3RRWA

Crystal structure of the tl29 protein from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
LNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Thylakoid lumenal 29 kDa protein, chloroplastic
publication title Crystal structure of the TL29 protein from Arabidopsis thaliana: An APX homolog without peroxidase activity.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 3rrwA01
1.20.58.1620 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rrwA02
1B80A 1GZAA 4CUOA 4BM3A 3R98A 2AS6A 2Y6AA 5SX3A 4A5GA 1CPGA 2EUSA 1DCCA 2RBTX 1H3JA 5KQHA 2EURA 4CZNA 1LYKA 2GHHX 3M2CA 1AENA 1W4YA 2XIFA 1BEMA 1CMPA 1ARPA 5KQIA 1ARUA 1AETA 5SW4A 4P4QA 1S73A 1AEFA 4NVNB 2GHDX 1S6VA 1APXA 4BM4A 1DJ1A 7CCPA 2B11A 1AEHA 2BOQA 5CIGA 5CCPA 1LGAA 1QGJA 4JMZA 4A7MA 5KSFA 2AS1A 1MKQA 5CIEA 4FEFA 5SYYA 4NFGA 5SW5A 4PAEA 5SYUA 1ARVA 2ANZA 5AOGA 5SYVA 2CCPA 5JHZA 1AEQA 4NVLA 1KXMA 2VCSA 5SXSA 1CK6A 1IYNA 4NVFA 1H5JA 2RBXX 2YCGA 6ATJA 4FCSA 5SYHA 1AEDA 4JMVA 4C50A 1GW2A 3M23A 3M2HA 1DSOA 4CZQA 1AEGA 2B12A 4JQKA 2GHCX 4BM0A 1H55A 2GB8A 1H5KA 4BLNA 4XVAA 2XJ5A 1BEJA 3FM4A 5SX0A 4NVOB 1H5CA 1CCJA 5L02A 1H5EA 5CIBA 5ABNA 4BM2A 3ZCYA 4JMAA 1AEEA 1PA2A 4CCPA 3FJWA 5L86A 2E3AA 2CCDA 3VLLA 1CCKA 5SXQA 1SCHA 1AEUA 3HDLA 1AEKA 1GX2A 1CCLA 1FHFA 6CCPA 2GHKX 2EUOA 5FNBA 1CCBA 1Z53A 3CCXA 1ARXA 2WD4A 5KQ0A 3M25A 2BCNA 4BLZA 4JM6A 1SBMA 1CMTA 4NVEA 1DSEA 1A2FA 2EUTA 3VLIA 3M2BA 4NVBA 5CJHA 4JPTA 4XV7A 4NVCA 5SW6A 2VCNA 5SYXA 5CIDA 1ATJA 1BGPA 1H5DA 1JDRA 1KOKA 2N18A 2RC1X 2VKAA 4FDQA 4C51A 2VNZX 1KRJA 1CCEA 1JCIA 1MK8A 3M2GA 3M2IA 1U2KA 2ATJA 2CL4X 4NVHB 2EUPA 3EXBA 1CMUA 4NVIB 1GWUA 2XIHA 2VNXX 1C8IA 2B0ZA 4OQ7A 2GGNX 4BLYA 2XJ6A 3E2NA 1GWTA 4GEDA 1AESA 2AS2A 1ML2A 1CYFA 3FMUA 5KQ6A 4A6ZA 5SXRA 5SYWA 3WNUA 5L05A 1BESA 3E2OA 2E39A 1CCAA 3VLKA 1MN2A 5SYJA 5SX0B 4JQNA 2JTIA 1H57A 5CIFA 1DS4A 1AEOA 1OAFA 2CYPA 2RBZX 1MN1A 1DJ5A 1YYGA 3ZCGA 3ATJA 1CCIA 4XV4A 4NVKB 1MNPA 2VCFX 2V23A 1CCGA 2Y5AA 7ATJA 1CPDA 1AEMA 1H58A 3M2DA 4BM1A 2RBVX 4CZOA 2X07A 5SYKA 2XI6A 1YZPA 5SX1A 1H5LA 1LLPA 4JM8A 3M2EA 5FNEA 2CEPA 2E3BA 4XV6A 1BEQA 5JPRA 5CIHA 2PCBA 2AS4A 5JQRA 4NVMB 3UW8A 5KQ3A 1SOGA 3M29A 4JPUA 3VLHA 5SYLA 1V0HX 3X16A 2RBUX 1OAGA 4JMBA 1A2GA 1H5MA 1B82A 1ZBYA 4CCXA 4JMTA 5D6MA 1CMQA 2RBWX 4USCA 4NVGB 3VLMA 5JHXA 5AMMA 4BLXA 1CCPA 1AEJA 4JQJA 1AC8A 2EUQA 4A78A 4NVDA 5EJTA 1AC4A 4FCNA 1RYCA 4CVJA 5AL9A 1ARWA 4JPLA 1U74A 1DSPA 4JMWA 4JMSA 1GWOA 1KZMA 2RC0X 4XV8A 2AQDA 1DSGA 4NVAA 1H5FA 1ITKA 3M27A 1W4WA 1BEPA 5SXTA 5KQ2A 2PCCA 2ICVA 2Y6BA 2IA8A 4CZPA 2X08A 1KXNA 3M2AA 1B85A 1BEKA 2RBYX 1U2LA 1ZBZA 2EUUA 3CCPA 3RIVA 4BLLA 1SDQA 1SJ2A 3M2FA 2EUNA 1EBEA 3M28A 5SX6A 5SX2A 1MKRA 2CCAA 2AS3A 2XJ8A 3M26A 4G05A 1U2JA 2RC2X 1LY8A 5KSKA 1YZRA 4A71A 4BLKA 5SYIA 2XILA 4JM9A 1U75A 2YLJA 5EJXA 4JM5A 5SXWA 5ABOA 1HCHA 3M8MA 1YYDA 3ZCHA 1AEVA 5ALAA 1QO4A 1AA4A 4NVJB 3WXOA 4XV5A 5SX7A 3Q3UA 1BVAA 1CPEA 3RRWA 1H5HA 1HSRA 5SXXA 1CPFA 1H5GA 1LY9A 4JB4A 2W23A 2B10A 1BJ9A 3FM1A 1AEBA 4JN0A 1H5AA 2GHEX 1CCCA 3RIWA 1UB2A 3FM6A 3R99A 1H5IA 1LYCA 5KQKA 1GZBA 3VLJA 5CICA 4JQMA 4ATJA 1ARYA 3FKGA 3UT2A 5ABQA 1QPAA 2V2EA 3M5QA 5JHYA 4CVIA 4CZRA 1STQA 2VO2X
chains in the Genus database with same CATH superfamily
1B80A 4IE4A 2Q9QB 4BM3A 3R98A 2Y6AA 4UV9B 1WRDA 3T8OA 4TWDA 2JJ9A 4DUYT 4EIWA 2A72A 3L09A 5KQHA 2CXFA 2EURA 4IIJE 2A7UB 2KLQA 1LYKA 2Y48B 1MNEA 3KBTA 2XPKA 5AQVB 4TNVA 1BEMA 1CMPA 3ZN0B 3N9NA 3UQ7A 2LOPA 1ZHCA 2XAHB 1AETA 5H6QB 4CXWA 2LKHA 4UIGA 1OEDA 4ZEYA 2GHDX 2LE8A 3JCFA 4EEBA 2FJDA 3ZT5A 3NRXA 5C3JA 7CCPA 2B11A 1AEHA 2IDOB 3C50A 2BOQA 4IL4A 1HX8A 1IAPA 3PUGA 4JEUB 2WS3A 1LGAA 1QGJA 2KNDA 4KBMB 2QVAA 1M7KA 5KSFA 5TAOA 4CZZB 2AS1A 1MKQA 2E2AA 4NFGA 5SYUA 4I4TE 5LXTE 2D0UA 2ACZA 5SXSA 4X1IE 5J2TE 2NOXA 4U7UB 5JVDE 4JMVA 4UVCB 4UR9A 4CZQA 2E9XD 2B12A 3JADA 4PK6A 2GHCX 4BM0A 1H55A 1NAFA 3AE4A 3PV0F 4C90A 4DR3T 2G0UA 4MHCA 4DNDA 1VOMA 1H5CA 2FBWA 3LBXB 5CIBA 5GONE 2FJBA 4KI0F 3H37A 4HN9A 1B7TA 4DV3T 5ABHA 1D0ZA 2UXNB 2ZM8A 5AQIB 1WYCA 4A5XA 1SCHA 3GMIA 4TZ4C 3OKQA 3H3MA 5FVKA 6CCPA 1CCBA 5M4YA 2WD4A 1LVFA 2XQ7A 2KINB 3AEFA 2ZM0A 3EVYA 4IDPA 2DLRA 4JI1T 3VLIA 2CPTA 4JPTA 4XV7A 3FZKB 1JNZA 4E7SA 3EUHA 5SYXA 1ATJA 1BGPA 1JDRA 2VKAA 4BJMA 5AFUL 1JCIA 1N34T 4CN4A 3AAAB 1MK8A 3TLUA 2W0GA 5AQNB 2EUPA 1U4QA 3EXBA 1XNQT 3SFDA 2MPKA 1WR0A 2B0ZA 2YKSA 2XQ3A 3MXZA 2YDSA 4Q25A 3CX7B 3RYHE 3HR0A 4H9SE 1BR4A 2I0MA 2ODUA 4XZCA 3E2OA 2WB5A 3Q5XA 4FI5A 3EHZA 3LK42 3VLKA 2N1GA 4JQNA 3VKHA 2CYPA 1OAFA 2RBZX 1E7PA 4AKGA 1MN1A 5AQQB 2C0SA 3KDSE 3O1HA 3ATJA 1NWMX 3ZC0A 3QNUA 5LBMA 3RYCE 4HWCA 4NVKB 1MNPA 2VCFX 2V23A 4KP3C 2Y5AA 3EDUA 4GIWA 1MMGA 3K1SA 4BM1A 2X0YA 4P0AA 2LHRA 5SYKA 4A97A 2CEAA 1XMOT 5SX1A 2WU2A 3OVUA 3ZCJA 1H5LA 3AEBA 2CWYA 2OLTA 1HNXT 2V1DB 2IMLA 2VVSA 5FXVA 2JMKA 3U3IA 3N2OA 2CEPA 3RLFF 4JV5T 2PJQA 4ILUA 5JPRA 5JRCB 4YJ3E 5JQRA 3RC8A 3CWZB 3UU4A 3M29A 1FJGT 3P4QA 3O1JA 3VLHA 1VCTA 1J5WA 4AQGA 3K3NA 2YINA 4QX8B 2RBUX 3AA1B 5AQHB 3UU3A 4PJMA 5C2TA 4LF4T 4HFIA 1Y01A 2AE9A 1H5MA 1B82A 5AQOB 5L47A 2LEHA 2PFVA 2XQ6A 2RBWX 3EABA 3VRAA 4DR5T 1I6ZA 3L8RA 4NVGB 3VLMA 3KV5A 5JHXA 4AQFC 5EK3A 1AEJA 2OV9A 1U5PA 3PUXF 3RH3A 2EUQA 4DR4T 3E22E 4NVDA 3HL6A 4CVJA 1L0VA 1RYCA 4JI8T 3A8YC 3AXJA 1U74A 4H7AA 4JMWA 5FXZA 1T98A 1FMWA 1V9DA 2JQKA 2PG8A 5IHYA 2E9XC 1IBMT 4NVAA 2I59A 3M27A 3ZMVB 3H3AA 4OYJA 5KQ2A 3J7Yq 2ZM2A 2LSGA 4IL9A 4DV1T 3C4WA 2PCCA 4ZOLE 2NP9A 4O4HE 1KXNA 4PK4A 3G06A 3LFMA 4EYYR 4ZS2A 5LYJE 4JEHB 1U2LA 4WNKA 1ZBZA 2BO5A 1G8XA 3CCPA 3RIVA 4JI3T 1UX5A 4MLKA 1IJ6A 3M28A 2Y6XA 5FXWA 1MKRA 2CCAA 2IC9A 2AS3A 1D1BA 2RC2X 4DIDB 5L4EA 1OEDE 5DJQC 4BLKA 1HCIA 5J1GA 1FIOA 5EJXA 4KHZF 4JM5A 2XQ8A 5JR9B 4PFOA 4WBNE 2WY2A 4JI5T 3CMLA 1AA4A 5L3CB 2KWHA 4GOUA 4IE5A 3RGLA 5L3FB 1D1CA 3NVOA 3MKDA 2XM1A 2H89A 4A56A 3NKZA 3O9XA 3QK6A 5BR8T 5JDQA 3P8CD 1H5GA 3JAFA 4YSZA 1LY9A 4ZI7E 3C4ZA 1KEYA 2BG9B 5FL0A 4O2AE 3CKDA 2CE7A 2KXPB 1IZNB 5KQKA 3AE3A 2E5LT 3GN5B 3NRYA 5CICA 4DMVA 1CHUA 5LMNT 2WM9A 4LF6T 1ARYA 2L3LA 4IDOA 4ILCA 5CA1E 5JHYA 1YW0A 4I43B 4QXHB 1STQA 5AQRB 4AQFA 2MAWA 2AS6A 2ZM6T 4A5GA 4AQYT 2WZIA 2C5IT 1ZP0A 4EV6A 2RBTX 3A5XA 5L3DB 3B13A 3FZFB 3PE0A 3N9MA 5JDGA 2VB6A 3ZEFB 5L3BB 5HCMA 2GHHX 1HF8A 4U3CA 3S4UA 2XIFA 2E9XA 4EGWA 4U72A 1ARUA 3EDVA 2XAJB 4P4QA 5KX5E 1X79A 3ONLC 4NVNB 2LOSA 4HWIB 2ODVA 3AVRA 4P0BA 2Y8DA 1S35A 5CIGA 4EYUA 4NPPA 5CCPA 4LMKA 2XQAA 2BVLA 2HPJA 4JMZA 3OYXA 2X9XA 1UK5A 2LRLA 3C98B 5CIEA 4HWHA 3TLWA 4U2ZA 4PAEA 1ARVA 4H9PC 5AOGA 1MMNA 3NZQA 4ZI2D 4NVLA 3F31A 5L2LA 1KXMA 3SS1A 1IYNA 2XQ5A 1H5JA 3AEGA 2DI4A 3RQUA 3IBPA 3R6NA 2YCGA 6ATJA 4FCSA 5SYHA 1AEDA 4C50A 3D0TA 1DSOA 1SA0E 1AEGA 2R6GF 3QB5K 4BLNA 1H5KA 4XVAA 2LJLA 2CBJA 1BEJA 1KNRA 3ANWB 5SX0A 3MK7C 1HX1B 1CCJA 4NUVA 5L02A 5KDMC 5ABNA 4LF8T 4HFHA 4TN7B 4L0RA 3ZCYA 2VKDA 1AEEA 3AE1A 1PA2A 2A2FX 4CCPA 3FJWA 4DBRA 3FB2A 1KNPA 4YXDA 2IC6A 2V5CA 4HGAA 1YQ4A 2CCDA 3PDYA 1OWAA 4ASKA 2JPFA 3PJAJ 2NTXA 1AEUA 3HDLA 4EZ4A 1AEKA 2V6YA 4Z8XA 4QHOA 2IIUA 1FHFA 3UUXB 4AKRB 4YY3T 3CCXA 5KQ0A 3AA6B 2BCNA 4JM6A 1OEDB 1W9RA 2P9BA 4TWHA 1A2FA 2EUTA 2XAFB 3UULA 3ZMSB 2M6BA 3ETVA 4CI1B 3T1YT 3ESLA 3CQCB 4BA9A 1XZYA 4NVBA 4H9RC 4NVCA 5SW6A 4EEDA 1GQEA 2HHHT 3CVRA 3KV9A 5CIDA 1H5DA 4H79A 4G63A 4DMWA 3RI5A 2N18A 2V26A 4JI2T 4NXNT 2CMRA 4WBOA 2ATJA 2CL4X 4NVHB 3DP7A 3RYIE 2MTQA 1CMUA 2XIHA 2VNXX 1C8IA 2GGNX 4BLYA 4GYRA 1GWTA 3LK3B 3UU6A 4JYAT 1D0XA 4A6ZA 5SXRA 5SYWA 3R84B 3VKGA 4N78D 2M6IA 3W15B 1LVKA 3J9X1 1MN2A 4QKNA 5SYJA 1H57A 3HKBE 2KT9A 1DS4A 2V7KA 3CQXC 2X66A 4GK0E 1YYGA 4GK5E 5LB7B 5HYAA 3JAEA 3ZCGA 5JDFA 2D5UA 1W09A 4JLEA 5HXRA 2CXDA 1CCGA 7ATJA 4AIUA 4GKFA 2UXXB 3RKGA 1UUSA 3PUQA 2C5KT 2CCQA 2RBVX 1N33T 3LJCA 4AKIA 2B1EA 5ABGA 1WCRA 5LGNB 1LRZA 3LSVA 4HTEA 1WLXA 1HG2A 3UTKA 3ZMTB 3AB3B 1H7CA 1HNZT 1BEQA 4ERRA 3UQ4A 1NENA 3L39A 5LMUT 2AS4A 5J2UE 2WDVA 4U7YA 5AQLB 3HA4A 3ZLIA 5FY1A 4O2BE 4X64T 5AQSB 5HEJA 4LF9T 5FKYA 1V0HX 2XHEB 3X16A 1OAGA 4JMBA 3TLSA 2KSRA 1ZBYA 4JUYA 3VU7H 2QRXA 4K0KT 2CXLA 1CMQA 3ZJ1A 5C8YE 3AE5A 1MNDA 3WAJA 5AMMA 3E08A 4ZI2C 1AC8A 4WZXA 4A78A 4I50E 5EJTA 4FCNA 5AL9A 2QA7A 2UXBT 4PW8A 2ES0A 1ARWA 3IA3A 4JMSA 1KZMA 1CUNA 2RC0X 2RP4A 3RF1A 2SPCA 4DR1T 1Z8UA 4YLHA 4H9OC 3VR8A 4X65T 1ITKA 4YHHT 2IHR1 1W4WA 1WYBA 2W63A 1D0YA 1BEPA 3KV6A 2A9UA 1YXRA 2W67A 4CZPA 2ACXA 2X08A 2RBYX 3AEEA 2KWIB 2HH7A 2EUUA 5LNKA 4BLLA 1SDQA 3KVBA 1VRBA 3RQWA 2BVMA 3FXEB 3TLVA 2CHNA 3M26A 4G05A 4CQIA 2VQFT 4TV8E 3PJAA 3PUYF 3P4SA 2YK0A 5IWAT 2WAUA 1U75A 2YLJA 2ZCAA 5SXWA 1HCHA 3AEAA 5HEUA 3ZCHA 2K48A 2QYWA 4IE6A 2IW5B 1UX4A 3ETUA 5HXCA 2EHOB 3F57A 3Q5DA 5SX7A 5F3JA 3N2GE 4HFVA 2WDRA 4QH5A 2FJAA 4HFBA 4B6XA 4ILBA 1WR6A 2Q9QD 4JI6T 2ZMAA 3RHWA 4A98A 4X20E 3QUJA 3AEDA 4KHPT 4ZI3D 3UUBA 2LT3A 2LHNA 2W23A 3NZPA 4KX6A 1BJ9A 2DNXA 3FM1A 1HR0T 1AEBA 1KNZA 4GKJT 3N9LA 2HPLA 1H5AA 2GHEX 3RIWA 1UB2A 3FM6A 2IAKA 5ADXL 3R99A 1FMVA 3ZT6A 4UVBB 2IUBA 2VASA 3FBZA 4JQMA 4ATJA 2JQQA 4PJLA 3VRBA 5ABFB 1JNRA 3PU8A 1QPAA 2V2EA 3M5QA 5L3GB 4CVIA 4CZRA 3RIAA 1GZAA 4CUOA 2CLYC 3M65A 4H63V 4ZXLA 4ISTA 5SX3A 2EUSA 1BR0A 5BMVE 2JMXA 3IHRA 3UFGA 2BS4A 5LCYA 1N32T 4LFCT 1G73A 4CZNA 5ABEA 3I9YA 4OYKA 5H9EB 1E1HB 2NTYA 1AENA 2W66A 5JH7E 1M62A 4YFSA 5KQIA 4ZZBA 5SW4A 1S73A 3LG7A 2UU9T 5F5WA 1S6VA 1APXA 2LSKA 3PUVF 4ZZCA 1J5ET 1DJ1A 4X66T 4DR6T 4HFDA 2AXDS 3O1IA 3N9QA 4HE8A 1VCSA 3ZMUB 4A7MA 4LMJA 3DJBA 3A7MA 3PURA 3P4PA 3FZHB 3P50A 3ZJ2A 2H88A 5JHZA 2VCSA 2RPAA 2WCAA 4NVFA 5LOVE 5FVLA 3K3OA 5F8PA 4IDNA 4X62T 4JQKA 1ZV4X 2D0TA 5L4HA 3AE6A 1HNWT 1ZOYA 2XJ5A 3ZYMA 3X1DA 3UUMA 5LHIB 3VR9A 2VKJA 5LG3A 4NVOB 1H5EA 1MMAA 4P1NA 4GYSA 4DV6T 2VL0A 4JI0T 2LSIA 4JMAA 1R8IA 1AJ3A 3F2EA 5L86A 2VWAA 2E3AA 4DO0A 1BR2A 3PU3A 3HKEE 3VLLA 3RIUC 2XZEA 3PTRB 5JDHA 1CCLA 2E9XB 5LA6E 2GHKX 2EUOA 5FNBA 2WP9A 4IDQA 4B3TT 1ARXA 4TV9E 4BLZA 3MA9A 1SBMA 4NVEA 5HAXA 2DCFA 2MOZA 1FEWA 5HWYA 2V5DA 2VURA 5JDNA 2BG9A 2NW8A 4KMCA 2UUBT 5HEHA 4FDQA 4C51A 2VNZX 1KRJA 4CXXA 2BS2A 1CCEA 3U78A 4LMLA 3X1LF 2MBGA 4DR2T 4HKAA 4X1YE 4YJ2E 5CGMA 3V5UA 2XQ4A 3GN5A 1BR1A 3ZPOA 1U2KA 2JIWA 3AE7A 1GWUA 3C64A 2VKHA 4EXTA 2XJ6A 2Q9QC 3LK2B 1MMDA 2WWUA 3N9PA 2F4VT 5JQGE 2AS2A 4PJJA 1ML2A 1CYFA 1O3XA 4UF0B 4ZI3C 5DQVA 4LFBT 3WNUA 3ZN1B 1BESA 4U2YA 3FHNA 2E39A 1T7SA 5SX0B 3K3QC 2JTIA 2KZ7B 2UUCT 5CIFA 1OXZA 1ZKEA 1W0AA 3BQLA 1DJ5A 2VKOA 3Q5WA 3ABVA 2CM0A 4DVDA 5LG4A 1CCIA 3RC3A 4UXNB 2WSSS 2L9QA 1AEMA 3OJAA 4ILAA 4X1KE 4PNIA 2RA1A 3M2DA 2DWGA 5CFBA 3ONJA 4CZOA 2J1DG 3FXDB 2CWOA 1QUUA 2XI6A 2V6YB 4JM8A 3M2EA 5LP6E 4UVAB 5FNEA 4K0UA 5L3EB 2WDQA 5FNVE 1KF6A 3KBUA 1XDPA 2E3BA 4JBWF 5CIHA 4KUMB 4F8HA 2XSBA 4NVMB 4ZHQE 1X9BA 4DUZT 1SOGA 4O4LE 3RIUA 4JPUA 2X51A 2YOEA 5H6RB 2XQYA 1A2GA 2WZHA 4B3ST 3RYFE 5DQWA 5LGUB 4YSYA 5ETWA 3VHLA 4JMTA 3ZYKA 3ANWA 5FP3A 4USCA 3B5MA 5AQJB 5EK2A 3CQGB 4JI4T 2HN2A 4JQJA 2W62A 1MIVA 3C51A 3WA8A 2V6XA 4IE0A 4YT0A 1XDOA 3UFEA 5EZYE 5H9FB 3ZYLA 3ONXA 1GWOA 4XV8A 4O8SA 2VVNA 3K8PC 2AQDA 2K5BB 4L5GA 1H5FA 4LF5T 4YHJA 4UEMA 4TX5A 1UGOA 2Q9QA 3AAIA 2WMOA 3FBLA 2CRBA 3Q5EA 4V1Av 2J47A 2XM2A 5IUXA 1BEKA 4TUYE 4DV5T 4X5TA 3B57A 3M2FA 2C5JA 2EUNA 3HKDE 5KXJA 3CX6B 1I94T 3ZCIA 3AE9A 4P09A 1U2JA 3PUSA 1HTJF 4FJOA 2UXDT 4JI7T 1YZRA 1UCUA 2W4XA 1DU2A 2XILA 4JM9A 3KVAA 5ABOA 1AEVA 2CBIA 5AQGB 4OFZA 4OX9T 3AA0B 3WXOA 4XV5A 3AA7B 2XTLA 4DV4T 1BVAA 3RRWA 3OTOT 3V5SA 1YQ3A 3Q2MA 4DV7T 1H5HA 4ANJA 3ZSTA 1IJ5A 3T1HT 1HSRA 3N5LA 5SXXA 1CPFA 1HS7A 5FL1A 3Q9DA 4NUUA 1SE7A 2D9DA 2B10A 5CD4J 4Z91A 4MBQA 2ZOPA 2JQHA 4IE7A 2X0HA 5AQMB 2Z6EA 1YD8G 2XUEA 2WU5A 4Z90A 5JDLA 3I1AA 4AI6A 2NR4A 1GZBA 3VLJA 2WBLA 3IEEA 2X9HA 3FKGA 3UT2A 3MJXA 2X9WA 4WW0A 3TKLB 2EHOC 4ZS3A 3RIFA 3LBXA 4CN1A 2LSYA 2OEBA 4BM4A 2VO2X 5JREA 2CHOA 4YTMA 4AXPA 5AQPB 1CPGA 1DCCA 3KV4A 3UU8A 2PBIA 1H3JA 4JZAA 3ZKRA 5LBQB 2BKPA 3M2CA 2V7JA 2BZBA 1W4YA 1QSDA 1ARPA 2BDEA 4CI2B 5KMGP 1ZEEA 4ISSA 2ZLYA 4MALA 1AEFA 4HFCA 3QOFA 4NIQA 4EB6E 5J0ZA 5HCJA 3N2KE 4DV0T 3QB5A 2XSAA 4TWFA 4C91A 4H9QC 5HXEA 2NW7A 3MZKB 2BG9E 1W0BA 4FEFA 5SYYA 3BK9A 3AAEB 5SW5A 3JC6D 2DL1A 2ANZA 5SYVA 2CCPA 1QLBA 2LKGA 4H63H 1N36T 1UURA 1XNRT 5HWXA 1AEQA 3PUZF 2LRKA 1CK6A 2RBXX 5FMNA 4HWFA 1GW2A 3M23A 3M2HA 5LHGB 3GA8A 2W61A 2X9YA 4L9IA 3ZSSA 2GB8A 1J1JA 3I0QA 3CX8B 5AQFB 2YEVC 2QGSA 5HEGA 4DR7T 3FM4A 1EZ3A 4M1PA 4CN6A 5CB4E 3O4XE 3KFWX 4BM2A 3AECA 1YKEB 2VK9A 4OK0A 2BKOA 3LDQB 1YKHB 1HFAA 3AXJB 4QWNB 5JR9C 3SWHA 1KK7A 2MYSA 1CCKA 5SXQA 4BAYB 3PUWF 2X68A 1GX2A 4IREA 4U33A 2EHOA 1Z53A 3M25A 2WQYA 3L3PA 4IDZA 5LHHB 2V8SV 1CMTA 1DSEA 5DABA 2BBJA 2YDQA 2YU2A 2HN1A 3ZC1A 5JRCA 3M2BA 5CJHA 5EK4A 2VCNA 2BG9C 1KFYA 4U74A 3E0ZA 2KMFA 1T72A 2D2SA 5A1LA 3TLTA 1KOKA 1SHZC 2RC1X 4I55E 3UU5A 3HKCE 4J2CA 3OPCA 3IF8B 2L8KA 5HXHA 2YN6A 3UT5E 5FXXA 2N9DA 3M2IA 3M2GA 3FZLB 3NBXX 2VQET 4QXBB 3P4RA 2DHRA 5HEOA 1HG5A 4U31A 5ABFA 4IGUA 4NVIB 1IBKT 4OQ7A 2PTFA 2XY8B 4UV8B 3E2NA 5LJMA 4GEDA 3BQKA 4CXYA 1AESA 4H9NC 2LM9A 3QC9A 4GKKT 4PAGA 2B76A 3KINB 3FMUA 5KQ6A 2H7OA 2YDRA 5L05A 1SUMB 3RX6A 4B3MT 5JDMA 2BBHA 2K24A 1CCAA 2W2UA 3C4XA 2I6HA 4XBFB 1AEOA 2V7MA 2JMHA 4LFAT 1MIWA 4DV2T 2XJ7A 4HWDA 5CJ5A 2YU1A 3OYZA 2H7VC 4XV4A 3BQIA 4ADZA 1ABVA 1CPDA 3PUAA 1H58A 3CPZA 4EOZB 4CI3B 3OBVE 1Z0PA 2X07A 1YZPA 2VL8A 4AISA 1LLPA 5AQTB 2V7IA 4I0UA 4QH4A 2CLYB 1NEKA 3AE2A 4XV6A 2XQ9A 4OHFA 3UUNA 2PCBA 4COFA 5JR9A 3RRCA 2E5VA 3UW8A 5KQ3A 2K9AA 3P7IA 5LGTB 4IHJE 5SYLA 3ZT7A 2J62A 4QX7B 3SRZA 2DWKA 1E2AA 4LF7T 4AKHA 4AKLA 4CCXA 4YSXA 5D6MA 2WMNA 2XASB 5HXSA 4HEAA 1WFDA 4BLXA 1CCPA 3N9OA 1US7B 3JC6C 4TNWA 1XMQT 2OA5A 1AC4A 4DBQA 1D1AA 4JPLA 1DSPA 4PK5A 3WAKA 4MFRA 2W00A 5FY7A 4WYVA 2CA5A 2J4GA 4HFEA 1DSGA 5AQKB 5IYZE 2BS3A 3RKOA 2FJEA 3AE8A 2H3RA 3HI2A 4O4JE 1OEDC 3EAMA 5SXTA 4B3RT 5FY0A 4YTPA 5CA0E 5JTGA 1MIYA 4G2AA 2EHOD 4BJNA 2ICVA 2Y6BA 2IA8A 4NXMT 2K3WA 3M2AA 1B85A 1T8BA 2N2NA 3NWIA 1SJ2A 4PFPA 2A3DA 3I0OA 1EBEA 5SX6A 3CIRA 5E0OA 5SX2A 4F6RC 2XJ8A 2JRKA 4UELA 1S94A 1LY8A 5KSKA 3I9WA 5AQUB 2UUAT 3CK6A 1XWMA 4A71A 2XAQB 4QXCB 5SYIA 2NWBA 2E8IA 4QYZB 3M8MA 3RPUA 1YYDA 2NW9A 4XAXB 4EAHA 5ALAA 2JQ9A 3EI0A 1QO4A 1IBLT 4NVJB 2X0LB 3SFEA 4UF0A 2WSSV 3Q3UA 2V7LA 2X67A 4PJNA 2LM2A 3AVSA 2UXCT 3WI3A 1CPEA 2LSJA 4IT4A 2FUPA 1LKXA 4E7ZA 4JB4A 3SOLA 4O4IE 2LLYA 4JN0A 1CCCA 5FYMA 3FZMB 2WWVA 3MACA 1H5IA 2M67A 3M3ZB 3ZMZB 1LYCA 4YTNA 3DTOA 4EZHA 3GWHA 2XAGB 1Y64B 5LJNA 2GK9A 5ABQA 2BKNA 4QH1A 3P4WA 4U7IA
chains in the Genus database with same CATH topology
1B80A 4AQFA 5JREA 4IE4A 1GZAA 4CUOA 2Q9QB 4BM3A 2CLYC 3R98A 3M65A 4H63V 2AS6A 2Y6AA 4ISTA 4AXPA 5SX3A 4A5GA 1CPGA 2EUSA 4AQGA 4UV9B 1WRDA 3T8OA 2C5IT 1BR0A 1DCCA 3KV4A 5BMVE 2RBTX 3IHRA 3A5XA 2PBIA 2JJ9A 5LCYA 5L3DB 3B13A 4EIWA 3PE0A 1H3JA 2A72A 3L09A 4JZAA 3N9MA 5KQHA 5JDGA 2VB6A 2CXFA 2EURA 4IIJE 3ZEFB 1G73A 4CZNA 5LBQB 2KLQA 5L3BB 1LYKA 3I9YA 2GHHX 3M2CA 1HF8A 5H9EB 1E1HB 1MNEA 2BZBA 1AENA 1W4YA 2NTYA 2V7JA 2Y48B 1QSDA 3KBTA 3S4UA 2XIFA 1BEMA 1CMPA 2E9XA 3N9NA 1ARPA 3ZN0B 5JH7E 4I50E 2LOPA 4U72A 1ZHCA 4YFSA 2BDEA 4CI2B 5KMGP 5KQIA 1ARUA 2XAHB 3EDVA 1AETA 2XAJB 5H6QB 4CXWA 1ZEEA 5SW4A 4ISSA 4P4QA 5KX5E 1S73A 1X79A 4UIGA 2ZLYA 3LG7A 1AEFA 4MALA 4NVNB 2GHDX 2LE8A 1S6VA 2LOSA 1APXA 4EB6E 2LSKA 2ODVA 3AVRA 4P0BA 4BM4A 3NRXA 2Y8DA 3N2KE 1DJ1A 7CCPA 2B11A 1AEHA 1S35A 3C50A 2BOQA 5CIGA 1HX8A 1IAPA 3O1IA 3PUGA 4JEUB 4EYUA 3N9QA 5CCPA 1LGAA 3NRYA 4C91A 1QGJA 2KNDA 4KBMB 2BVLA 4HE8A 2HPJA 4H9QC 4JMZA 3OYXA 5HXEA 2NW7A 3MZKB 3ZMUB 4A7MA 5KSFA 5TAOA 3DJBA 2X9XA 4CZZB 2AS1A 3C98B 1MKQA 5CIEA 4FEFA 5SYYA 3BK9A 4NFGA 3AAEB 3PURA 5SW5A 4PAEA 5SYUA 4I4TE 3JC6D 1ARVA 2ANZA 5AOGA 5SYVA 1MMNA 2CCPA 4H9PC 3NZQA 5JHZA 4H63H 3ZJ2A 4ZI2D 5LXTE 5HWXA 1AEQA 4NVLA 2D0UA 3F31A 5L2LA 1KXMA 3SS1A 2VCSA 5SXSA 1CK6A 4X1IE 1IYNA 5J2TE 4NVFA 1H5JA 2DI4A 5LOVE 2RBXX 2NOXA 3IBPA 3R6NA 4U7UB 3K3OA 5FMNA 5F8PA 2YCGA 6ATJA 4FCSA 5SYHA 1AEDA 5JVDE 4JMVA 4C50A 1GW2A 3D0TA 4UVCB 3M23A 3M2HA 1DSOA 1SA0E 4CZQA 5LHGB 1AEGA 2B12A 2E9XD 3GA8A 4PK6A 4JQKA 2W61A 2X9YA 2GHCX 4BM0A 1ZV4X 2D0TA 4L9IA 1H55A 1NAFA 2GB8A 1H5KA 4BLNA 4C90A 4XVAA 2LJLA 2XJ5A 3I0QA 3ZYMA 3CX8B 5LHIB 3UUMA 2G0UA 2YEVC 2QGSA 1BEJA 4MHCA 3FM4A 3ANWB 1EZ3A 2VKJA 4M1PA 5SX0A 3MK7C 5CB4E 3O4XE 4DNDA 1VOMA 4NVOB 1H5CA 1CCJA 4NUVA 5L02A 3LBXB 1H5EA 5KDMC 5CIBA 5ABNA 4BM2A 1MMAA 3KFWX 4TN7B 4GYSA 1YKEB 3ZCYA 4L0RA 2VK9A 2LSIA 5GONE 4JMAA 2VKDA 1AEEA 4OK0A 1PA2A 1AJ3A 2A2FX 4CCPA 3F2EA 3FJWA 5L86A 3H37A 4HN9A 2VWAA 2E3AA 1B7TA 1YKHB 3FB2A 1HFAA 4DBRA 4DO0A 2IC6A 4HGAA 1BR2A 1D0ZA 2UXNB 3PU3A 2CCDA 2ZM8A 4QWNB 5JR9C 3SWHA 3HKEE 3PDYA 1OWAA 1WYCA 4ASKA 1KK7A 2MYSA 2JPFA 3VLLA 1CCKA 5SXQA 4OYKA 4BAYB 2NTXA 1SCHA 1AEUA 2X68A 3HDLA 3GMIA 4TZ4C 3PTRB 4EZ4A 1AEKA 5JDHA 1GX2A 4QHOA 4Z8XA 3OKQA 1CCLA 1FHFA 2E9XB 6CCPA 2GHKX 2EHOA 5LA6E 3UUXB 4AKRB 2EUOA 5FNBA 1CCBA 1Z53A 5M4YA 3CCXA 1ARXA 2WD4A 5KQ0A 3M25A 1LVFA 2KINB 3AA6B 4TV9E 3L3PA 4IDZA 2BCNA 4BLZA 3MA9A 4JM6A 3EVYA 2ZM0A 1SBMA 5LHHB 1CMTA 4NVEA 1DSEA 2P9BA 5DABA 5HAXA 1A2FA 2EUTA 2XAFB 3UULA 3ZMSB 2DCFA 2DLRA 2YU2A 2MOZA 3ETVA 3VLIA 3ZC1A 4CI1B 3ESLA 3CQCB 4BA9A 5JRCA 3M2BA 4NVBA 5CJHA 1FEWA 4H9RC 4JPTA 5HWYA 5EK4A 4XV7A 4NVCA 5SW6A 2VCNA 4U74A 4E7SA 3E0ZA 3CVRA 3EUHA 5JDNA 2KMFA 5SYXA 2D2SA 5CIDA 3KV9A 1ATJA 1BGPA 1H5DA 1JDRA 4H79A 4G63A 4DMWA 5A1LA 2NW8A 1KOKA 4KMCA 1SHZC 2N18A 2RC1X 2VKAA 4FDQA 2V26A 4C51A 2VNZX 3HKCE 4I55E 4J2CA 1KRJA 4BJMA 4CXXA 3IF8B 2L8KA 1CCEA 1JCIA 3U78A 5AFUL 5HXHA 2MBGA 4HKAA 3UT5E 4X1YE 3AAAB 4YJ2E 3V5UA 5FXXA 3GN5A 1BR1A 2CMRA 1MK8A 3M2GA 3M2IA 2N9DA 3NBXX 4WBOA 1U2KA 2ATJA 2CL4X 4QXBB 4NVHB 3ZPOA 2W0GA 3DP7A 3RYIE 2EUPA 2DHRA 1U4QA 3EXBA 1HG5A 2MTQA 4IGUA 1CMUA 4NVIB 1GWUA 2XIHA 2VKHA 3C64A 2VNXX 1C8IA 2B0ZA 4OQ7A 4EXTA 4UV8B 2GGNX 4BLYA 2XJ6A 3E2NA 5LJMA 2Q9QC 3LK2B 3MXZA 1MMDA 1GWTA 2WWUA 4GEDA 3LK3B 4GYRA 3N9PA 3BQKA 4CXYA 1AESA 4H9NC 5JQGE 2LM9A 2AS2A 1D0XA 3QC9A 4PAGA 4PJJA 1ML2A 3CX7B 3KINB 1CYFA 1O3XA 4UF0B 4ZI3C 3FMUA 3RYHE 5KQ6A 4A6ZA 5DQVA 5SXRA 5SYWA 2H7OA 3WNUA 3HR0A 3ZN1B 3R84B 4H9SE 5L05A 1BR4A 3VKGA 1BESA 4N78D 2ODUA 3FHNA 3E2OA 4XZCA 3RX6A 3W15B 1LVKA 5JDMA 2E39A 3J9X1 3Q5XA 2K24A 4FI5A 3LK42 1CCAA 3VLKA 1MN2A 4QKNA 2N1GA 5SYJA 5SX0B 4JQNA 3K3QC 3C4XA 2JTIA 2KZ7B 1H57A 3HKBE 2KT9A 3VKHA 5CIFA 1OXZA 1DS4A 1AEOA 1OAFA 2CYPA 1ZKEA 2RBZX 2V7MA 4XBFB 2JMHA 2V7KA 3BQLA 3CQXC 4AKGA 1MIWA 1MN1A 1DJ5A 2X66A 4GK0E 2VKOA 1YYGA 2C0SA 3Q5WA 3KDSE 4GK5E 5HYAA 2CM0A 2YU1A 2H7VC 3OYZA 4DVDA 5LG4A 3ZCGA 3O1HA 3ATJA 1CCIA 1NWMX 4XV4A 5JDFA 3ZC0A 2D5UA 5LBMA 3RYCE 3RC3A 3BQIA 4JLEA 4UXNB 2CXDA 5HXRA 4ADZA 4NVKB 1MNPA 2VCFX 2V23A 4KP3C 1CCGA 2Y5AA 3EDUA 2L9QA 4GIWA 7ATJA 1CPDA 1AEMA 3OJAA 4X1KE 3PUAA 1MMGA 1H58A 2UXXB 2RA1A 4PNIA 3PUQA 3M2DA 2DWGA 2C5KT 3CPZA 4BM1A 2CCQA 4EOZB 4CI3B 2RBVX 4CZOA 3OBVE 3LJCA 4AKIA 4AI6A 2J1DG 3FXDB 1Z0PA 2CWOA 4P0AA 2X07A 5SYKA 1QUUA 2LHRA 2XI6A 2CEAA 1YZPA 2B1EA 2VL8A 5SX1A 5LGNB 3ZCJA 1H5LA 1LLPA 4JM8A 2CWYA 1LRZA 3M2EA 2V1DB 5LP6E 2V7IA 4UVAB 5FNEA 5FXVA 4HTEA 1WLXA 4K0UA 2JMKA 3U3IA 3N2OA 5L3EB 2CLYB 1HG2A 5FNVE 2CEPA 3UTKA 3KBUA 3ZMTB 3AB3B 2E3BA 1H7CA 4XV6A 4BJNA 2PJQA 4ILUA 4OHFA 1BEQA 5JPRA 5CIHA 4KUMB 3UUNA 2PCBA 4ERRA 5JRCB 2AS4A 4YJ3E 5JQRA 3RC8A 5J2UE 5JR9A 4NVMB 3RRCA 3HA4A 3CWZB 3UW8A 5KQ3A 1SOGA 3M29A 5FY1A 3ZLIA 4O2BE 2K9AA 3O1JA 4O4LE 3P7IA 4JPUA 3VLHA 5SYLA 4IHJE 5LGTB 2X51A 1V0HX 4QX7B 3K3NA 2XHEB 3X16A 2RBUX 2XQYA 2YINA 4QX8B 3AA1B 5H6RB 3SRZA 1OAGA 4JMBA 2DWKA 1A2GA 4PJMA 4AKHA 4AKLA 1H5MA 3RYFE 1B82A 1ZBYA 4JUYA 3VU7H 2LEHA 2PFVA 5DQWA 5LGUB 4CCXA 5ETWA 3VHLA 2CXLA 4JMTA 3ZYKA 3ANWA 5D6MA 2WMNA 1CMQA 5FP3A 2RBWX 3ZJ1A 4USCA 5C8YE 2XASB 5HXSA 4NVGB 3VLMA 1MNDA 5JHXA 3KV5A 4HEAA 3WAJA 5AMMA 4BLXA 5EK2A 4AQFC 1CCPA 3N9OA 5EK3A 1AEJA 3E08A 1US7B 3JC6C 3CQGB 4JQJA 4ZI2C 1AC8A 1U5PA 2W62A 2EUQA 3RH3A 1MIVA 4A78A 3E22E 4NVDA 3HL6A 5EJTA 1AC4A 4FCNA 1RYCA 4CVJA 2OA5A 5AL9A 1D1AA 2QA7A 3C51A 4PW8A 3WA8A 4PFPA 4DBQA 2ES0A 1ARWA 4JPLA 1U74A 4IE0A 1DSPA 4H7AA 4JMWA 4JMSA 3UFEA 5EZYE 5H9FB 4PK5A 5FXZA 1T98A 3ONXA 3ZYLA 3WAKA 1GWOA 1FMWA 4MFRA 1KZMA 1CUNA 2RC0X 2RP4A 4XV8A 1V9DA 4O8SA 2W00A 2PG8A 2SPCA 3K8PC 2CA5A 2AQDA 5FY7A 5IHYA 2E9XC 1DSGA 4YLHA 4NVAA 2K5BB 4L5GA 4H9OC 1H5FA 1ITKA 5IYZE 4YHJA 2I59A 3M27A 3RKOA 1W4WA 1WYBA 4UEMA 2W63A 2H3RA 3HI2A 1D0YA 4TX5A 2Q9QA 1BEPA 4O4JE 3ZMVB 3AAIA 3KV6A 2WMOA 5SXTA 3H3AA 4OYJA 5KQ2A 5FY0A 3J7Yq 3FBLA 5CA0E 2ZM2A 1MIYA 2LSGA 4G2AA 2EHOD 3C4WA 2PCCA 2ICVA 4V1Av 2Y6BA 2IA8A 4CZPA 2ACXA 4ZOLE 2NP9A 2X08A 4O4HE 1KXNA 3M2AA 4PK4A 3LFMA 1B85A 1BEKA 2RBYX 4EYYR 4ZS2A 4TUYE 4JEHB 2KWIB 1U2LA 5LYJE 2HH7A 4WNKA 1ZBZA 2EUUA 2N2NA 1G8XA 3CCPA 3RIVA 5LNKA 4BLLA 1SDQA 1SJ2A 3M2FA 1UX5A 2EUNA 2A3DA 2C5JA 1EBEA 1VRBA 3B57A 3HKDE 3I0OA 3KVBA 2BVMA 3FXEB 3CX6B 4MLKA 1IJ6A 3M28A 2Y6XA 5SX6A 5E0OA 5SX2A 5FXWA 3ZCIA 4F6RC 1MKRA 2CCAA 2IC9A 2AS3A 2XJ8A 2JRKA 3M26A 4P09A 4G05A 1D1BA 1U2JA 2RC2X 4CQIA 4UELA 1S94A 3PUSA 1LY8A 5KSKA 1HTJF 4TV8E 4FJOA 3I9WA 1YZRA 1UCUA 5DJQC 4A71A 2YK0A 4BLKA 1HCIA 2WAUA 2XAQB 4QXCB 1FIOA 5SYIA 2XILA 5J1GA 4JM9A 1U75A 2YLJA 2ZCAA 5EJXA 4JM5A 3KVAA 5SXWA 5ABOA 1HCHA 2NWBA 2E8IA 4QYZB 3M8MA 3RPUA 5JR9B 1YYDA 4PFOA 4WBNE 3ZCHA 1AEVA 2K48A 4XAXB 4IE6A 2IW5B 2NW9A 4EAHA 5ALAA 1UX4A 4ZHQE 1QO4A 3CMLA 1AA4A 3ETUA 5HXCA 5L3CB 4NVJB 2KWHA 2X0LB 2EHOB 4GOUA 4OFZA 3AA0B 3F57A 4IE5A 4UF0A 3WXOA 5L3FB 4XV5A 5SX7A 2WSSV 3Q3UA 3AA7B 1D1CA 3N2GE 4HFVA 4B6XA 5F3JA 2V7LA 2X67A 2XTLA 3MKDA 4PJNA 3AVSA 4A56A 1WR6A 2Q9QD 3WI3A 2ZMAA 1BVAA 1CPEA 3O9XA 3RRWA 3QK6A 3V5SA 3Q2MA 1H5HA 2LSJA 4X20E 3QUJA 1IJ5A 4ANJA 1HSRA 5JDQA 3N5LA 4ZI3D 5SXXA 1LKXA 3P8CD 1CPFA 1H5GA 2LT3A 4E7ZA 1LY9A 4JB4A 2LHNA 2W23A 3C4ZA 3SOLA 3NZPA 4ZI7E 1HS7A 3Q9DA 4NUUA 2B10A 1BJ9A 2DNXA 5CD4J 3FM1A 1KNZA 1AEBA 4O4IE 4MBQA 4JN0A 3N9LA 2HPLA 1H5AA 2GHEX 1CCCA 4O2AE 3RIWA 1UB2A 3FM6A 2IAKA 5FYMA 5ADXL 4IE7A 3R99A 3CKDA 1FMVA 3MACA 2CE7A 1H5IA 2M67A 2KXPB 2Z6EA 3ZMZB 1YD8G 2XUEA 1LYCA 1IZNB 5KQKA 3DTOA 4UVBB 4EZHA 5JDLA 3I1AA 3GWHA 2XAGB 3GN5B 2VASA 1GZBA 3VLJA 1Y64B 5CICA 2WBLA 4JQMA 3FBZA 4ATJA 3IEEA 4DMVA 2JQQA 4PJLA 5LJNA 2GK9A 2WM9A 2X9HA 1ARYA 3FKGA 3UT2A 2L3LA 5CA1E 5ABQA 3MJXA 2X9WA 4WW0A 3TKLB 3PU8A 2EHOC 1QPAA 2V2EA 3M5QA 5JHYA 1YW0A 4QXHB 4I43B 3LBXA 4ZS3A 5L3GB 4CVIA 4CZRA 2LSYA 1STQA 2VO2X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B80 A;  1GZA A;  4CUO A;  4BM3 A;  3R98 A;  2AS6 A;  2Y6A A;  5SX3 A;  4A5G A;  1CPG A;  2EUS A;  1DCC A;  2RBT X;  1H3J A;  5KQH A;  2EUR A;  4CZN A;  1LYK A;  2GHH X;  3M2C A;  1AEN A;  1W4Y A;  2XIF A;  1BEM A;  1CMP A;  1ARP A;  5KQI A;  1ARU A;  1AET A;  5SW4 A;  4P4Q A;  1S73 A;  1AEF A;  4NVN B;  2GHD X;  1S6V A;  1APX A;  4BM4 A;  1DJ1 A;  7CCP A;  2B11 A;  1AEH A;  2BOQ A;  5CIG A;  5CCP A;  1LGA A;  1QGJ A;  4JMZ A;  4A7M A;  5KSF A;  2AS1 A;  1MKQ A;  5CIE A;  4FEF A;  5SYY A;  4NFG A;  5SW5 A;  4PAE A;  5SYU A;  1ARV A;  2ANZ A;  5AOG A;  5SYV A;  2CCP A;  5JHZ A;  1AEQ A;  4NVL A;  1KXM A;  2VCS A;  5SXS A;  1CK6 A;  1IYN A;  4NVF A;  1H5J A;  2RBX X;  2YCG A;  6ATJ A;  4FCS A;  5SYH A;  1AED A;  4JMV A;  4C50 A;  1GW2 A;  3M23 A;  3M2H A;  1DSO A;  4CZQ A;  1AEG A;  2B12 A;  4JQK A;  2GHC X;  4BM0 A;  1H55 A;  2GB8 A;  1H5K A;  4BLN A;  4XVA A;  2XJ5 A;  1BEJ A;  3FM4 A;  5SX0 A;  4NVO B;  1H5C A;  1CCJ A;  5L02 A;  1H5E A;  5CIB A;  5ABN A;  4BM2 A;  3ZCY A;  4JMA A;  1AEE A;  1PA2 A;  4CCP A;  3FJW A;  5L86 A;  2E3A A;  2CCD A;  3VLL A;  1CCK A;  5SXQ A;  1SCH A;  1AEU A;  3HDL A;  1AEK A;  1GX2 A;  1CCL A;  1FHF A;  6CCP A;  2GHK X;  2EUO A;  5FNB A;  1CCB A;  1Z53 A;  3CCX A;  1ARX A;  2WD4 A;  5KQ0 A;  3M25 A;  2BCN A;  4BLZ A;  4JM6 A;  1SBM A;  1CMT A;  4NVE A;  1DSE A;  1A2F A;  2EUT A;  3VLI A;  3M2B A;  4NVB A;  5CJH A;  4JPT A;  4XV7 A;  4NVC A;  5SW6 A;  2VCN A;  5SYX A;  5CID A;  1ATJ A;  1BGP A;  1H5D A;  1JDR A;  1KOK A;  2N18 A;  2RC1 X;  2VKA A;  4FDQ A;  4C51 A;  2VNZ X;  1KRJ A;  1CCE A;  1JCI A;  1MK8 A;  3M2G A;  3M2I A;  1U2K A;  2ATJ A;  2CL4 X;  4NVH B;  2EUP A;  3EXB A;  1CMU A;  4NVI B;  1GWU A;  2XIH A;  2VNX X;  1C8I A;  2B0Z A;  4OQ7 A;  2GGN X;  4BLY A;  2XJ6 A;  3E2N A;  1GWT A;  4GED A;  1AES A;  2AS2 A;  1ML2 A;  1CYF A;  3FMU A;  5KQ6 A;  4A6Z A;  5SXR A;  5SYW A;  3WNU A;  5L05 A;  1BES A;  3E2O A;  2E39 A;  1CCA A;  3VLK A;  1MN2 A;  5SYJ A;  5SX0 B;  4JQN A;  2JTI A;  1H57 A;  5CIF A;  1DS4 A;  1AEO A;  1OAF A;  2CYP A;  2RBZ X;  1MN1 A;  1DJ5 A;  1YYG A;  3ZCG A;  3ATJ A;  1CCI A;  4XV4 A;  4NVK B;  1MNP A;  2VCF X;  2V23 A;  1CCG A;  2Y5A A;  7ATJ A;  1CPD A;  1AEM A;  1H58 A;  3M2D A;  4BM1 A;  2RBV X;  4CZO A;  2X07 A;  5SYK A;  2XI6 A;  1YZP A;  5SX1 A;  1H5L A;  1LLP A;  4JM8 A;  3M2E A;  5FNE A;  2CEP A;  2E3B A;  4XV6 A;  1BEQ A;  5JPR A;  5CIH A;  2PCB A;  2AS4 A;  5JQR A;  4NVM B;  3UW8 A;  5KQ3 A;  1SOG A;  3M29 A;  4JPU A;  3VLH A;  5SYL A;  1V0H X;  3X16 A;  2RBU X;  1OAG A;  4JMB A;  1A2G A;  1H5M A;  1B82 A;  1ZBY A;  4CCX A;  4JMT A;  5D6M A;  1CMQ A;  2RBW X;  4USC A;  4NVG B;  3VLM A;  5JHX A;  5AMM A;  4BLX A;  1CCP A;  1AEJ A;  4JQJ A;  1AC8 A;  2EUQ A;  4A78 A;  4NVD A;  5EJT A;  1AC4 A;  4FCN A;  1RYC A;  4CVJ A;  5AL9 A;  1ARW A;  4JPL A;  1U74 A;  1DSP A;  4JMW A;  4JMS A;  1GWO A;  1KZM A;  2RC0 X;  4XV8 A;  2AQD A;  1DSG A;  4NVA A;  1H5F A;  1ITK A;  3M27 A;  1W4W A;  1BEP A;  5SXT A;  5KQ2 A;  2PCC A;  2ICV A;  2Y6B A;  2IA8 A;  4CZP A;  2X08 A;  1KXN A;  3M2A A;  1B85 A;  1BEK A;  2RBY X;  1U2L A;  1ZBZ A;  2EUU A;  3CCP A;  3RIV A;  4BLL A;  1SDQ A;  1SJ2 A;  3M2F A;  2EUN A;  1EBE A;  3M28 A;  5SX6 A;  5SX2 A;  1MKR A;  2CCA A;  2AS3 A;  2XJ8 A;  3M26 A;  4G05 A;  1U2J A;  2RC2 X;  1LY8 A;  5KSK A;  1YZR A;  4A71 A;  4BLK A;  5SYI A;  2XIL A;  4JM9 A;  1U75 A;  2YLJ A;  5EJX A;  4JM5 A;  5SXW A;  5ABO A;  1HCH A;  3M8M A;  1YYD A;  3ZCH A;  1AEV A;  5ALA A;  1QO4 A;  1AA4 A;  4NVJ B;  3WXO A;  4XV5 A;  5SX7 A;  3Q3U A;  1BVA A;  1CPE A;  3RRW A;  1H5H A;  1HSR A;  5SXX A;  1CPF A;  1H5G A;  1LY9 A;  4JB4 A;  2W23 A;  2B10 A;  1BJ9 A;  3FM1 A;  1AEB A;  4JN0 A;  1H5A A;  2GHE X;  1CCC A;  3RIW A;  1UB2 A;  3FM6 A;  3R99 A;  1H5I A;  1LYC A;  5KQK A;  1GZB A;  3VLJ A;  5CIC A;  4JQM A;  4ATJ A;  1ARY A;  3FKG A;  3UT2 A;  5ABQ A;  1QPA A;  2V2E A;  3M5Q A;  5JHY A;  4CVI A;  4CZR A;  1STQ A;  2VO2 X; 
#chains in the Genus database with same CATH topology
 1B80 A;  4IE4 A;  2Q9Q B;  4BM3 A;  3R98 A;  2Y6A A;  4UV9 B;  1WRD A;  3T8O A;  4TWD A;  2JJ9 A;  4DUY T;  4EIW A;  2A72 A;  3L09 A;  5KQH A;  2CXF A;  2EUR A;  4IIJ E;  2A7U B;  2KLQ A;  1LYK A;  2Y48 B;  1MNE A;  3KBT A;  2XPK A;  5AQV B;  4TNV A;  1BEM A;  1CMP A;  3ZN0 B;  3N9N A;  3UQ7 A;  2LOP A;  1ZHC A;  2XAH B;  1AET A;  5H6Q B;  4CXW A;  2LKH A;  4UIG A;  1OED A;  4ZEY A;  2GHD X;  2LE8 A;  3JCF A;  4EEB A;  2FJD A;  3ZT5 A;  3NRX A;  5C3J A;  7CCP A;  2B11 A;  1AEH A;  2IDO B;  3C50 A;  2BOQ A;  4IL4 A;  1HX8 A;  1IAP A;  3PUG A;  4JEU B;  2WS3 A;  1LGA A;  1QGJ A;  2KND A;  4KBM B;  2QVA A;  1M7K A;  5KSF A;  5TAO A;  4CZZ B;  2AS1 A;  1MKQ A;  2E2A A;  4NFG A;  5SYU A;  4I4T E;  5LXT E;  2D0U A;  2ACZ A;  5SXS A;  4X1I E;  5J2T E;  2NOX A;  4U7U B;  5JVD E;  4JMV A;  4UVC B;  4UR9 A;  4CZQ A;  2E9X D;  2B12 A;  3JAD A;  4PK6 A;  2GHC X;  4BM0 A;  1H55 A;  1NAF A;  3AE4 A;  3PV0 F;  4C90 A;  4DR3 T;  2G0U A;  4MHC A;  4DND A;  1VOM A;  1H5C A;  2FBW A;  3LBX B;  5CIB A;  5GON E;  2FJB A;  4KI0 F;  3H37 A;  4HN9 A;  1B7T A;  4DV3 T;  5ABH A;  1D0Z A;  2UXN B;  2ZM8 A;  5AQI B;  1WYC A;  4A5X A;  1SCH A;  3GMI A;  4TZ4 C;  3OKQ A;  3H3M A;  5FVK A;  6CCP A;  1CCB A;  5M4Y A;  2WD4 A;  1LVF A;  2XQ7 A;  2KIN B;  3AEF A;  2ZM0 A;  3EVY A;  4IDP A;  2DLR A;  4JI1 T;  3VLI A;  2CPT A;  4JPT A;  4XV7 A;  3FZK B;  1JNZ A;  4E7S A;  3EUH A;  5SYX A;  1ATJ A;  1BGP A;  1JDR A;  2VKA A;  4BJM A;  5AFU L;  1JCI A;  1N34 T;  4CN4 A;  3AAA B;  1MK8 A;  3TLU A;  2W0G A;  5AQN B;  2EUP A;  1U4Q A;  3EXB A;  1XNQ T;  3SFD A;  2MPK A;  1WR0 A;  2B0Z A;  2YKS A;  2XQ3 A;  3MXZ A;  2YDS A;  4Q25 A;  3CX7 B;  3RYH E;  3HR0 A;  4H9S E;  1BR4 A;  2I0M A;  2ODU A;  4XZC A;  3E2O A;  2WB5 A;  3Q5X A;  4FI5 A;  3EHZ A;  3LK4 2;  3VLK A;  2N1G A;  4JQN A;  3VKH A;  2CYP A;  1OAF A;  2RBZ X;  1E7P A;  4AKG A;  1MN1 A;  5AQQ B;  2C0S A;  3KDS E;  3O1H A;  3ATJ A;  1NWM X;  3ZC0 A;  3QNU A;  5LBM A;  3RYC E;  4HWC A;  4NVK B;  1MNP A;  2VCF X;  2V23 A;  4KP3 C;  2Y5A A;  3EDU A;  4GIW A;  1MMG A;  3K1S A;  4BM1 A;  2X0Y A;  4P0A A;  2LHR A;  5SYK A;  4A97 A;  2CEA A;  1XMO T;  5SX1 A;  2WU2 A;  3OVU A;  3ZCJ A;  1H5L A;  3AEB A;  2CWY A;  2OLT A;  1HNX T;  2V1D B;  2IML A;  2VVS A;  5FXV A;  2JMK A;  3U3I A;  3N2O A;  2CEP A;  3RLF F;  4JV5 T;  2PJQ A;  4ILU A;  5JPR A;  5JRC B;  4YJ3 E;  5JQR A;  3RC8 A;  3CWZ B;  3UU4 A;  3M29 A;  1FJG T;  3P4Q A;  3O1J A;  3VLH A;  1VCT A;  1J5W A;  4AQG A;  3K3N A;  2YIN A;  4QX8 B;  2RBU X;  3AA1 B;  5AQH B;  3UU3 A;  4PJM A;  5C2T A;  4LF4 T;  4HFI A;  1Y01 A;  2AE9 A;  1H5M A;  1B82 A;  5AQO B;  5L47 A;  2LEH A;  2PFV A;  2XQ6 A;  2RBW X;  3EAB A;  3VRA A;  4DR5 T;  1I6Z A;  3L8R A;  4NVG B;  3VLM A;  3KV5 A;  5JHX A;  4AQF C;  5EK3 A;  1AEJ A;  2OV9 A;  1U5P A;  3PUX F;  3RH3 A;  2EUQ A;  4DR4 T;  3E22 E;  4NVD A;  3HL6 A;  4CVJ A;  1L0V A;  1RYC A;  4JI8 T;  3A8Y C;  3AXJ A;  1U74 A;  4H7A A;  4JMW A;  5FXZ A;  1T98 A;  1FMW A;  1V9D A;  2JQK A;  2PG8 A;  5IHY A;  2E9X C;  1IBM T;  4NVA A;  2I59 A;  3M27 A;  3ZMV B;  3H3A A;  4OYJ A;  5KQ2 A;  3J7Y q;  2ZM2 A;  2LSG A;  4IL9 A;  4DV1 T;  3C4W A;  2PCC A;  4ZOL E;  2NP9 A;  4O4H E;  1KXN A;  4PK4 A;  3G06 A;  3LFM A;  4EYY R;  4ZS2 A;  5LYJ E;  4JEH B;  1U2L A;  4WNK A;  1ZBZ A;  2BO5 A;  1G8X A;  3CCP A;  3RIV A;  4JI3 T;  1UX5 A;  4MLK A;  1IJ6 A;  3M28 A;  2Y6X A;  5FXW A;  1MKR A;  2CCA A;  2IC9 A;  2AS3 A;  1D1B A;  2RC2 X;  4DID B;  5L4E A;  1OED E;  5DJQ C;  4BLK A;  1HCI A;  5J1G A;  1FIO A;  5EJX A;  4KHZ F;  4JM5 A;  2XQ8 A;  5JR9 B;  4PFO A;  4WBN E;  2WY2 A;  4JI5 T;  3CML A;  1AA4 A;  5L3C B;  2KWH A;  4GOU A;  4IE5 A;  3RGL A;  5L3F B;  1D1C A;  3NVO A;  3MKD A;  2XM1 A;  2H89 A;  4A56 A;  3NKZ A;  3O9X A;  3QK6 A;  5BR8 T;  5JDQ A;  3P8C D;  1H5G A;  3JAF A;  4YSZ A;  1LY9 A;  4ZI7 E;  3C4Z A;  1KEY A;  2BG9 B;  5FL0 A;  4O2A E;  3CKD A;  2CE7 A;  2KXP B;  1IZN B;  5KQK A;  3AE3 A;  2E5L T;  3GN5 B;  3NRY A;  5CIC A;  4DMV A;  1CHU A;  5LMN T;  2WM9 A;  4LF6 T;  1ARY A;  2L3L A;  4IDO A;  4ILC A;  5CA1 E;  5JHY A;  1YW0 A;  4I43 B;  4QXH B;  1STQ A;  5AQR B;  4AQF A;  2MAW A;  2AS6 A;  2ZM6 T;  4A5G A;  4AQY T;  2WZI A;  2C5I T;  1ZP0 A;  4EV6 A;  2RBT X;  3A5X A;  5L3D B;  3B13 A;  3FZF B;  3PE0 A;  3N9M A;  5JDG A;  2VB6 A;  3ZEF B;  5L3B B;  5HCM A;  2GHH X;  1HF8 A;  4U3C A;  3S4U A;  2XIF A;  2E9X A;  4EGW A;  4U72 A;  1ARU A;  3EDV A;  2XAJ B;  4P4Q A;  5KX5 E;  1X79 A;  3ONL C;  4NVN B;  2LOS A;  4HWI B;  2ODV A;  3AVR A;  4P0B A;  2Y8D A;  1S35 A;  5CIG A;  4EYU A;  4NPP A;  5CCP A;  4LMK A;  2XQA A;  2BVL A;  2HPJ A;  4JMZ A;  3OYX A;  2X9X A;  1UK5 A;  2LRL A;  3C98 B;  5CIE A;  4HWH A;  3TLW A;  4U2Z A;  4PAE A;  1ARV A;  4H9P C;  5AOG A;  1MMN A;  3NZQ A;  4ZI2 D;  4NVL A;  3F31 A;  5L2L A;  1KXM A;  3SS1 A;  1IYN A;  2XQ5 A;  1H5J A;  3AEG A;  2DI4 A;  3RQU A;  3IBP A;  3R6N A;  2YCG A;  6ATJ A;  4FCS A;  5SYH A;  1AED A;  4C50 A;  3D0T A;  1DSO A;  1SA0 E;  1AEG A;  2R6G F;  3QB5 K;  4BLN A;  1H5K A;  4XVA A;  2LJL A;  2CBJ A;  1BEJ A;  1KNR A;  3ANW B;  5SX0 A;  3MK7 C;  1HX1 B;  1CCJ A;  4NUV A;  5L02 A;  5KDM C;  5ABN A;  4LF8 T;  4HFH A;  4TN7 B;  4L0R A;  3ZCY A;  2VKD A;  1AEE A;  3AE1 A;  1PA2 A;  2A2F X;  4CCP A;  3FJW A;  4DBR A;  3FB2 A;  1KNP A;  4YXD A;  2IC6 A;  2V5C A;  4HGA A;  1YQ4 A;  2CCD A;  3PDY A;  1OWA A;  4ASK A;  2JPF A;  3PJA J;  2NTX A;  1AEU A;  3HDL A;  4EZ4 A;  1AEK A;  2V6Y A;  4Z8X A;  4QHO A;  2IIU A;  1FHF A;  3UUX B;  4AKR B;  4YY3 T;  3CCX A;  5KQ0 A;  3AA6 B;  2BCN A;  4JM6 A;  1OED B;  1W9R A;  2P9B A;  4TWH A;  1A2F A;  2EUT A;  2XAF B;  3UUL A;  3ZMS B;  2M6B A;  3ETV A;  4CI1 B;  3T1Y T;  3ESL A;  3CQC B;  4BA9 A;  1XZY A;  4NVB A;  4H9R C;  4NVC A;  5SW6 A;  4EED A;  1GQE A;  2HHH T;  3CVR A;  3KV9 A;  5CID A;  1H5D A;  4H79 A;  4G63 A;  4DMW A;  3RI5 A;  2N18 A;  2V26 A;  4JI2 T;  4NXN T;  2CMR A;  4WBO A;  2ATJ A;  2CL4 X;  4NVH B;  3DP7 A;  3RYI E;  2MTQ A;  1CMU A;  2XIH A;  2VNX X;  1C8I A;  2GGN X;  4BLY A;  4GYR A;  1GWT A;  3LK3 B;  3UU6 A;  4JYA T;  1D0X A;  4A6Z A;  5SXR A;  5SYW A;  3R84 B;  3VKG A;  4N78 D;  2M6I A;  3W15 B;  1LVK A;  3J9X 1;  1MN2 A;  4QKN A;  5SYJ A;  1H57 A;  3HKB E;  2KT9 A;  1DS4 A;  2V7K A;  3CQX C;  2X66 A;  4GK0 E;  1YYG A;  4GK5 E;  5LB7 B;  5HYA A;  3JAE A;  3ZCG A;  5JDF A;  2D5U A;  1W09 A;  4JLE A;  5HXR A;  2CXD A;  1CCG A;  7ATJ A;  4AIU A;  4GKF A;  2UXX B;  3RKG A;  1UUS A;  3PUQ A;  2C5K T;  2CCQ A;  2RBV X;  1N33 T;  3LJC A;  4AKI A;  2B1E A;  5ABG A;  1WCR A;  5LGN B;  1LRZ A;  3LSV A;  4HTE A;  1WLX A;  1HG2 A;  3UTK A;  3ZMT B;  3AB3 B;  1H7C A;  1HNZ T;  1BEQ A;  4ERR A;  3UQ4 A;  1NEN A;  3L39 A;  5LMU T;  2AS4 A;  5J2U E;  2WDV A;  4U7Y A;  5AQL B;  3HA4 A;  3ZLI A;  5FY1 A;  4O2B E;  4X64 T;  5AQS B;  5HEJ A;  4LF9 T;  5FKY A;  1V0H X;  2XHE B;  3X16 A;  1OAG A;  4JMB A;  3TLS A;  2KSR A;  1ZBY A;  4JUY A;  3VU7 H;  2QRX A;  4K0K T;  2CXL A;  1CMQ A;  3ZJ1 A;  5C8Y E;  3AE5 A;  1MND A;  3WAJ A;  5AMM A;  3E08 A;  4ZI2 C;  1AC8 A;  4WZX A;  4A78 A;  4I50 E;  5EJT A;  4FCN A;  5AL9 A;  2QA7 A;  2UXB T;  4PW8 A;  2ES0 A;  1ARW A;  3IA3 A;  4JMS A;  1KZM A;  1CUN A;  2RC0 X;  2RP4 A;  3RF1 A;  2SPC A;  4DR1 T;  1Z8U A;  4YLH A;  4H9O C;  3VR8 A;  4X65 T;  1ITK A;  4YHH T;  2IHR 1;  1W4W A;  1WYB A;  2W63 A;  1D0Y A;  1BEP A;  3KV6 A;  2A9U A;  1YXR A;  2W67 A;  4CZP A;  2ACX A;  2X08 A;  2RBY X;  3AEE A;  2KWI B;  2HH7 A;  2EUU A;  5LNK A;  4BLL A;  1SDQ A;  3KVB A;  1VRB A;  3RQW A;  2BVM A;  3FXE B;  3TLV A;  2CHN A;  3M26 A;  4G05 A;  4CQI A;  2VQF T;  4TV8 E;  3PJA A;  3PUY F;  3P4S A;  2YK0 A;  5IWA T;  2WAU A;  1U75 A;  2YLJ A;  2ZCA A;  5SXW A;  1HCH A;  3AEA A;  5HEU A;  3ZCH A;  2K48 A;  2QYW A;  4IE6 A;  2IW5 B;  1UX4 A;  3ETU A;  5HXC A;  2EHO B;  3F57 A;  3Q5D A;  5SX7 A;  5F3J A;  3N2G E;  4HFV A;  2WDR A;  4QH5 A;  2FJA A;  4HFB A;  4B6X A;  4ILB A;  1WR6 A;  2Q9Q D;  4JI6 T;  2ZMA A;  3RHW A;  4A98 A;  4X20 E;  3QUJ A;  3AED A;  4KHP T;  4ZI3 D;  3UUB A;  2LT3 A;  2LHN A;  2W23 A;  3NZP A;  4KX6 A;  1BJ9 A;  2DNX A;  3FM1 A;  1HR0 T;  1AEB A;  1KNZ A;  4GKJ T;  3N9L A;  2HPL A;  1H5A A;  2GHE X;  3RIW A;  1UB2 A;  3FM6 A;  2IAK A;  5ADX L;  3R99 A;  1FMV A;  3ZT6 A;  4UVB B;  2IUB A;  2VAS A;  3FBZ A;  4JQM A;  4ATJ A;  2JQQ A;  4PJL A;  3VRB A;  5ABF B;  1JNR A;  3PU8 A;  1QPA A;  2V2E A;  3M5Q A;  5L3G B;  4CVI A;  4CZR A;  3RIA A;  1GZA A;  4CUO A;  2CLY C;  3M65 A;  4H63 V;  4ZXL A;  4IST A;  5SX3 A;  2EUS A;  1BR0 A;  5BMV E;  2JMX A;  3IHR A;  3UFG A;  2BS4 A;  5LCY A;  1N32 T;  4LFC T;  1G73 A;  4CZN A;  5ABE A;  3I9Y A;  4OYK A;  5H9E B;  1E1H B;  2NTY A;  1AEN A;  2W66 A;  5JH7 E;  1M62 A;  4YFS A;  5KQI A;  4ZZB A;  5SW4 A;  1S73 A;  3LG7 A;  2UU9 T;  5F5W A;  1S6V A;  1APX A;  2LSK A;  3PUV F;  4ZZC A;  1J5E T;  1DJ1 A;  4X66 T;  4DR6 T;  4HFD A;  2AXD S;  3O1I A;  3N9Q A;  4HE8 A;  1VCS A;  3ZMU B;  4A7M A;  4LMJ A;  3DJB A;  3A7M A;  3PUR A;  3P4P A;  3FZH B;  3P50 A;  3ZJ2 A;  2H88 A;  5JHZ A;  2VCS A;  2RPA A;  2WCA A;  4NVF A;  5LOV E;  5FVL A;  3K3O A;  5F8P A;  4IDN A;  4X62 T;  4JQK A;  1ZV4 X;  2D0T A;  5L4H A;  3AE6 A;  1HNW T;  1ZOY A;  2XJ5 A;  3ZYM A;  3X1D A;  3UUM A;  5LHI B;  3VR9 A;  2VKJ A;  5LG3 A;  4NVO B;  1H5E A;  1MMA A;  4P1N A;  4GYS A;  4DV6 T;  2VL0 A;  4JI0 T;  2LSI A;  4JMA A;  1R8I A;  1AJ3 A;  3F2E A;  5L86 A;  2VWA A;  2E3A A;  4DO0 A;  1BR2 A;  3PU3 A;  3HKE E;  3VLL A;  3RIU C;  2XZE A;  3PTR B;  5JDH A;  1CCL A;  2E9X B;  5LA6 E;  2GHK X;  2EUO A;  5FNB A;  2WP9 A;  4IDQ A;  4B3T T;  1ARX A;  4TV9 E;  4BLZ A;  3MA9 A;  1SBM A;  4NVE A;  5HAX A;  2DCF A;  2MOZ A;  1FEW A;  5HWY A;  2V5D A;  2VUR A;  5JDN A;  2BG9 A;  2NW8 A;  4KMC A;  2UUB T;  5HEH A;  4FDQ A;  4C51 A;  2VNZ X;  1KRJ A;  4CXX A;  2BS2 A;  1CCE A;  3U78 A;  4LML A;  3X1L F;  2MBG A;  4DR2 T;  4HKA A;  4X1Y E;  4YJ2 E;  5CGM A;  3V5U A;  2XQ4 A;  3GN5 A;  1BR1 A;  3ZPO A;  1U2K A;  2JIW A;  3AE7 A;  1GWU A;  3C64 A;  2VKH A;  4EXT A;  2XJ6 A;  2Q9Q C;  3LK2 B;  1MMD A;  2WWU A;  3N9P A;  2F4V T;  5JQG E;  2AS2 A;  4PJJ A;  1ML2 A;  1CYF A;  1O3X A;  4UF0 B;  4ZI3 C;  5DQV A;  4LFB T;  3WNU A;  3ZN1 B;  1BES A;  4U2Y A;  3FHN A;  2E39 A;  1T7S A;  5SX0 B;  3K3Q C;  2JTI A;  2KZ7 B;  2UUC T;  5CIF A;  1OXZ A;  1ZKE A;  1W0A A;  3BQL A;  1DJ5 A;  2VKO A;  3Q5W A;  3ABV A;  2CM0 A;  4DVD A;  5LG4 A;  1CCI A;  3RC3 A;  4UXN B;  2WSS S;  2L9Q A;  1AEM A;  3OJA A;  4ILA A;  4X1K E;  4PNI A;  2RA1 A;  3M2D A;  2DWG A;  5CFB A;  3ONJ A;  4CZO A;  2J1D G;  3FXD B;  2CWO A;  1QUU A;  2XI6 A;  2V6Y B;  4JM8 A;  3M2E A;  5LP6 E;  4UVA B;  5FNE A;  4K0U A;  5L3E B;  2WDQ A;  5FNV E;  1KF6 A;  3KBU A;  1XDP A;  2E3B A;  4JBW F;  5CIH A;  4KUM B;  4F8H A;  2XSB A;  4NVM B;  4ZHQ E;  1X9B A;  4DUZ T;  1SOG A;  4O4L E;  3RIU A;  4JPU A;  2X51 A;  2YOE A;  5H6R B;  2XQY A;  1A2G A;  2WZH A;  4B3S T;  3RYF E;  5DQW A;  5LGU B;  4YSY A;  5ETW A;  3VHL A;  4JMT A;  3ZYK A;  3ANW A;  5FP3 A;  4USC A;  3B5M A;  5AQJ B;  5EK2 A;  3CQG B;  4JI4 T;  2HN2 A;  4JQJ A;  2W62 A;  1MIV A;  3C51 A;  3WA8 A;  2V6X A;  4IE0 A;  4YT0 A;  1XDO A;  3UFE A;  5EZY E;  5H9F B;  3ZYL A;  3ONX A;  1GWO A;  4XV8 A;  4O8S A;  2VVN A;  3K8P C;  2AQD A;  2K5B B;  4L5G A;  1H5F A;  4LF5 T;  4YHJ A;  4UEM A;  4TX5 A;  1UGO A;  2Q9Q A;  3AAI A;  2WMO A;  3FBL A;  2CRB A;  3Q5E A;  4V1A v;  2J47 A;  2XM2 A;  5IUX A;  1BEK A;  4TUY E;  4DV5 T;  4X5T A;  3B57 A;  3M2F A;  2C5J A;  2EUN A;  3HKD E;  5KXJ A;  3CX6 B;  1I94 T;  3ZCI A;  3AE9 A;  4P09 A;  1U2J A;  3PUS A;  1HTJ F;  4FJO A;  2UXD T;  4JI7 T;  1YZR A;  1UCU A;  2W4X A;  1DU2 A;  2XIL A;  4JM9 A;  3KVA A;  5ABO A;  1AEV A;  2CBI A;  5AQG B;  4OFZ A;  4OX9 T;  3AA0 B;  3WXO A;  4XV5 A;  3AA7 B;  2XTL A;  4DV4 T;  1BVA A;  3RRW A;  3OTO T;  3V5S A;  1YQ3 A;  3Q2M A;  4DV7 T;  1H5H A;  4ANJ A;  3ZST A;  1IJ5 A;  3T1H T;  1HSR A;  3N5L A;  5SXX A;  1CPF A;  1HS7 A;  5FL1 A;  3Q9D A;  4NUU A;  1SE7 A;  2D9D A;  2B10 A;  5CD4 J;  4Z91 A;  4MBQ A;  2ZOP A;  2JQH A;  4IE7 A;  2X0H A;  5AQM B;  2Z6E A;  1YD8 G;  2XUE A;  2WU5 A;  4Z90 A;  5JDL A;  3I1A A;  4AI6 A;  2NR4 A;  1GZB A;  3VLJ A;  2WBL A;  3IEE A;  2X9H A;  3FKG A;  3UT2 A;  3MJX A;  2X9W A;  4WW0 A;  3TKL B;  2EHO C;  4ZS3 A;  3RIF A;  3LBX A;  4CN1 A;  2LSY A;  2OEB A;  4BM4 A;  2VO2 X;  5JRE A;  2CHO A;  4YTM A;  4AXP A;  5AQP B;  1CPG A;  1DCC A;  3KV4 A;  3UU8 A;  2PBI A;  1H3J A;  4JZA A;  3ZKR A;  5LBQ B;  2BKP A;  3M2C A;  2V7J A;  2BZB A;  1W4Y A;  1QSD A;  1ARP A;  2BDE A;  4CI2 B;  5KMG P;  1ZEE A;  4ISS A;  2ZLY A;  4MAL A;  1AEF A;  4HFC A;  3QOF A;  4NIQ A;  4EB6 E;  5J0Z A;  5HCJ A;  3N2K E;  4DV0 T;  3QB5 A;  2XSA A;  4TWF A;  4C91 A;  4H9Q C;  5HXE A;  2NW7 A;  3MZK B;  2BG9 E;  1W0B A;  4FEF A;  5SYY A;  3BK9 A;  3AAE B;  5SW5 A;  3JC6 D;  2DL1 A;  2ANZ A;  5SYV A;  2CCP A;  1QLB A;  2LKG A;  4H63 H;  1N36 T;  1UUR A;  1XNR T;  5HWX A;  1AEQ A;  3PUZ F;  2LRK A;  1CK6 A;  2RBX X;  5FMN A;  4HWF A;  1GW2 A;  3M23 A;  3M2H A;  5LHG B;  3GA8 A;  2W61 A;  2X9Y A;  4L9I A;  3ZSS A;  2GB8 A;  1J1J A;  3I0Q A;  3CX8 B;  5AQF B;  2YEV C;  2QGS A;  5HEG A;  4DR7 T;  3FM4 A;  1EZ3 A;  4M1P A;  4CN6 A;  5CB4 E;  3O4X E;  3KFW X;  4BM2 A;  3AEC A;  1YKE B;  2VK9 A;  4OK0 A;  2BKO A;  3LDQ B;  1YKH B;  1HFA A;  3AXJ B;  4QWN B;  5JR9 C;  3SWH A;  1KK7 A;  2MYS A;  1CCK A;  5SXQ A;  4BAY B;  3PUW F;  2X68 A;  1GX2 A;  4IRE A;  4U33 A;  2EHO A;  1Z53 A;  3M25 A;  2WQY A;  3L3P A;  4IDZ A;  5LHH B;  2V8S V;  1CMT A;  1DSE A;  5DAB A;  2BBJ A;  2YDQ A;  2YU2 A;  2HN1 A;  3ZC1 A;  5JRC A;  3M2B A;  5CJH A;  5EK4 A;  2VCN A;  2BG9 C;  1KFY A;  4U74 A;  3E0Z A;  2KMF A;  1T72 A;  2D2S A;  5A1L A;  3TLT A;  1KOK A;  1SHZ C;  2RC1 X;  4I55 E;  3UU5 A;  3HKC E;  4J2C A;  3OPC A;  3IF8 B;  2L8K A;  5HXH A;  2YN6 A;  3UT5 E;  5FXX A;  2N9D A;  3M2I A;  3M2G A;  3FZL B;  3NBX X;  2VQE T;  4QXB B;  3P4R A;  2DHR A;  5HEO A;  1HG5 A;  4U31 A;  5ABF A;  4IGU A;  4NVI B;  1IBK T;  4OQ7 A;  2PTF A;  2XY8 B;  4UV8 B;  3E2N A;  5LJM A;  4GED A;  3BQK A;  4CXY A;  1AES A;  4H9N C;  2LM9 A;  3QC9 A;  4GKK T;  4PAG A;  2B76 A;  3KIN B;  3FMU A;  5KQ6 A;  2H7O A;  2YDR A;  5L05 A;  1SUM B;  3RX6 A;  4B3M T;  5JDM A;  2BBH A;  2K24 A;  1CCA A;  2W2U A;  3C4X A;  2I6H A;  4XBF B;  1AEO A;  2V7M A;  2JMH A;  4LFA T;  1MIW A;  4DV2 T;  2XJ7 A;  4HWD A;  5CJ5 A;  2YU1 A;  3OYZ A;  2H7V C;  4XV4 A;  3BQI A;  4ADZ A;  1ABV A;  1CPD A;  3PUA A;  1H58 A;  3CPZ A;  4EOZ B;  4CI3 B;  3OBV E;  1Z0P A;  2X07 A;  1YZP A;  2VL8 A;  4AIS A;  1LLP A;  5AQT B;  2V7I A;  4I0U A;  4QH4 A;  2CLY B;  1NEK A;  3AE2 A;  4XV6 A;  2XQ9 A;  4OHF A;  3UUN A;  2PCB A;  4COF A;  5JR9 A;  3RRC A;  2E5V A;  3UW8 A;  5KQ3 A;  2K9A A;  3P7I A;  5LGT B;  4IHJ E;  5SYL A;  3ZT7 A;  2J62 A;  4QX7 B;  3SRZ A;  2DWK A;  1E2A A;  4LF7 T;  4AKH A;  4AKL A;  4CCX A;  4YSX A;  5D6M A;  2WMN A;  2XAS B;  5HXS A;  4HEA A;  1WFD A;  4BLX A;  1CCP A;  3N9O A;  1US7 B;  3JC6 C;  4TNW A;  1XMQ T;  2OA5 A;  1AC4 A;  4DBQ A;  1D1A A;  4JPL A;  1DSP A;  4PK5 A;  3WAK A;  4MFR A;  2W00 A;  5FY7 A;  4WYV A;  2CA5 A;  2J4G A;  4HFE A;  1DSG A;  5AQK B;  5IYZ E;  2BS3 A;  3RKO A;  2FJE A;  3AE8 A;  2H3R A;  3HI2 A;  4O4J E;  1OED C;  3EAM A;  5SXT A;  4B3R T;  5FY0 A;  4YTP A;  5CA0 E;  5JTG A;  1MIY A;  4G2A A;  2EHO D;  4BJN A;  2ICV A;  2Y6B A;  2IA8 A;  4NXM T;  2K3W A;  3M2A A;  1B85 A;  1T8B A;  2N2N A;  3NWI A;  1SJ2 A;  4PFP A;  2A3D A;  3I0O A;  1EBE A;  5SX6 A;  3CIR A;  5E0O A;  5SX2 A;  4F6R C;  2XJ8 A;  2JRK A;  4UEL A;  1S94 A;  1LY8 A;  5KSK A;  3I9W A;  5AQU B;  2UUA T;  3CK6 A;  1XWM A;  4A71 A;  2XAQ B;  4QXC B;  5SYI A;  2NWB A;  2E8I A;  4QYZ B;  3M8M A;  3RPU A;  1YYD A;  2NW9 A;  4XAX B;  4EAH A;  5ALA A;  2JQ9 A;  3EI0 A;  1QO4 A;  1IBL T;  4NVJ B;  2X0L B;  3SFE A;  4UF0 A;  2WSS V;  3Q3U A;  2V7L A;  2X67 A;  4PJN A;  2LM2 A;  3AVS A;  2UXC T;  3WI3 A;  1CPE A;  2LSJ A;  4IT4 A;  2FUP A;  1LKX A;  4E7Z A;  4JB4 A;  3SOL A;  4O4I E;  2LLY A;  4JN0 A;  1CCC A;  5FYM A;  3FZM B;  2WWV A;  3MAC A;  1H5I A;  2M67 A;  3M3Z B;  3ZMZ B;  1LYC A;  4YTN A;  3DTO A;  4EZH A;  3GWH A;  2XAG B;  1Y64 B;  5LJN A;  2GK9 A;  5ABQ A;  2BKN A;  4QH1 A;  3P4W A;  4U7I A; 
#chains in the Genus database with same CATH homology
 1B80 A;  4AQF A;  5JRE A;  4IE4 A;  1GZA A;  4CUO A;  2Q9Q B;  4BM3 A;  2CLY C;  3R98 A;  3M65 A;  4H63 V;  2AS6 A;  2Y6A A;  4IST A;  4AXP A;  5SX3 A;  4A5G A;  1CPG A;  2EUS A;  4AQG A;  4UV9 B;  1WRD A;  3T8O A;  2C5I T;  1BR0 A;  1DCC A;  3KV4 A;  5BMV E;  2RBT X;  3IHR A;  3A5X A;  2PBI A;  2JJ9 A;  5LCY A;  5L3D B;  3B13 A;  4EIW A;  3PE0 A;  1H3J A;  2A72 A;  3L09 A;  4JZA A;  3N9M A;  5KQH A;  5JDG A;  2VB6 A;  2CXF A;  2EUR A;  4IIJ E;  3ZEF B;  1G73 A;  4CZN A;  5LBQ B;  2KLQ A;  5L3B B;  1LYK A;  3I9Y A;  2GHH X;  3M2C A;  1HF8 A;  5H9E B;  1E1H B;  1MNE A;  2BZB A;  1AEN A;  1W4Y A;  2NTY A;  2V7J A;  2Y48 B;  1QSD A;  3KBT A;  3S4U A;  2XIF A;  1BEM A;  1CMP A;  2E9X A;  3N9N A;  1ARP A;  3ZN0 B;  5JH7 E;  4I50 E;  2LOP A;  4U72 A;  1ZHC A;  4YFS A;  2BDE A;  4CI2 B;  5KMG P;  5KQI A;  1ARU A;  2XAH B;  3EDV A;  1AET A;  2XAJ B;  5H6Q B;  4CXW A;  1ZEE A;  5SW4 A;  4ISS A;  4P4Q A;  5KX5 E;  1S73 A;  1X79 A;  4UIG A;  2ZLY A;  3LG7 A;  1AEF A;  4MAL A;  4NVN B;  2GHD X;  2LE8 A;  1S6V A;  2LOS A;  1APX A;  4EB6 E;  2LSK A;  2ODV A;  3AVR A;  4P0B A;  4BM4 A;  3NRX A;  2Y8D A;  3N2K E;  1DJ1 A;  7CCP A;  2B11 A;  1AEH A;  1S35 A;  3C50 A;  2BOQ A;  5CIG A;  1HX8 A;  1IAP A;  3O1I A;  3PUG A;  4JEU B;  4EYU A;  3N9Q A;  5CCP A;  1LGA A;  3NRY A;  4C91 A;  1QGJ A;  2KND A;  4KBM B;  2BVL A;  4HE8 A;  2HPJ A;  4H9Q C;  4JMZ A;  3OYX A;  5HXE A;  2NW7 A;  3MZK B;  3ZMU B;  4A7M A;  5KSF A;  5TAO A;  3DJB A;  2X9X A;  4CZZ B;  2AS1 A;  3C98 B;  1MKQ A;  5CIE A;  4FEF A;  5SYY A;  3BK9 A;  4NFG A;  3AAE B;  3PUR A;  5SW5 A;  4PAE A;  5SYU A;  4I4T E;  3JC6 D;  1ARV A;  2ANZ A;  5AOG A;  5SYV A;  1MMN A;  2CCP A;  4H9P C;  3NZQ A;  5JHZ A;  4H63 H;  3ZJ2 A;  4ZI2 D;  5LXT E;  5HWX A;  1AEQ A;  4NVL A;  2D0U A;  3F31 A;  5L2L A;  1KXM A;  3SS1 A;  2VCS A;  5SXS A;  1CK6 A;  4X1I E;  1IYN A;  5J2T E;  4NVF A;  1H5J A;  2DI4 A;  5LOV E;  2RBX X;  2NOX A;  3IBP A;  3R6N A;  4U7U B;  3K3O A;  5FMN A;  5F8P A;  2YCG A;  6ATJ A;  4FCS A;  5SYH A;  1AED A;  5JVD E;  4JMV A;  4C50 A;  1GW2 A;  3D0T A;  4UVC B;  3M23 A;  3M2H A;  1DSO A;  1SA0 E;  4CZQ A;  5LHG B;  1AEG A;  2B12 A;  2E9X D;  3GA8 A;  4PK6 A;  4JQK A;  2W61 A;  2X9Y A;  2GHC X;  4BM0 A;  1ZV4 X;  2D0T A;  4L9I A;  1H55 A;  1NAF A;  2GB8 A;  1H5K A;  4BLN A;  4C90 A;  4XVA A;  2LJL A;  2XJ5 A;  3I0Q A;  3ZYM A;  3CX8 B;  5LHI B;  3UUM A;  2G0U A;  2YEV C;  2QGS A;  1BEJ A;  4MHC A;  3FM4 A;  3ANW B;  1EZ3 A;  2VKJ A;  4M1P A;  5SX0 A;  3MK7 C;  5CB4 E;  3O4X E;  4DND A;  1VOM A;  4NVO B;  1H5C A;  1CCJ A;  4NUV A;  5L02 A;  3LBX B;  1H5E A;  5KDM C;  5CIB A;  5ABN A;  4BM2 A;  1MMA A;  3KFW X;  4TN7 B;  4GYS A;  1YKE B;  3ZCY A;  4L0R A;  2VK9 A;  2LSI A;  5GON E;  4JMA A;  2VKD A;  1AEE A;  4OK0 A;  1PA2 A;  1AJ3 A;  2A2F X;  4CCP A;  3F2E A;  3FJW A;  5L86 A;  3H37 A;  4HN9 A;  2VWA A;  2E3A A;  1B7T A;  1YKH B;  3FB2 A;  1HFA A;  4DBR A;  4DO0 A;  2IC6 A;  4HGA A;  1BR2 A;  1D0Z A;  2UXN B;  3PU3 A;  2CCD A;  2ZM8 A;  4QWN B;  5JR9 C;  3SWH A;  3HKE E;  3PDY A;  1OWA A;  1WYC A;  4ASK A;  1KK7 A;  2MYS A;  2JPF A;  3VLL A;  1CCK A;  5SXQ A;  4OYK A;  4BAY B;  2NTX A;  1SCH A;  1AEU A;  2X68 A;  3HDL A;  3GMI A;  4TZ4 C;  3PTR B;  4EZ4 A;  1AEK A;  5JDH A;  1GX2 A;  4QHO A;  4Z8X A;  3OKQ A;  1CCL A;  1FHF A;  2E9X B;  6CCP A;  2GHK X;  2EHO A;  5LA6 E;  3UUX B;  4AKR B;  2EUO A;  5FNB A;  1CCB A;  1Z53 A;  5M4Y A;  3CCX A;  1ARX A;  2WD4 A;  5KQ0 A;  3M25 A;  1LVF A;  2KIN B;  3AA6 B;  4TV9 E;  3L3P A;  4IDZ A;  2BCN A;  4BLZ A;  3MA9 A;  4JM6 A;  3EVY A;  2ZM0 A;  1SBM A;  5LHH B;  1CMT A;  4NVE A;  1DSE A;  2P9B A;  5DAB A;  5HAX A;  1A2F A;  2EUT A;  2XAF B;  3UUL A;  3ZMS B;  2DCF A;  2DLR A;  2YU2 A;  2MOZ A;  3ETV A;  3VLI A;  3ZC1 A;  4CI1 B;  3ESL A;  3CQC B;  4BA9 A;  5JRC A;  3M2B A;  4NVB A;  5CJH A;  1FEW A;  4H9R C;  4JPT A;  5HWY A;  5EK4 A;  4XV7 A;  4NVC A;  5SW6 A;  2VCN A;  4U74 A;  4E7S A;  3E0Z A;  3CVR A;  3EUH A;  5JDN A;  2KMF A;  5SYX A;  2D2S A;  5CID A;  3KV9 A;  1ATJ A;  1BGP A;  1H5D A;  1JDR A;  4H79 A;  4G63 A;  4DMW A;  5A1L A;  2NW8 A;  1KOK A;  4KMC A;  1SHZ C;  2N18 A;  2RC1 X;  2VKA A;  4FDQ A;  2V26 A;  4C51 A;  2VNZ X;  3HKC E;  4I55 E;  4J2C A;  1KRJ A;  4BJM A;  4CXX A;  3IF8 B;  2L8K A;  1CCE A;  1JCI A;  3U78 A;  5AFU L;  5HXH A;  2MBG A;  4HKA A;  3UT5 E;  4X1Y E;  3AAA B;  4YJ2 E;  3V5U A;  5FXX A;  3GN5 A;  1BR1 A;  2CMR A;  1MK8 A;  3M2G A;  3M2I A;  2N9D A;  3NBX X;  4WBO A;  1U2K A;  2ATJ A;  2CL4 X;  4QXB B;  4NVH B;  3ZPO A;  2W0G A;  3DP7 A;  3RYI E;  2EUP A;  2DHR A;  1U4Q A;  3EXB A;  1HG5 A;  2MTQ A;  4IGU A;  1CMU A;  4NVI B;  1GWU A;  2XIH A;  2VKH A;  3C64 A;  2VNX X;  1C8I A;  2B0Z A;  4OQ7 A;  4EXT A;  4UV8 B;  2GGN X;  4BLY A;  2XJ6 A;  3E2N A;  5LJM A;  2Q9Q C;  3LK2 B;  3MXZ A;  1MMD A;  1GWT A;  2WWU A;  4GED A;  3LK3 B;  4GYR A;  3N9P A;  3BQK A;  4CXY A;  1AES A;  4H9N C;  5JQG E;  2LM9 A;  2AS2 A;  1D0X A;  3QC9 A;  4PAG A;  4PJJ A;  1ML2 A;  3CX7 B;  3KIN B;  1CYF A;  1O3X A;  4UF0 B;  4ZI3 C;  3FMU A;  3RYH E;  5KQ6 A;  4A6Z A;  5DQV A;  5SXR A;  5SYW A;  2H7O A;  3WNU A;  3HR0 A;  3ZN1 B;  3R84 B;  4H9S E;  5L05 A;  1BR4 A;  3VKG A;  1BES A;  4N78 D;  2ODU A;  3FHN A;  3E2O A;  4XZC A;  3RX6 A;  3W15 B;  1LVK A;  5JDM A;  2E39 A;  3J9X 1;  3Q5X A;  2K24 A;  4FI5 A;  3LK4 2;  1CCA A;  3VLK A;  1MN2 A;  4QKN A;  2N1G A;  5SYJ A;  5SX0 B;  4JQN A;  3K3Q C;  3C4X A;  2JTI A;  2KZ7 B;  1H57 A;  3HKB E;  2KT9 A;  3VKH A;  5CIF A;  1OXZ A;  1DS4 A;  1AEO A;  1OAF A;  2CYP A;  1ZKE A;  2RBZ X;  2V7M A;  4XBF B;  2JMH A;  2V7K A;  3BQL A;  3CQX C;  4AKG A;  1MIW A;  1MN1 A;  1DJ5 A;  2X66 A;  4GK0 E;  2VKO A;  1YYG A;  2C0S A;  3Q5W A;  3KDS E;  4GK5 E;  5HYA A;  2CM0 A;  2YU1 A;  2H7V C;  3OYZ A;  4DVD A;  5LG4 A;  3ZCG A;  3O1H A;  3ATJ A;  1CCI A;  1NWM X;  4XV4 A;  5JDF A;  3ZC0 A;  2D5U A;  5LBM A;  3RYC E;  3RC3 A;  3BQI A;  4JLE A;  4UXN B;  2CXD A;  5HXR A;  4ADZ A;  4NVK B;  1MNP A;  2VCF X;  2V23 A;  4KP3 C;  1CCG A;  2Y5A A;  3EDU A;  2L9Q A;  4GIW A;  7ATJ A;  1CPD A;  1AEM A;  3OJA A;  4X1K E;  3PUA A;  1MMG A;  1H58 A;  2UXX B;  2RA1 A;  4PNI A;  3PUQ A;  3M2D A;  2DWG A;  2C5K T;  3CPZ A;  4BM1 A;  2CCQ A;  4EOZ B;  4CI3 B;  2RBV X;  4CZO A;  3OBV E;  3LJC A;  4AKI A;  4AI6 A;  2J1D G;  3FXD B;  1Z0P A;  2CWO A;  4P0A A;  2X07 A;  5SYK A;  1QUU A;  2LHR A;  2XI6 A;  2CEA A;  1YZP A;  2B1E A;  2VL8 A;  5SX1 A;  5LGN B;  3ZCJ A;  1H5L A;  1LLP A;  4JM8 A;  2CWY A;  1LRZ A;  3M2E A;  2V1D B;  5LP6 E;  2V7I A;  4UVA B;  5FNE A;  5FXV A;  4HTE A;  1WLX A;  4K0U A;  2JMK A;  3U3I A;  3N2O A;  5L3E B;  2CLY B;  1HG2 A;  5FNV E;  2CEP A;  3UTK A;  3KBU A;  3ZMT B;  3AB3 B;  2E3B A;  1H7C A;  4XV6 A;  4BJN A;  2PJQ A;  4ILU A;  4OHF A;  1BEQ A;  5JPR A;  5CIH A;  4KUM B;  3UUN A;  2PCB A;  4ERR A;  5JRC B;  2AS4 A;  4YJ3 E;  5JQR A;  3RC8 A;  5J2U E;  5JR9 A;  4NVM B;  3RRC A;  3HA4 A;  3CWZ B;  3UW8 A;  5KQ3 A;  1SOG A;  3M29 A;  5FY1 A;  3ZLI A;  4O2B E;  2K9A A;  3O1J A;  4O4L E;  3P7I A;  4JPU A;  3VLH A;  5SYL A;  4IHJ E;  5LGT B;  2X51 A;  1V0H X;  4QX7 B;  3K3N A;  2XHE B;  3X16 A;  2RBU X;  2XQY A;  2YIN A;  4QX8 B;  3AA1 B;  5H6R B;  3SRZ A;  1OAG A;  4JMB A;  2DWK A;  1A2G A;  4PJM A;  4AKH A;  4AKL A;  1H5M A;  3RYF E;  1B82 A;  1ZBY A;  4JUY A;  3VU7 H;  2LEH A;  2PFV A;  5DQW A;  5LGU B;  4CCX A;  5ETW A;  3VHL A;  2CXL A;  4JMT A;  3ZYK A;  3ANW A;  5D6M A;  2WMN A;  1CMQ A;  5FP3 A;  2RBW X;  3ZJ1 A;  4USC A;  5C8Y E;  2XAS B;  5HXS A;  4NVG B;  3VLM A;  1MND A;  5JHX A;  3KV5 A;  4HEA A;  3WAJ A;  5AMM A;  4BLX A;  5EK2 A;  4AQF C;  1CCP A;  3N9O A;  5EK3 A;  1AEJ A;  3E08 A;  1US7 B;  3JC6 C;  3CQG B;  4JQJ A;  4ZI2 C;  1AC8 A;  1U5P A;  2W62 A;  2EUQ A;  3RH3 A;  1MIV A;  4A78 A;  3E22 E;  4NVD A;  3HL6 A;  5EJT A;  1AC4 A;  4FCN A;  1RYC A;  4CVJ A;  2OA5 A;  5AL9 A;  1D1A A;  2QA7 A;  3C51 A;  4PW8 A;  3WA8 A;  4PFP A;  4DBQ A;  2ES0 A;  1ARW A;  4JPL A;  1U74 A;  4IE0 A;  1DSP A;  4H7A A;  4JMW A;  4JMS A;  3UFE A;  5EZY E;  5H9F B;  4PK5 A;  5FXZ A;  1T98 A;  3ONX A;  3ZYL A;  3WAK A;  1GWO A;  1FMW A;  4MFR A;  1KZM A;  1CUN A;  2RC0 X;  2RP4 A;  4XV8 A;  1V9D A;  4O8S A;  2W00 A;  2PG8 A;  2SPC A;  3K8P C;  2CA5 A;  2AQD A;  5FY7 A;  5IHY A;  2E9X C;  1DSG A;  4YLH A;  4NVA A;  2K5B B;  4L5G A;  4H9O C;  1H5F A;  1ITK A;  5IYZ E;  4YHJ A;  2I59 A;  3M27 A;  3RKO A;  1W4W A;  1WYB A;  4UEM A;  2W63 A;  2H3R A;  3HI2 A;  1D0Y A;  4TX5 A;  2Q9Q A;  1BEP A;  4O4J E;  3ZMV B;  3AAI A;  3KV6 A;  2WMO A;  5SXT A;  3H3A A;  4OYJ A;  5KQ2 A;  5FY0 A;  3J7Y q;  3FBL A;  5CA0 E;  2ZM2 A;  1MIY A;  2LSG A;  4G2A A;  2EHO D;  3C4W A;  2PCC A;  2ICV A;  4V1A v;  2Y6B A;  2IA8 A;  4CZP A;  2ACX A;  4ZOL E;  2NP9 A;  2X08 A;  4O4H E;  1KXN A;  3M2A A;  4PK4 A;  3LFM A;  1B85 A;  1BEK A;  2RBY X;  4EYY R;  4ZS2 A;  4TUY E;  4JEH B;  2KWI B;  1U2L A;  5LYJ E;  2HH7 A;  4WNK A;  1ZBZ A;  2EUU A;  2N2N A;  1G8X A;  3CCP A;  3RIV A;  5LNK A;  4BLL A;  1SDQ A;  1SJ2 A;  3M2F A;  1UX5 A;  2EUN A;  2A3D A;  2C5J A;  1EBE A;  1VRB A;  3B57 A;  3HKD E;  3I0O A;  3KVB A;  2BVM A;  3FXE B;  3CX6 B;  4MLK A;  1IJ6 A;  3M28 A;  2Y6X A;  5SX6 A;  5E0O A;  5SX2 A;  5FXW A;  3ZCI A;  4F6R C;  1MKR A;  2CCA A;  2IC9 A;  2AS3 A;  2XJ8 A;  2JRK A;  3M26 A;  4P09 A;  4G05 A;  1D1B A;  1U2J A;  2RC2 X;  4CQI A;  4UEL A;  1S94 A;  3PUS A;  1LY8 A;  5KSK A;  1HTJ F;  4TV8 E;  4FJO A;  3I9W A;  1YZR A;  1UCU A;  5DJQ C;  4A71 A;  2YK0 A;  4BLK A;  1HCI A;  2WAU A;  2XAQ B;  4QXC B;  1FIO A;  5SYI A;  2XIL A;  5J1G A;  4JM9 A;  1U75 A;  2YLJ A;  2ZCA A;  5EJX A;  4JM5 A;  3KVA A;  5SXW A;  5ABO A;  1HCH A;  2NWB A;  2E8I A;  4QYZ B;  3M8M A;  3RPU A;  5JR9 B;  1YYD A;  4PFO A;  4WBN E;  3ZCH A;  1AEV A;  2K48 A;  4XAX B;  4IE6 A;  2IW5 B;  2NW9 A;  4EAH A;  5ALA A;  1UX4 A;  4ZHQ E;  1QO4 A;  3CML A;  1AA4 A;  3ETU A;  5HXC A;  5L3C B;  4NVJ B;  2KWH A;  2X0L B;  2EHO B;  4GOU A;  4OFZ A;  3AA0 B;  3F57 A;  4IE5 A;  4UF0 A;  3WXO A;  5L3F B;  4XV5 A;  5SX7 A;  2WSS V;  3Q3U A;  3AA7 B;  1D1C A;  3N2G E;  4HFV A;  4B6X A;  5F3J A;  2V7L A;  2X67 A;  2XTL A;  3MKD A;  4PJN A;  3AVS A;  4A56 A;  1WR6 A;  2Q9Q D;  3WI3 A;  2ZMA A;  1BVA A;  1CPE A;  3O9X A;  3RRW A;  3QK6 A;  3V5S A;  3Q2M A;  1H5H A;  2LSJ A;  4X20 E;  3QUJ A;  1IJ5 A;  4ANJ A;  1HSR A;  5JDQ A;  3N5L A;  4ZI3 D;  5SXX A;  1LKX A;  3P8C D;  1CPF A;  1H5G A;  2LT3 A;  4E7Z A;  1LY9 A;  4JB4 A;  2LHN A;  2W23 A;  3C4Z A;  3SOL A;  3NZP A;  4ZI7 E;  1HS7 A;  3Q9D A;  4NUU A;  2B10 A;  1BJ9 A;  2DNX A;  5CD4 J;  3FM1 A;  1KNZ A;  1AEB A;  4O4I E;  4MBQ A;  4JN0 A;  3N9L A;  2HPL A;  1H5A A;  2GHE X;  1CCC A;  4O2A E;  3RIW A;  1UB2 A;  3FM6 A;  2IAK A;  5FYM A;  5ADX L;  4IE7 A;  3R99 A;  3CKD A;  1FMV A;  3MAC A;  2CE7 A;  1H5I A;  2M67 A;  2KXP B;  2Z6E A;  3ZMZ B;  1YD8 G;  2XUE A;  1LYC A;  1IZN B;  5KQK A;  3DTO A;  4UVB B;  4EZH A;  5JDL A;  3I1A A;  3GWH A;  2XAG B;  3GN5 B;  2VAS A;  1GZB A;  3VLJ A;  1Y64 B;  5CIC A;  2WBL A;  4JQM A;  3FBZ A;  4ATJ A;  3IEE A;  4DMV A;  2JQQ A;  4PJL A;  5LJN A;  2GK9 A;  2WM9 A;  2X9H A;  1ARY A;  3FKG A;  3UT2 A;  2L3L A;  5CA1 E;  5ABQ A;  3MJX A;  2X9W A;  4WW0 A;  3TKL B;  3PU8 A;  2EHO C;  1QPA A;  2V2E A;  3M5Q A;  5JHY A;  1YW0 A;  4QXH B;  4I43 B;  3LBX A;  4ZS3 A;  5L3G B;  4CVI A;  4CZR A;  2LSY A;  1STQ A;  2VO2 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...