4CZQA

Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with cadmium
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
367
structure length
367
Chain Sequence
PTAVCSDGTRVSNAVCCDFVSLGQDLQSMVLQGDCGEDAHEIIRLTFHDAVAISRKLGPSAGGGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSLHPTISAGDLVQFAGAVALSNCPGAPRVQFLAGRPNHTIAAIDGLIPEPQDNVTSILERFDDAGGFTPFEVVSLLASHTIARADKVDPTLDAAPFDTTPFTFDSQIFLEVLLKGVGFPGLDNNTGEVSSPLPLGDTSTGGKDTGLMRLQSDFALAHDPRTACFWQGFVDQQEFMSQSFASAFAKLAVLGHNTDDLIDCSEVVPVPKPAVDKPTTFPATTGPQDLELSCLAERFPTLSVDPGAQETLIPHCSDGLENCTSVQFSGPATDSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Implications of the C-Terminal Tail in the Catalytic and Stability Properties of Manganese Peroxidases from Ligninolytic Fungi
pubmed doi rcsb
molecule keywords EXTRALONG MANGANESE PEROXIDASE
molecule tags Oxidoreductase
source organism Ceriporiopsis subvermispora
total genus 113
structure length 367
sequence length 367
ec nomenclature ec 1.11.1.13: Manganese peroxidase.
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4czqA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4czqA01
1H5EA 4XVAA 1KOKA 1LYKA 4XV4A 3VLKA 1MK8A 1AEHA 5JHYA 5SYYA 4XV7A 1CCPA 1JDRA 2RC0X 1H58A 2VKAA 5SYIA 5SYHA 7CCPA 2B10A 4JM8A 2VCFX 2BOQA 4JN0A 4NVDA 1ARUA 1PA2A 2Y6BA 2XILA 2CCAA 3E2OA 2CL4X 4JM5A 1ZBYA 3RIVA 1AA4A 1EBEA 4FDQA 4CZPA 4G05A 5SYJA 1H5LA 1ITKA 2PCCA 1H3JA 5EJXA 2EUTA 1W4YA 3X16A 2CEPA 1CMTA 1OAGA 2W23A 1CCAA 1DSPA 5SYVA 1AEDA 2CCPA 4CCPA 1CPEA 4CUOA 1H5FA 3VLMA 2RC2X 1CK6A 2XJ5A 1GZBA 5SYLA 1A2GA 1MN1A 4JPLA 4C51A 6CCPA 1OAFA 1S6VA 2XJ8A 4CZNA 5CIHA 1AEGA 4GEDA 2VNZX 5JHZA 1STQA 5SX7A 3VLIA 1H5JA 7ATJA 4JQKA 2RBVX 4NVBA 2EUQA 1BJ9A 1SOGA 3M25A 1AEVA 2V2EA 1AETA 5CIEA 5KQKA 1MNPA 4FEFA 1AEJA 3Q3UA 5JHXA 1CYFA 1CMQA 5SXWA 2RBXX 1BVAA 2XJ6A 4NVNB 3M28A 2E3AA 1CCJA 5CIFA 1LYCA 2EUSA 2GGNX 2IA8A 1BEKA 5SYUA 1AEUA 3M2FA 1C8IA 1RYCA 1DS4A 2X07A 5KSFA 1KXMA 1BESA 3M29A 5AL9A 1ML2A 1ZBZA 2GHCX 3WNUA 2V23A 1H5KA 1QO4A 2GB8A 5KQ6A 5SXTA 1MKRA 1V0HX 1KZMA 5SXXA 1BGPA 2YCGA 5KQ2A 4BLZA 3FKGA 4JPUA 5L02A 2B11A 3FM1A 2VO2X 1HCHA 1AEFA 1GX2A 1LY9A 3ZCYA 3ZCHA 1GZAA 2EURA 5SYXA 1H5GA 1H5IA 1U75A 5SW6A 5ALAA 1H55A 3M2HA 4XV6A 5ABNA 3FJWA 1CPGA 5JPRA 1KXNA 1BEQA 3M5QA 1ARXA 1CPDA 4NFGA 3M2EA 4P4QA 2YLJA 4BM4A 2PCBA 4JPTA 1CMPA 4NVAA 1IYNA 4NVFA 4PAEA 1ARPA 3ATJA 4CVJA 5SX6A 1ARYA 2RC1X 4OQ7A 4JM6A 2GHDX 1DCCA 5CCPA 4CZQA 1H5DA 1YZPA 2X08A 2VCSA 4NVGB 2JTIA 4A6ZA 2CYPA 2RBZX 1CCLA 5SXQA 2RBTX 1GWUA 4BM3A 3CCPA 1CCKA 5SXRA 1AENA 5SYWA 3FM6A 4BM1A 5SYKA 4FCSA 3E2NA 4NVIB 1GW2A 1SBMA 2ICVA 2RBUX 3FM4A 1CCBA 4JMTA 4CZOA 1DSEA 2AS6A 4JMSA 1S73A 1CMUA 1YYGA 4A71A 4JM9A 4BLKA 1ARVA 2RBYX 1Z53A 3M23A 1DJ1A 3M2IA 3RRWA 4FCNA 3M2CA 2AS4A 4ATJA 4BLNA 1UB2A 5SW4A 5KQIA 5SX1A 3R98A 5SX3A 1B85A 6ATJA 4USCA 2AS2A 3VLJA 2GHKX 3VLHA 2BCNA 2CCDA 2E39A 3M27A 3UT2A 1AEQA 2AS3A 4JMVA 5KQ3A 1LY8A 3HDLA 1GWTA 3M8MA 2VCNA 5FNBA 1MN2A 1CPFA 1DSOA 3ZCGA 2B12A 5ABOA 5CIGA 2N18A 1H5CA 2Y6AA 4XV5A 4BM0A 5SX0B 1HSRA 2ATJA 1AEBA 4NVEA 5KQ0A 4A78A 1U74A 1DSGA 4JMWA 4A7MA 3M2GA 1KRJA 3UW8A 4CVIA 1CCGA 2EUOA 5SXSA 2B0ZA 5CIDA 2Y5AA 4BM2A 1QPAA 2XI6A 4JMBA 1BEPA 1A2FA 4JQNA 1CCIA 1SDQA 4BLLA 1CCEA 4NVLA 1QGJA 2AS1A 4NVKB 1U2LA 1DJ5A 1JCIA 1B82A 5CIBA 4CZRA 4C50A 1W4WA 4CCXA 1AC8A 2E3BA 2VNXX 3R99A 2GHEX 3M26A 1AESA 2XIFA 3M2DA 5L05A 1H5HA 5SW5A 5D6MA 5SX0A 4NVMB 4XV8A 3VLLA 3WXOA 1AEEA 2RBWX 3M2BA 1AEKA 1CCCA 4NVJB 3RIWA 5CJHA 1H57A 1GWOA 4JQJA 2EUNA 1AEOA 1ATJA 1SCHA 1H5AA 4A5GA 1AEMA 3FMUA 1ARWA 2XIHA 1BEJA 4JB4A 2EUUA 1LGAA 2GHHX 5FNEA 1SJ2A 4NVOB 4JMZA 5AOGA 2WD4A 2AQDA 5ABQA 1H5MA 1LLPA 1APXA 1BEMA 1FHFA 1B80A 5JQRA 5KSKA 4NVCA 3EXBA 5L86A 1U2JA 4BLXA 5CICA 2EUPA 4JQMA 5EJTA 1U2KA 4BLYA 1YYDA 4JMAA 1AC4A 3CCXA 1MKQA 3M2AA 2ANZA 4NVHB 5SX2A 1YZRA 5AMMA 5KQHA
chains in the Genus database with same CATH superfamily
1H5EA 4XVAA 1KOKA 1LYKA 4XV4A 3VLKA 1MK8A 1AEHA 5JHYA 5SYYA 4XV7A 1CCPA 1JDRA 2RC0X 1H58A 2VKAA 5SYIA 5SYHA 7CCPA 2B10A 4JM8A 2VCFX 2BOQA 4JN0A 4NVDA 1ARUA 1PA2A 2Y6BA 2XILA 2CCAA 3E2OA 5CD4J 2CL4X 4JM5A 1ZBYA 3RIVA 1AA4A 1EBEA 4FDQA 4CZPA 4G05A 5SYJA 4GKFA 1H5LA 1ITKA 2PCCA 1H3JA 5EJXA 2EUTA 1W4YA 3X16A 2CEPA 1CMTA 2JMXA 1OAGA 2W23A 1CCAA 1DSPA 5SYVA 1AEDA 2CCPA 4CCPA 4JZAA 1CPEA 4CUOA 1H5FA 3VLMA 2RC2X 1CK6A 2XJ5A 1GZBA 5SYLA 1A2GA 1MN1A 4JPLA 4C51A 6CCPA 1OAFA 1S6VA 2XJ8A 4CZNA 2OEBA 5CIHA 1AEGA 4GEDA 2VNZX 5JHZA 1STQA 5SX7A 3VLIA 1H5JA 7ATJA 4JQKA 2RBVX 4NVBA 2EUQA 1BJ9A 1SOGA 3M25A 1AEVA 2V2EA 1AETA 5CIEA 5KQKA 1MNPA 4FEFA 1AEJA 3Q3UA 5JHXA 1CYFA 1CMQA 5SXWA 2RBXX 1BVAA 2XJ6A 4NVNB 3M28A 2E3AA 1CCJA 5CIFA 1LYCA 2EUSA 2GGNX 2IA8A 1BEKA 5SYUA 1AEUA 3M2FA 1C8IA 1RYCA 1DS4A 2X07A 5KSFA 1KXMA 5H9FB 1BESA 3M29A 5AL9A 1ML2A 1ZBZA 2A7UB 2GHCX 3WNUA 2V23A 1H5KA 1QO4A 2GB8A 5KQ6A 4H79A 5SXTA 1MKRA 1V0HX 1KZMA 5SXXA 1BGPA 2YCGA 5KQ2A 4BLZA 3FKGA 4JPUA 3WA8A 5L02A 2B11A 4H7AA 3FM1A 2VO2X 1HCHA 1AEFA 1GX2A 1LY9A 3ZCYA 3ZCHA 1GZAA 2EURA 5SYXA 1H5GA 1H5IA 1U75A 5SW6A 2WSSS 2BO5A 5ALAA 1H55A 3M2HA 4XV6A 5ABNA 3FJWA 1CPGA 5JPRA 1KXNA 3X1LF 1BEQA 3M5QA 1ARXA 1CPDA 4NFGA 3M2EA 4P4QA 2YLJA 4BM4A 2PCBA 4JPTA 2ZCAA 1CMPA 4NVAA 1IYNA 4NVFA 4PAEA 1ABVA 1ARPA 3ATJA 4CVJA 5SX6A 1ARYA 2RC1X 4OQ7A 4JM6A 2GHDX 1DCCA 5CCPA 4CZQA 1H5DA 1YZPA 2X08A 2VCSA 4NVGB 2JTIA 4A6ZA 2CYPA 2RBZX 1CCLA 5SXQA 2RBTX 1GWUA 4BM3A 3CCPA 1CCKA 5SXRA 1AENA 5SYWA 3FM6A 4BM1A 5SYKA 4FCSA 3E2NA 4NVIB 1GW2A 1SBMA 2ICVA 2RBUX 3FM4A 1CCBA 4JMTA 4CZOA 1DSEA 2AS6A 4JMSA 1S73A 1CMUA 1YYGA 4A71A 4JM9A 4BLKA 1ARVA 2RBYX 1Z53A 3M23A 1DJ1A 3M2IA 3RRWA 4FCNA 3M2CA 2AS4A 4ATJA 4BLNA 1UB2A 5SW4A 5KQIA 5SX1A 3R98A 5SX3A 1B85A 6ATJA 4USCA 2AS2A 3VLJA 2GHKX 3VLHA 2BCNA 2CCDA 2E39A 3M27A 3UT2A 1AEQA 2AS3A 4JMVA 5KQ3A 2ZOPA 1LY8A 3HDLA 1GWTA 3M8MA 2VCNA 5FNBA 1MN2A 1CPFA 1DSOA 4QYZB 3ZCGA 2B12A 5ABOA 5CIGA 2N18A 1H5CA 2Y6AA 4XV5A 4BM0A 5SX0B 1HSRA 2ATJA 1AEBA 4NVEA 5KQ0A 4A78A 1U74A 1DSGA 4JMWA 4A7MA 3M2GA 5H9EB 1KRJA 4U7UB 3UW8A 4CVIA 1CCGA 2EUOA 5SXSA 2B0ZA 5CIDA 2Y5AA 4BM2A 1QPAA 2XI6A 4JMBA 1BEPA 1A2FA 4JQNA 1CCIA 1SDQA 4BLLA 1CCEA 4NVLA 1QGJA 2AS1A 4NVKB 1U2LA 1DJ5A 1JCIA 1B82A 5CIBA 4CZRA 4C50A 1W4WA 4CCXA 1AC8A 2E3BA 2VNXX 3R99A 2GHEX 3M26A 1AESA 2XIFA 3M2DA 5L05A 1H5HA 5SW5A 5D6MA 5SX0A 4NVMB 4XV8A 3VLLA 3WXOA 1AEEA 2RBWX 3M2BA 1AEKA 1CCCA 4NVJB 3RIWA 5CJHA 1H57A 1GWOA 4JQJA 2EUNA 1AEOA 1ATJA 1SCHA 1H5AA 4A5GA 1AEMA 3FMUA 1ARWA 2XIHA 1BEJA 4JB4A 2EUUA 1LGAA 2GHHX 5FNEA 1SJ2A 4NVOB 4JMZA 5AOGA 2WD4A 2AQDA 5ABQA 1H5MA 1LLPA 1APXA 1BEMA 1FHFA 1B80A 5JQRA 5KSKA 4NVCA 3EXBA 5L86A 1U2JA 4BLXA 5CICA 2EUPA 4JQMA 5EJTA 1U2KA 4BLYA 1YYDA 4JMAA 1AC4A 3CCXA 1MKQA 3M2AA 2ANZA 4NVHB 5SX2A 1YZRA 5AMMA 5KQHA
chains in the Genus database with same CATH topology
1H5EA 4XVAA 1KOKA 1LYKA 4XV4A 3VLKA 1MK8A 1AEHA 5JHYA 5SYYA 4XV7A 1CCPA 1JDRA 2RC0X 1H58A 2VKAA 5SYIA 5SYHA 7CCPA 2B10A 4JM8A 2VCFX 2BOQA 4JN0A 4NVDA 1ARUA 1PA2A 2Y6BA 2XILA 2CCAA 3E2OA 5CD4J 2CL4X 4JM5A 1ZBYA 3RIVA 1AA4A 1EBEA 4FDQA 4CZPA 4G05A 5SYJA 1H5LA 1ITKA 2PCCA 1H3JA 5EJXA 2EUTA 1W4YA 3X16A 2CEPA 1CMTA 1OAGA 2W23A 1CCAA 1DSPA 5SYVA 1AEDA 2CCPA 4CCPA 4JZAA 1CPEA 4CUOA 1H5FA 3VLMA 2RC2X 1CK6A 2XJ5A 1GZBA 5SYLA 1A2GA 1MN1A 4JPLA 4C51A 6CCPA 1OAFA 1S6VA 2XJ8A 4CZNA 5CIHA 1AEGA 4GEDA 2VNZX 5JHZA 1STQA 5SX7A 3VLIA 1H5JA 7ATJA 4JQKA 2RBVX 4NVBA 2EUQA 1BJ9A 1SOGA 3M25A 1AEVA 2V2EA 1AETA 5CIEA 5KQKA 1MNPA 4FEFA 1AEJA 3Q3UA 5JHXA 1CYFA 1CMQA 5SXWA 2RBXX 1BVAA 2XJ6A 4NVNB 3M28A 2E3AA 1CCJA 5CIFA 1LYCA 2EUSA 2GGNX 2IA8A 1BEKA 5SYUA 1AEUA 3M2FA 1C8IA 1RYCA 1DS4A 2X07A 5KSFA 1KXMA 5H9FB 1BESA 3M29A 5AL9A 1ML2A 1ZBZA 2GHCX 3WNUA 2V23A 1H5KA 1QO4A 2GB8A 5KQ6A 4H79A 5SXTA 1MKRA 1V0HX 1KZMA 5SXXA 1BGPA 2YCGA 5KQ2A 4BLZA 3FKGA 4JPUA 3WA8A 5L02A 2B11A 4H7AA 3FM1A 2VO2X 1HCHA 1AEFA 1GX2A 1LY9A 3ZCYA 3ZCHA 1GZAA 2EURA 5SYXA 1H5GA 1H5IA 1U75A 5SW6A 5ALAA 1H55A 3M2HA 4XV6A 5ABNA 3FJWA 1CPGA 5JPRA 1KXNA 1BEQA 3M5QA 1ARXA 1CPDA 4NFGA 3M2EA 4P4QA 2YLJA 4BM4A 2PCBA 4JPTA 2ZCAA 1CMPA 4NVAA 1IYNA 4NVFA 4PAEA 1ARPA 3ATJA 4CVJA 5SX6A 1ARYA 2RC1X 4OQ7A 4JM6A 2GHDX 1DCCA 5CCPA 4CZQA 1H5DA 1YZPA 2X08A 2VCSA 4NVGB 2JTIA 4A6ZA 2CYPA 2RBZX 1CCLA 5SXQA 2RBTX 1GWUA 4BM3A 3CCPA 1CCKA 5SXRA 1AENA 5SYWA 3FM6A 4BM1A 5SYKA 4FCSA 3E2NA 4NVIB 1GW2A 1SBMA 2ICVA 2RBUX 3FM4A 1CCBA 4JMTA 4CZOA 1DSEA 2AS6A 4JMSA 1S73A 1CMUA 1YYGA 4A71A 4JM9A 4BLKA 1ARVA 2RBYX 1Z53A 3M23A 1DJ1A 3M2IA 3RRWA 4FCNA 3M2CA 2AS4A 4ATJA 4BLNA 1UB2A 5SW4A 5KQIA 5SX1A 3R98A 5SX3A 1B85A 6ATJA 4USCA 2AS2A 3VLJA 2GHKX 3VLHA 2BCNA 2CCDA 2E39A 3M27A 3UT2A 1AEQA 2AS3A 4JMVA 5KQ3A 1LY8A 3HDLA 1GWTA 3M8MA 2VCNA 5FNBA 1MN2A 1CPFA 1DSOA 4QYZB 3ZCGA 2B12A 5ABOA 5CIGA 2N18A 1H5CA 2Y6AA 4XV5A 4BM0A 5SX0B 1HSRA 2ATJA 1AEBA 4NVEA 5KQ0A 4A78A 1U74A 1DSGA 4JMWA 4A7MA 3M2GA 5H9EB 1KRJA 4U7UB 3UW8A 4CVIA 1CCGA 2EUOA 5SXSA 2B0ZA 5CIDA 2Y5AA 4BM2A 1QPAA 2XI6A 4JMBA 1BEPA 1A2FA 4JQNA 1CCIA 1SDQA 4BLLA 1CCEA 4NVLA 1QGJA 2AS1A 4NVKB 1U2LA 1DJ5A 1JCIA 1B82A 5CIBA 4CZRA 4C50A 1W4WA 4CCXA 1AC8A 2E3BA 2VNXX 3R99A 2GHEX 3M26A 1AESA 2XIFA 3M2DA 5L05A 1H5HA 5SW5A 5D6MA 5SX0A 4NVMB 4XV8A 3VLLA 3WXOA 1AEEA 2RBWX 3M2BA 1AEKA 1CCCA 4NVJB 3RIWA 5CJHA 1H57A 1GWOA 4JQJA 2EUNA 1AEOA 1ATJA 1SCHA 1H5AA 4A5GA 1AEMA 3FMUA 1ARWA 2XIHA 1BEJA 4JB4A 2EUUA 1LGAA 2GHHX 5FNEA 1SJ2A 4NVOB 4JMZA 5AOGA 2WD4A 2AQDA 5ABQA 1H5MA 1LLPA 1APXA 1BEMA 1FHFA 1B80A 5JQRA 5KSKA 4NVCA 3EXBA 5L86A 1U2JA 4BLXA 5CICA 2EUPA 4JQMA 5EJTA 1U2KA 4BLYA 1YYDA 4JMAA 1AC4A 3CCXA 1MKQA 3M2AA 2ANZA 4NVHB 5SX2A 1YZRA 5AMMA 5KQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5E A;  4XVA A;  1KOK A;  1LYK A;  4XV4 A;  3VLK A;  1MK8 A;  1AEH A;  5JHY A;  5SYY A;  4XV7 A;  1CCP A;  1JDR A;  2RC0 X;  1H58 A;  2VKA A;  5SYI A;  5SYH A;  7CCP A;  2B10 A;  4JM8 A;  2VCF X;  2BOQ A;  4JN0 A;  4NVD A;  1ARU A;  1PA2 A;  2Y6B A;  2XIL A;  2CCA A;  3E2O A;  2CL4 X;  4JM5 A;  1ZBY A;  3RIV A;  1AA4 A;  1EBE A;  4FDQ A;  4CZP A;  4G05 A;  5SYJ A;  1H5L A;  1ITK A;  2PCC A;  1H3J A;  5EJX A;  2EUT A;  1W4Y A;  3X16 A;  2CEP A;  1CMT A;  1OAG A;  2W23 A;  1CCA A;  1DSP A;  5SYV A;  1AED A;  2CCP A;  4CCP A;  1CPE A;  4CUO A;  1H5F A;  3VLM A;  2RC2 X;  1CK6 A;  2XJ5 A;  1GZB A;  5SYL A;  1A2G A;  1MN1 A;  4JPL A;  4C51 A;  6CCP A;  1OAF A;  1S6V A;  2XJ8 A;  4CZN A;  5CIH A;  1AEG A;  4GED A;  2VNZ X;  5JHZ A;  1STQ A;  5SX7 A;  3VLI A;  1H5J A;  7ATJ A;  4JQK A;  2RBV X;  4NVB A;  2EUQ A;  1BJ9 A;  1SOG A;  3M25 A;  1AEV A;  2V2E A;  1AET A;  5CIE A;  5KQK A;  1MNP A;  4FEF A;  1AEJ A;  3Q3U A;  5JHX A;  1CYF A;  1CMQ A;  5SXW A;  2RBX X;  1BVA A;  2XJ6 A;  4NVN B;  3M28 A;  2E3A A;  1CCJ A;  5CIF A;  1LYC A;  2EUS A;  2GGN X;  2IA8 A;  1BEK A;  5SYU A;  1AEU A;  3M2F A;  1C8I A;  1RYC A;  1DS4 A;  2X07 A;  5KSF A;  1KXM A;  1BES A;  3M29 A;  5AL9 A;  1ML2 A;  1ZBZ A;  2GHC X;  3WNU A;  2V23 A;  1H5K A;  1QO4 A;  2GB8 A;  5KQ6 A;  5SXT A;  1MKR A;  1V0H X;  1KZM A;  5SXX A;  1BGP A;  2YCG A;  5KQ2 A;  4BLZ A;  3FKG A;  4JPU A;  5L02 A;  2B11 A;  3FM1 A;  2VO2 X;  1HCH A;  1AEF A;  1GX2 A;  1LY9 A;  3ZCY A;  3ZCH A;  1GZA A;  2EUR A;  5SYX A;  1H5G A;  1H5I A;  1U75 A;  5SW6 A;  5ALA A;  1H55 A;  3M2H A;  4XV6 A;  5ABN A;  3FJW A;  1CPG A;  5JPR A;  1KXN A;  1BEQ A;  3M5Q A;  1ARX A;  1CPD A;  4NFG A;  3M2E A;  4P4Q A;  2YLJ A;  4BM4 A;  2PCB A;  4JPT A;  1CMP A;  4NVA A;  1IYN A;  4NVF A;  4PAE A;  1ARP A;  3ATJ A;  4CVJ A;  5SX6 A;  1ARY A;  2RC1 X;  4OQ7 A;  4JM6 A;  2GHD X;  1DCC A;  5CCP A;  4CZQ A;  1H5D A;  1YZP A;  2X08 A;  2VCS A;  4NVG B;  2JTI A;  4A6Z A;  2CYP A;  2RBZ X;  1CCL A;  5SXQ A;  2RBT X;  1GWU A;  4BM3 A;  3CCP A;  1CCK A;  5SXR A;  1AEN A;  5SYW A;  3FM6 A;  4BM1 A;  5SYK A;  4FCS A;  3E2N A;  4NVI B;  1GW2 A;  1SBM A;  2ICV A;  2RBU X;  3FM4 A;  1CCB A;  4JMT A;  4CZO A;  1DSE A;  2AS6 A;  4JMS A;  1S73 A;  1CMU A;  1YYG A;  4A71 A;  4JM9 A;  4BLK A;  1ARV A;  2RBY X;  1Z53 A;  3M23 A;  1DJ1 A;  3M2I A;  3RRW A;  4FCN A;  3M2C A;  2AS4 A;  4ATJ A;  4BLN A;  1UB2 A;  5SW4 A;  5KQI A;  5SX1 A;  3R98 A;  5SX3 A;  1B85 A;  6ATJ A;  4USC A;  2AS2 A;  3VLJ A;  2GHK X;  3VLH A;  2BCN A;  2CCD A;  2E39 A;  3M27 A;  3UT2 A;  1AEQ A;  2AS3 A;  4JMV A;  5KQ3 A;  1LY8 A;  3HDL A;  1GWT A;  3M8M A;  2VCN A;  5FNB A;  1MN2 A;  1CPF A;  1DSO A;  3ZCG A;  2B12 A;  5ABO A;  5CIG A;  2N18 A;  1H5C A;  2Y6A A;  4XV5 A;  4BM0 A;  5SX0 B;  1HSR A;  2ATJ A;  1AEB A;  4NVE A;  5KQ0 A;  4A78 A;  1U74 A;  1DSG A;  4JMW A;  4A7M A;  3M2G A;  1KRJ A;  3UW8 A;  4CVI A;  1CCG A;  2EUO A;  5SXS A;  2B0Z A;  5CID A;  2Y5A A;  4BM2 A;  1QPA A;  2XI6 A;  4JMB A;  1BEP A;  1A2F A;  4JQN A;  1CCI A;  1SDQ A;  4BLL A;  1CCE A;  4NVL A;  1QGJ A;  2AS1 A;  4NVK B;  1U2L A;  1DJ5 A;  1JCI A;  1B82 A;  5CIB A;  4CZR A;  4C50 A;  1W4W A;  4CCX A;  1AC8 A;  2E3B A;  2VNX X;  3R99 A;  2GHE X;  3M26 A;  1AES A;  2XIF A;  3M2D A;  5L05 A;  1H5H A;  5SW5 A;  5D6M A;  5SX0 A;  4NVM B;  4XV8 A;  3VLL A;  3WXO A;  1AEE A;  2RBW X;  3M2B A;  1AEK A;  1CCC A;  4NVJ B;  3RIW A;  5CJH A;  1H57 A;  1GWO A;  4JQJ A;  2EUN A;  1AEO A;  1ATJ A;  1SCH A;  1H5A A;  4A5G A;  1AEM A;  3FMU A;  1ARW A;  2XIH A;  1BEJ A;  4JB4 A;  2EUU A;  1LGA A;  2GHH X;  5FNE A;  1SJ2 A;  4NVO B;  4JMZ A;  5AOG A;  2WD4 A;  2AQD A;  5ABQ A;  1H5M A;  1LLP A;  1APX A;  1BEM A;  1FHF A;  1B80 A;  5JQR A;  5KSK A;  4NVC A;  3EXB A;  5L86 A;  1U2J A;  4BLX A;  5CIC A;  2EUP A;  4JQM A;  5EJT A;  1U2K A;  4BLY A;  1YYD A;  4JMA A;  1AC4 A;  3CCX A;  1MKQ A;  3M2A A;  2ANZ A;  4NVH B;  5SX2 A;  1YZR A;  5AMM A;  5KQH A; 
#chains in the Genus database with same CATH topology
 1H5E A;  4XVA A;  1KOK A;  1LYK A;  4XV4 A;  3VLK A;  1MK8 A;  1AEH A;  5JHY A;  5SYY A;  4XV7 A;  1CCP A;  1JDR A;  2RC0 X;  1H58 A;  2VKA A;  5SYI A;  5SYH A;  7CCP A;  2B10 A;  4JM8 A;  2VCF X;  2BOQ A;  4JN0 A;  4NVD A;  1ARU A;  1PA2 A;  2Y6B A;  2XIL A;  2CCA A;  3E2O A;  5CD4 J;  2CL4 X;  4JM5 A;  1ZBY A;  3RIV A;  1AA4 A;  1EBE A;  4FDQ A;  4CZP A;  4G05 A;  5SYJ A;  4GKF A;  1H5L A;  1ITK A;  2PCC A;  1H3J A;  5EJX A;  2EUT A;  1W4Y A;  3X16 A;  2CEP A;  1CMT A;  2JMX A;  1OAG A;  2W23 A;  1CCA A;  1DSP A;  5SYV A;  1AED A;  2CCP A;  4CCP A;  4JZA A;  1CPE A;  4CUO A;  1H5F A;  3VLM A;  2RC2 X;  1CK6 A;  2XJ5 A;  1GZB A;  5SYL A;  1A2G A;  1MN1 A;  4JPL A;  4C51 A;  6CCP A;  1OAF A;  1S6V A;  2XJ8 A;  4CZN A;  2OEB A;  5CIH A;  1AEG A;  4GED A;  2VNZ X;  5JHZ A;  1STQ A;  5SX7 A;  3VLI A;  1H5J A;  7ATJ A;  4JQK A;  2RBV X;  4NVB A;  2EUQ A;  1BJ9 A;  1SOG A;  3M25 A;  1AEV A;  2V2E A;  1AET A;  5CIE A;  5KQK A;  1MNP A;  4FEF A;  1AEJ A;  3Q3U A;  5JHX A;  1CYF A;  1CMQ A;  5SXW A;  2RBX X;  1BVA A;  2XJ6 A;  4NVN B;  3M28 A;  2E3A A;  1CCJ A;  5CIF A;  1LYC A;  2EUS A;  2GGN X;  2IA8 A;  1BEK A;  5SYU A;  1AEU A;  3M2F A;  1C8I A;  1RYC A;  1DS4 A;  2X07 A;  5KSF A;  1KXM A;  5H9F B;  1BES A;  3M29 A;  5AL9 A;  1ML2 A;  1ZBZ A;  2A7U B;  2GHC X;  3WNU A;  2V23 A;  1H5K A;  1QO4 A;  2GB8 A;  5KQ6 A;  4H79 A;  5SXT A;  1MKR A;  1V0H X;  1KZM A;  5SXX A;  1BGP A;  2YCG A;  5KQ2 A;  4BLZ A;  3FKG A;  4JPU A;  3WA8 A;  5L02 A;  2B11 A;  4H7A A;  3FM1 A;  2VO2 X;  1HCH A;  1AEF A;  1GX2 A;  1LY9 A;  3ZCY A;  3ZCH A;  1GZA A;  2EUR A;  5SYX A;  1H5G A;  1H5I A;  1U75 A;  5SW6 A;  2WSS S;  2BO5 A;  5ALA A;  1H55 A;  3M2H A;  4XV6 A;  5ABN A;  3FJW A;  1CPG A;  5JPR A;  1KXN A;  3X1L F;  1BEQ A;  3M5Q A;  1ARX A;  1CPD A;  4NFG A;  3M2E A;  4P4Q A;  2YLJ A;  4BM4 A;  2PCB A;  4JPT A;  2ZCA A;  1CMP A;  4NVA A;  1IYN A;  4NVF A;  4PAE A;  1ABV A;  1ARP A;  3ATJ A;  4CVJ A;  5SX6 A;  1ARY A;  2RC1 X;  4OQ7 A;  4JM6 A;  2GHD X;  1DCC A;  5CCP A;  4CZQ A;  1H5D A;  1YZP A;  2X08 A;  2VCS A;  4NVG B;  2JTI A;  4A6Z A;  2CYP A;  2RBZ X;  1CCL A;  5SXQ A;  2RBT X;  1GWU A;  4BM3 A;  3CCP A;  1CCK A;  5SXR A;  1AEN A;  5SYW A;  3FM6 A;  4BM1 A;  5SYK A;  4FCS A;  3E2N A;  4NVI B;  1GW2 A;  1SBM A;  2ICV A;  2RBU X;  3FM4 A;  1CCB A;  4JMT A;  4CZO A;  1DSE A;  2AS6 A;  4JMS A;  1S73 A;  1CMU A;  1YYG A;  4A71 A;  4JM9 A;  4BLK A;  1ARV A;  2RBY X;  1Z53 A;  3M23 A;  1DJ1 A;  3M2I A;  3RRW A;  4FCN A;  3M2C A;  2AS4 A;  4ATJ A;  4BLN A;  1UB2 A;  5SW4 A;  5KQI A;  5SX1 A;  3R98 A;  5SX3 A;  1B85 A;  6ATJ A;  4USC A;  2AS2 A;  3VLJ A;  2GHK X;  3VLH A;  2BCN A;  2CCD A;  2E39 A;  3M27 A;  3UT2 A;  1AEQ A;  2AS3 A;  4JMV A;  5KQ3 A;  2ZOP A;  1LY8 A;  3HDL A;  1GWT A;  3M8M A;  2VCN A;  5FNB A;  1MN2 A;  1CPF A;  1DSO A;  4QYZ B;  3ZCG A;  2B12 A;  5ABO A;  5CIG A;  2N18 A;  1H5C A;  2Y6A A;  4XV5 A;  4BM0 A;  5SX0 B;  1HSR A;  2ATJ A;  1AEB A;  4NVE A;  5KQ0 A;  4A78 A;  1U74 A;  1DSG A;  4JMW A;  4A7M A;  3M2G A;  5H9E B;  1KRJ A;  4U7U B;  3UW8 A;  4CVI A;  1CCG A;  2EUO A;  5SXS A;  2B0Z A;  5CID A;  2Y5A A;  4BM2 A;  1QPA A;  2XI6 A;  4JMB A;  1BEP A;  1A2F A;  4JQN A;  1CCI A;  1SDQ A;  4BLL A;  1CCE A;  4NVL A;  1QGJ A;  2AS1 A;  4NVK B;  1U2L A;  1DJ5 A;  1JCI A;  1B82 A;  5CIB A;  4CZR A;  4C50 A;  1W4W A;  4CCX A;  1AC8 A;  2E3B A;  2VNX X;  3R99 A;  2GHE X;  3M26 A;  1AES A;  2XIF A;  3M2D A;  5L05 A;  1H5H A;  5SW5 A;  5D6M A;  5SX0 A;  4NVM B;  4XV8 A;  3VLL A;  3WXO A;  1AEE A;  2RBW X;  3M2B A;  1AEK A;  1CCC A;  4NVJ B;  3RIW A;  5CJH A;  1H57 A;  1GWO A;  4JQJ A;  2EUN A;  1AEO A;  1ATJ A;  1SCH A;  1H5A A;  4A5G A;  1AEM A;  3FMU A;  1ARW A;  2XIH A;  1BEJ A;  4JB4 A;  2EUU A;  1LGA A;  2GHH X;  5FNE A;  1SJ2 A;  4NVO B;  4JMZ A;  5AOG A;  2WD4 A;  2AQD A;  5ABQ A;  1H5M A;  1LLP A;  1APX A;  1BEM A;  1FHF A;  1B80 A;  5JQR A;  5KSK A;  4NVC A;  3EXB A;  5L86 A;  1U2J A;  4BLX A;  5CIC A;  2EUP A;  4JQM A;  5EJT A;  1U2K A;  4BLY A;  1YYD A;  4JMA A;  1AC4 A;  3CCX A;  1MKQ A;  3M2A A;  2ANZ A;  4NVH B;  5SX2 A;  1YZR A;  5AMM A;  5KQH A; 
#chains in the Genus database with same CATH homology
 1H5E A;  4XVA A;  1KOK A;  1LYK A;  4XV4 A;  3VLK A;  1MK8 A;  1AEH A;  5JHY A;  5SYY A;  4XV7 A;  1CCP A;  1JDR A;  2RC0 X;  1H58 A;  2VKA A;  5SYI A;  5SYH A;  7CCP A;  2B10 A;  4JM8 A;  2VCF X;  2BOQ A;  4JN0 A;  4NVD A;  1ARU A;  1PA2 A;  2Y6B A;  2XIL A;  2CCA A;  3E2O A;  5CD4 J;  2CL4 X;  4JM5 A;  1ZBY A;  3RIV A;  1AA4 A;  1EBE A;  4FDQ A;  4CZP A;  4G05 A;  5SYJ A;  1H5L A;  1ITK A;  2PCC A;  1H3J A;  5EJX A;  2EUT A;  1W4Y A;  3X16 A;  2CEP A;  1CMT A;  1OAG A;  2W23 A;  1CCA A;  1DSP A;  5SYV A;  1AED A;  2CCP A;  4CCP A;  4JZA A;  1CPE A;  4CUO A;  1H5F A;  3VLM A;  2RC2 X;  1CK6 A;  2XJ5 A;  1GZB A;  5SYL A;  1A2G A;  1MN1 A;  4JPL A;  4C51 A;  6CCP A;  1OAF A;  1S6V A;  2XJ8 A;  4CZN A;  5CIH A;  1AEG A;  4GED A;  2VNZ X;  5JHZ A;  1STQ A;  5SX7 A;  3VLI A;  1H5J A;  7ATJ A;  4JQK A;  2RBV X;  4NVB A;  2EUQ A;  1BJ9 A;  1SOG A;  3M25 A;  1AEV A;  2V2E A;  1AET A;  5CIE A;  5KQK A;  1MNP A;  4FEF A;  1AEJ A;  3Q3U A;  5JHX A;  1CYF A;  1CMQ A;  5SXW A;  2RBX X;  1BVA A;  2XJ6 A;  4NVN B;  3M28 A;  2E3A A;  1CCJ A;  5CIF A;  1LYC A;  2EUS A;  2GGN X;  2IA8 A;  1BEK A;  5SYU A;  1AEU A;  3M2F A;  1C8I A;  1RYC A;  1DS4 A;  2X07 A;  5KSF A;  1KXM A;  5H9F B;  1BES A;  3M29 A;  5AL9 A;  1ML2 A;  1ZBZ A;  2GHC X;  3WNU A;  2V23 A;  1H5K A;  1QO4 A;  2GB8 A;  5KQ6 A;  4H79 A;  5SXT A;  1MKR A;  1V0H X;  1KZM A;  5SXX A;  1BGP A;  2YCG A;  5KQ2 A;  4BLZ A;  3FKG A;  4JPU A;  3WA8 A;  5L02 A;  2B11 A;  4H7A A;  3FM1 A;  2VO2 X;  1HCH A;  1AEF A;  1GX2 A;  1LY9 A;  3ZCY A;  3ZCH A;  1GZA A;  2EUR A;  5SYX A;  1H5G A;  1H5I A;  1U75 A;  5SW6 A;  5ALA A;  1H55 A;  3M2H A;  4XV6 A;  5ABN A;  3FJW A;  1CPG A;  5JPR A;  1KXN A;  1BEQ A;  3M5Q A;  1ARX A;  1CPD A;  4NFG A;  3M2E A;  4P4Q A;  2YLJ A;  4BM4 A;  2PCB A;  4JPT A;  2ZCA A;  1CMP A;  4NVA A;  1IYN A;  4NVF A;  4PAE A;  1ARP A;  3ATJ A;  4CVJ A;  5SX6 A;  1ARY A;  2RC1 X;  4OQ7 A;  4JM6 A;  2GHD X;  1DCC A;  5CCP A;  4CZQ A;  1H5D A;  1YZP A;  2X08 A;  2VCS A;  4NVG B;  2JTI A;  4A6Z A;  2CYP A;  2RBZ X;  1CCL A;  5SXQ A;  2RBT X;  1GWU A;  4BM3 A;  3CCP A;  1CCK A;  5SXR A;  1AEN A;  5SYW A;  3FM6 A;  4BM1 A;  5SYK A;  4FCS A;  3E2N A;  4NVI B;  1GW2 A;  1SBM A;  2ICV A;  2RBU X;  3FM4 A;  1CCB A;  4JMT A;  4CZO A;  1DSE A;  2AS6 A;  4JMS A;  1S73 A;  1CMU A;  1YYG A;  4A71 A;  4JM9 A;  4BLK A;  1ARV A;  2RBY X;  1Z53 A;  3M23 A;  1DJ1 A;  3M2I A;  3RRW A;  4FCN A;  3M2C A;  2AS4 A;  4ATJ A;  4BLN A;  1UB2 A;  5SW4 A;  5KQI A;  5SX1 A;  3R98 A;  5SX3 A;  1B85 A;  6ATJ A;  4USC A;  2AS2 A;  3VLJ A;  2GHK X;  3VLH A;  2BCN A;  2CCD A;  2E39 A;  3M27 A;  3UT2 A;  1AEQ A;  2AS3 A;  4JMV A;  5KQ3 A;  1LY8 A;  3HDL A;  1GWT A;  3M8M A;  2VCN A;  5FNB A;  1MN2 A;  1CPF A;  1DSO A;  4QYZ B;  3ZCG A;  2B12 A;  5ABO A;  5CIG A;  2N18 A;  1H5C A;  2Y6A A;  4XV5 A;  4BM0 A;  5SX0 B;  1HSR A;  2ATJ A;  1AEB A;  4NVE A;  5KQ0 A;  4A78 A;  1U74 A;  1DSG A;  4JMW A;  4A7M A;  3M2G A;  5H9E B;  1KRJ A;  4U7U B;  3UW8 A;  4CVI A;  1CCG A;  2EUO A;  5SXS A;  2B0Z A;  5CID A;  2Y5A A;  4BM2 A;  1QPA A;  2XI6 A;  4JMB A;  1BEP A;  1A2F A;  4JQN A;  1CCI A;  1SDQ A;  4BLL A;  1CCE A;  4NVL A;  1QGJ A;  2AS1 A;  4NVK B;  1U2L A;  1DJ5 A;  1JCI A;  1B82 A;  5CIB A;  4CZR A;  4C50 A;  1W4W A;  4CCX A;  1AC8 A;  2E3B A;  2VNX X;  3R99 A;  2GHE X;  3M26 A;  1AES A;  2XIF A;  3M2D A;  5L05 A;  1H5H A;  5SW5 A;  5D6M A;  5SX0 A;  4NVM B;  4XV8 A;  3VLL A;  3WXO A;  1AEE A;  2RBW X;  3M2B A;  1AEK A;  1CCC A;  4NVJ B;  3RIW A;  5CJH A;  1H57 A;  1GWO A;  4JQJ A;  2EUN A;  1AEO A;  1ATJ A;  1SCH A;  1H5A A;  4A5G A;  1AEM A;  3FMU A;  1ARW A;  2XIH A;  1BEJ A;  4JB4 A;  2EUU A;  1LGA A;  2GHH X;  5FNE A;  1SJ2 A;  4NVO B;  4JMZ A;  5AOG A;  2WD4 A;  2AQD A;  5ABQ A;  1H5M A;  1LLP A;  1APX A;  1BEM A;  1FHF A;  1B80 A;  5JQR A;  5KSK A;  4NVC A;  3EXB A;  5L86 A;  1U2J A;  4BLX A;  5CIC A;  2EUP A;  4JQM A;  5EJT A;  1U2K A;  4BLY A;  1YYD A;  4JMA A;  1AC4 A;  3CCX A;  1MKQ A;  3M2A A;  2ANZ A;  4NVH B;  5SX2 A;  1YZR A;  5AMM A;  5KQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...