;  2XHE B;  4IHJ E;  4MAL A;  1YZR A;  3ZMS B;  5HXE A;  5LHG B;  5SX3 A;  1D0Z A;  4UEM A;  4TN7 B;  2LE8 A;  1HCH A;  1MIW A;  2HPJ A;  5M4Y A;  7CCP A;  2ANZ A;  4HTE A;  2XIF A;  3ZYK A;  6ATJ A;  3N9M A;  1LRZ A;  3Q9D A;  2LM9 A;  5SW6 A;  5SXQ A;  1DS4 A;  3HKB E;  2LSY A;  4HE8 A;  5LGT B;  1GZB A;  5LJM A;  1H55 A;  2B12 A;  3HI2 A;  5L3D B;  1CMU A;  4JM6 A;  4ZOL E;  1U2J A;  5CA1 E;  2Q9Q B;  4P0A A;  2K24 A;  4AI6 A;  3AAA B;  7ATJ A;  1LY8 A;  2C0S A;  4JQN A;  5AFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...