4CZRA

Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with cadmium (anomalous data)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
366
structure length
366
Chain Sequence
PTAVCSDGTRVSNAVCCDFVSLGQDLQSMVLQGDCGEDAHEIIRLTFHDAVAISRKLGPSAGGGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSLHPTISAGDLVQFAGAVALSNCPGAPRVQFLAGRPNHTIAAIDGLIPEPQDNVTSILERFDDAGGFTPFEVVSLLASHTIARADKVDPTLDAAPFDTTPFTFDSQIFLEVLLKGVGFPGLDNNTGEVSSPLPLGDTSTGGKDTGLMRLQSDFALAHDPRTACFWQGFVDQQEFMSQSFASAFAKLAVLGHNTDDLIDCSEVVPVPKPAVDKPTTFPATTGPQDLELSCLAERFPTLSVDPGAQETLIPHCSDGLENCTSVQFSGPATDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Implications of the C-Terminal Tail in the Catalytic and Stability Properties of Manganese Peroxidases from Ligninolytic Fungi
pubmed doi rcsb
molecule keywords EXTRALONG MANGANESE PEROXIDASE
molecule tags Oxidoreductase
source organism Ceriporiopsis subvermispora
total genus 112
structure length 366
sequence length 366
ec nomenclature ec 1.11.1.13: Manganese peroxidase.
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4czrA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4czrA01
5KQ2A 1BEMA 4JMZA 5ALAA 6CCPA 1A2GA 2CCDA 5FNEA 4XV8A 4JN0A 2B11A 4C50A 3VLHA 1H5IA 4CZRA 2Y6BA 1AEVA 3M2EA 4JQNA 2E39A 5SX0B 2B12A 3VLLA 4JQJA 1AESA 1CCIA 4OQ7A 1AENA 2B0ZA 4XV7A 5SXSA 3FJWA 2AQDA 2EURA 1CCPA 1ATJA 1CCAA 1GW2A 2N18A 1C8IA 4PAEA 2GHKX 5KQ6A 3VLMA 7CCPA 4NVIB 4NVAA 1ML2A 1H5MA 2RBWX 2XIHA 4NVHB 5SYJA 1OAFA 4JB4A 5SX2A 1H5AA 5D6MA 4JMVA 5SX3A 1AC4A 3FMUA 5L05A 2IA8A 1UB2A 4JM8A 5EJTA 1EBEA 4CCPA 1AEKA 3UT2A 3M2BA 4XV5A 5SW4A 2AS2A 1ARUA 2PCCA 2RBVX 1CPGA 1CPEA 5CIHA 5SYVA 4BLLA 2JTIA 3RRWA 4A71A 4CZOA 1H5EA 2CEPA 5CIGA 1CMUA 1SCHA 1V0HX 1H5GA 1H5DA 2VO2X 1AEFA 1ZBZA 2GHCX 1DJ1A 2VNXX 1H58A 1U2KA 1YYGA 2WD4A 1BEJA 4FCNA 1H5CA 1SJ2A 1H5FA 1QO4A 3E2OA 1U2LA 4BM4A 1GWTA 3R99A 2AS6A 2EUQA 2EUTA 2AS4A 1DS4A 4NVDA 1GZBA 5ABQA 4A7MA 1KXNA 2YCGA 4XVAA 1SBMA 2VCFX 2BCNA 2VNZX 1CCGA 4CZPA 5SX0A 4NFGA 3ATJA 3ZCHA 2CYPA 1HSRA 4CVIA 1W4YA 1BVAA 1ARVA 3M28A 4FCSA 1BJ9A 4NVLA 1CCCA 2EUNA 1H57A 2RC1X 3X16A 1YZPA 3M23A 3M25A 4JPTA 4CZNA 5SXXA 4A6ZA 1AEOA 4BM1A 2CCPA 5SYYA 1ITKA 4BLKA 1B80A 1DSEA 4JMWA 4P4QA 6ATJA 5SYLA 1S73A 1BESA 4JPLA 5SYXA 2Y5AA 1CPFA 1H55A 1YZRA 1MKQA 2CL4X 2EUSA 5SX6A 1GWUA 4BLYA 1H5LA 5CIDA 1OAGA 1AEUA 4JMBA 1CPDA 1ARPA 3E2NA 3RIWA 1H5JA 3CCXA 2RBZX 1U75A 1AEJA 1KOKA 4NVNB 5L02A 1DSPA 1AEMA 3M2GA 2RBXX 5KQKA 1JDRA 5JHYA 1LYCA 5KSFA 2XJ8A 4NVMB 1LY8A 2GHEX 5CIEA 1KZMA 5JHXA 1GX2A 1CMQA 1AETA 5KQIA 5KQ0A 2RBTX 1U2JA 5JQRA 4GEDA 4C51A 5AMMA 3FM6A 4XV4A 4BLNA 1DSOA 4A78A 5L86A 3ZCYA 4ATJA 1HCHA 3CCPA 4JM5A 5AL9A 1AC8A 1DSGA 4JM9A 4CUOA 1ARXA 2AS1A 3RIVA 4CVJA 4JMSA 1BEQA 2ICVA 1FHFA 5KQHA 1AEGA 1CCBA 2XJ6A 1W4WA 1CMTA 1MK8A 2ATJA 3EXBA 5SXRA 2PCBA 2RBYX 4JQMA 3M2AA 1DCCA 4NVGB 1BEKA 4BLXA 1AEEA 5CCPA 4NVCA 2ANZA 1JCIA 1LY9A 2RBUX 3M2CA 1B85A 1AEBA 2EUOA 4G05A 5SW5A 1LYKA 2XI6A 4XV6A 3FKGA 7ATJA 5SYUA 5CIFA 3WXOA 1CMPA 3M27A 2RC0X 5ABOA 4NVEA 2EUPA 4JPUA 5CJHA 3M2IA 2Y6AA 5ABNA 1QPAA 2X07A 1A2FA 5SYKA 5KSKA 4NVKB 1QGJA 3ZCGA 3UW8A 5AOGA 5EJXA 3VLIA 1IYNA 5FNBA 3HDLA 1S6VA 2CCAA 4NVJB 2B10A 2VCSA 1APXA 4BLZA 2AS3A 4FDQA 1ARWA 3M29A 1AA4A 5SX7A 3R98A 1YYDA 4JMAA 3VLJA 4BM0A 3FM4A 4BM3A 2E3BA 3M2DA 1CCKA 2X08A 1AEQA 1H3JA 2V23A 4NVBA 1MNPA 4A5GA 2GGNX 1PA2A 5SYIA 2XJ5A 1RYCA 3VLKA 1H5HA 2GHDX 5SYHA 3M8MA 1CK6A 1H5KA 2GHHX 1CCLA 3M26A 2W23A 1KXMA 1BEPA 2YLJA 2VKAA 2RC2X 1DJ5A 5CIBA 4JQKA 4JMTA 2EUUA 4FEFA 5SXTA 1LLPA 1CCJA 2GB8A 1SOGA 5SX1A 5CICA 4CZQA 4USCA 1B82A 1MN2A 2E3AA 5SXWA 1U74A 5SW6A 5SXQA 2BOQA 1AEDA 1GWOA 1CCEA 1LGAA 3M2HA 1BGPA 2XILA 5JPRA 4NVOB 4CCXA 1AEHA 4JM6A 4BM2A 2V2EA 1ARYA 1ZBYA 1GZAA 3M2FA 1MKRA 3WNUA 1KRJA 1CYFA 2XIFA 1STQA 1MN1A 3FM1A 5KQ3A 5JHZA 3M5QA 2VCNA 4NVFA 1Z53A 5SYWA 1SDQA 3Q3UA
chains in the Genus database with same CATH superfamily
5KQ2A 1BEMA 4JMZA 5ALAA 6CCPA 1A2GA 2CCDA 5FNEA 4XV8A 4JN0A 2B11A 4C50A 3VLHA 1H5IA 4CZRA 2Y6BA 1AEVA 3M2EA 4JQNA 2E39A 5SX0B 2B12A 3VLLA 4JQJA 1AESA 1CCIA 4OQ7A 1AENA 2B0ZA 4XV7A 5SXSA 3FJWA 2AQDA 2EURA 1CCPA 1ATJA 1CCAA 1GW2A 2N18A 1C8IA 4PAEA 2GHKX 5KQ6A 3VLMA 7CCPA 2A7UB 2JMXA 4NVIB 4NVAA 1ML2A 1H5MA 2RBWX 2XIHA 4NVHB 5SYJA 1OAFA 4JB4A 5SX2A 1H5AA 5D6MA 4JMVA 5SX3A 1AC4A 3FMUA 4QYZB 5L05A 2IA8A 1UB2A 4JM8A 4JZAA 5EJTA 1EBEA 4CCPA 1AEKA 3UT2A 3M2BA 4XV5A 5SW4A 2AS2A 1ARUA 2PCCA 2RBVX 1CPGA 1CPEA 5CIHA 5SYVA 4BLLA 2JTIA 3RRWA 4A71A 4CZOA 1H5EA 2CEPA 5CIGA 3WA8A 1CMUA 1SCHA 1V0HX 1H5GA 1H5DA 2VO2X 3X1LF 1AEFA 1ZBZA 2GHCX 1DJ1A 2VNXX 1H58A 1U2KA 1YYGA 2WD4A 1BEJA 4FCNA 1H5CA 1SJ2A 1H5FA 1QO4A 3E2OA 1U2LA 4BM4A 1GWTA 3R99A 2AS6A 2EUQA 2EUTA 2OEBA 2AS4A 1DS4A 4NVDA 1GZBA 5ABQA 4A7MA 1KXNA 2YCGA 4XVAA 1SBMA 2VCFX 2BCNA 2VNZX 1CCGA 4CZPA 5SX0A 4NFGA 3ATJA 3ZCHA 2CYPA 1HSRA 4CVIA 1W4YA 1BVAA 1ARVA 3M28A 4FCSA 1BJ9A 4NVLA 1CCCA 2EUNA 1H57A 2RC1X 3X16A 1YZPA 3M23A 3M25A 4JPTA 4CZNA 5SXXA 4A6ZA 1AEOA 4BM1A 2CCPA 5SYYA 1ITKA 4BLKA 1B80A 1DSEA 4JMWA 4P4QA 6ATJA 5SYLA 1S73A 1BESA 2BO5A 4JPLA 5SYXA 2Y5AA 4U7UB 1CPFA 1H55A 1YZRA 1MKQA 2CL4X 2ZCAA 2EUSA 5SX6A 1GWUA 4BLYA 1H5LA 5CIDA 1OAGA 1AEUA 4JMBA 1CPDA 1ARPA 3E2NA 2ZOPA 3RIWA 5H9EB 1H5JA 3CCXA 2RBZX 1U75A 1AEJA 1KOKA 4NVNB 5L02A 1DSPA 1AEMA 3M2GA 2RBXX 5KQKA 1JDRA 5JHYA 1LYCA 5KSFA 2XJ8A 4NVMB 1LY8A 2GHEX 5CIEA 1KZMA 5JHXA 1GX2A 1CMQA 1AETA 5KQIA 5KQ0A 2RBTX 1U2JA 5JQRA 4GEDA 4C51A 5AMMA 3FM6A 4XV4A 4BLNA 1DSOA 4A78A 5L86A 3ZCYA 4ATJA 1HCHA 3CCPA 1ABVA 4JM5A 5AL9A 1AC8A 1DSGA 4JM9A 4CUOA 1ARXA 2AS1A 3RIVA 4CVJA 4JMSA 1BEQA 2ICVA 1FHFA 5KQHA 1AEGA 1CCBA 2XJ6A 1W4WA 1CMTA 1MK8A 2ATJA 3EXBA 5SXRA 2WSSS 2PCBA 2RBYX 4JQMA 3M2AA 1DCCA 4NVGB 1BEKA 4BLXA 1AEEA 5CCPA 4NVCA 2ANZA 1JCIA 1LY9A 2RBUX 3M2CA 1B85A 1AEBA 2EUOA 4G05A 4H7AA 5SW5A 1LYKA 2XI6A 4XV6A 3FKGA 7ATJA 5SYUA 5CIFA 3WXOA 1CMPA 3M27A 2RC0X 5ABOA 4NVEA 2EUPA 5H9FB 4JPUA 5CJHA 3M2IA 2Y6AA 5ABNA 1QPAA 2X07A 1A2FA 4H79A 5SYKA 5KSKA 4NVKB 1QGJA 3ZCGA 3UW8A 5AOGA 5EJXA 3VLIA 1IYNA 5FNBA 3HDLA 1S6VA 2CCAA 4NVJB 2B10A 2VCSA 1APXA 4BLZA 2AS3A 4FDQA 1ARWA 3M29A 1AA4A 5SX7A 3R98A 1YYDA 4JMAA 3VLJA 4BM0A 3FM4A 4BM3A 2E3BA 3M2DA 1CCKA 2X08A 1AEQA 1H3JA 2V23A 4NVBA 1MNPA 4A5GA 2GGNX 1PA2A 5SYIA 2XJ5A 1RYCA 3VLKA 4GKFA 1H5HA 2GHDX 5SYHA 3M8MA 1CK6A 1H5KA 2GHHX 1CCLA 3M26A 2W23A 1KXMA 1BEPA 2YLJA 2VKAA 2RC2X 1DJ5A 5CIBA 4JQKA 4JMTA 2EUUA 4FEFA 5SXTA 1LLPA 1CCJA 2GB8A 1SOGA 5SX1A 5CICA 4CZQA 4USCA 1B82A 1MN2A 2E3AA 5SXWA 1U74A 5SW6A 5SXQA 2BOQA 1AEDA 1GWOA 1CCEA 1LGAA 3M2HA 1BGPA 2XILA 5JPRA 4NVOB 5CD4J 4CCXA 1AEHA 4JM6A 4BM2A 2V2EA 1ARYA 1ZBYA 1GZAA 3M2FA 1MKRA 3WNUA 1KRJA 1CYFA 2XIFA 1STQA 1MN1A 3FM1A 5KQ3A 5JHZA 3M5QA 2VCNA 4NVFA 1Z53A 5SYWA 1SDQA 3Q3UA
chains in the Genus database with same CATH topology
5KQ2A 1BEMA 4JMZA 5ALAA 6CCPA 1A2GA 2CCDA 5FNEA 4XV8A 4JN0A 2B11A 4C50A 3VLHA 1H5IA 4CZRA 2Y6BA 1AEVA 3M2EA 4JQNA 2E39A 5SX0B 2B12A 3VLLA 4JQJA 1AESA 1CCIA 4OQ7A 1AENA 2B0ZA 4XV7A 5SXSA 3FJWA 2AQDA 2EURA 1CCPA 1ATJA 1CCAA 1GW2A 2N18A 1C8IA 4PAEA 2GHKX 5KQ6A 3VLMA 7CCPA 4NVIB 4NVAA 1ML2A 1H5MA 2RBWX 2XIHA 4NVHB 5SYJA 1OAFA 4JB4A 5SX2A 1H5AA 5D6MA 4JMVA 5SX3A 1AC4A 3FMUA 4QYZB 5L05A 2IA8A 1UB2A 4JM8A 4JZAA 5EJTA 1EBEA 4CCPA 1AEKA 3UT2A 3M2BA 4XV5A 5SW4A 2AS2A 1ARUA 2PCCA 2RBVX 1CPGA 1CPEA 5CIHA 5SYVA 4BLLA 2JTIA 3RRWA 4A71A 4CZOA 1H5EA 2CEPA 5CIGA 3WA8A 1CMUA 1SCHA 1V0HX 1H5GA 1H5DA 2VO2X 1AEFA 1ZBZA 2GHCX 1DJ1A 2VNXX 1H58A 1U2KA 1YYGA 2WD4A 1BEJA 4FCNA 1H5CA 1SJ2A 1H5FA 1QO4A 3E2OA 1U2LA 4BM4A 1GWTA 3R99A 2AS6A 2EUQA 2EUTA 2AS4A 1DS4A 4NVDA 1GZBA 5ABQA 4A7MA 1KXNA 2YCGA 4XVAA 1SBMA 2VCFX 2BCNA 2VNZX 1CCGA 4CZPA 5SX0A 4NFGA 3ATJA 3ZCHA 2CYPA 1HSRA 4CVIA 1W4YA 1BVAA 1ARVA 3M28A 4FCSA 1BJ9A 4NVLA 1CCCA 2EUNA 1H57A 2RC1X 3X16A 1YZPA 3M23A 3M25A 4JPTA 4CZNA 5SXXA 4A6ZA 1AEOA 4BM1A 2CCPA 5SYYA 1ITKA 4BLKA 1B80A 1DSEA 4JMWA 4P4QA 6ATJA 5SYLA 1S73A 1BESA 4JPLA 5SYXA 2Y5AA 4U7UB 1CPFA 1H55A 1YZRA 1MKQA 2CL4X 2ZCAA 2EUSA 5SX6A 1GWUA 4BLYA 1H5LA 5CIDA 1OAGA 1AEUA 4JMBA 1CPDA 1ARPA 3E2NA 3RIWA 5H9EB 1H5JA 3CCXA 2RBZX 1U75A 1AEJA 1KOKA 4NVNB 5L02A 1DSPA 1AEMA 3M2GA 2RBXX 5KQKA 1JDRA 5JHYA 1LYCA 5KSFA 2XJ8A 4NVMB 1LY8A 2GHEX 5CIEA 1KZMA 5JHXA 1GX2A 1CMQA 1AETA 5KQIA 5KQ0A 2RBTX 1U2JA 5JQRA 4GEDA 4C51A 5AMMA 3FM6A 4XV4A 4BLNA 1DSOA 4A78A 5L86A 3ZCYA 4ATJA 1HCHA 3CCPA 4JM5A 5AL9A 1AC8A 1DSGA 4JM9A 4CUOA 1ARXA 2AS1A 3RIVA 4CVJA 4JMSA 1BEQA 2ICVA 1FHFA 5KQHA 1AEGA 1CCBA 2XJ6A 1W4WA 1CMTA 1MK8A 2ATJA 3EXBA 5SXRA 2PCBA 2RBYX 4JQMA 3M2AA 1DCCA 4NVGB 1BEKA 4BLXA 1AEEA 5CCPA 4NVCA 2ANZA 1JCIA 1LY9A 2RBUX 3M2CA 1B85A 1AEBA 2EUOA 4G05A 4H7AA 5SW5A 1LYKA 2XI6A 4XV6A 3FKGA 7ATJA 5SYUA 5CIFA 3WXOA 1CMPA 3M27A 2RC0X 5ABOA 4NVEA 2EUPA 5H9FB 4JPUA 5CJHA 3M2IA 2Y6AA 5ABNA 1QPAA 2X07A 1A2FA 4H79A 5SYKA 5KSKA 4NVKB 1QGJA 3ZCGA 3UW8A 5AOGA 5EJXA 3VLIA 1IYNA 5FNBA 3HDLA 1S6VA 2CCAA 4NVJB 2B10A 2VCSA 1APXA 4BLZA 2AS3A 4FDQA 1ARWA 3M29A 1AA4A 5SX7A 3R98A 1YYDA 4JMAA 3VLJA 4BM0A 3FM4A 4BM3A 2E3BA 3M2DA 1CCKA 2X08A 1AEQA 1H3JA 2V23A 4NVBA 1MNPA 4A5GA 2GGNX 1PA2A 5SYIA 2XJ5A 1RYCA 3VLKA 1H5HA 2GHDX 5SYHA 3M8MA 1CK6A 1H5KA 2GHHX 1CCLA 3M26A 2W23A 1KXMA 1BEPA 2YLJA 2VKAA 2RC2X 1DJ5A 5CIBA 4JQKA 4JMTA 2EUUA 4FEFA 5SXTA 1LLPA 1CCJA 2GB8A 1SOGA 5SX1A 5CICA 4CZQA 4USCA 1B82A 1MN2A 2E3AA 5SXWA 1U74A 5SW6A 5SXQA 2BOQA 1AEDA 1GWOA 1CCEA 1LGAA 3M2HA 1BGPA 2XILA 5JPRA 4NVOB 5CD4J 4CCXA 1AEHA 4JM6A 4BM2A 2V2EA 1ARYA 1ZBYA 1GZAA 3M2FA 1MKRA 3WNUA 1KRJA 1CYFA 2XIFA 1STQA 1MN1A 3FM1A 5KQ3A 5JHZA 3M5QA 2VCNA 4NVFA 1Z53A 5SYWA 1SDQA 3Q3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KQ2 A;  1BEM A;  4JMZ A;  5ALA A;  6CCP A;  1A2G A;  2CCD A;  5FNE A;  4XV8 A;  4JN0 A;  2B11 A;  4C50 A;  3VLH A;  1H5I A;  4CZR A;  2Y6B A;  1AEV A;  3M2E A;  4JQN A;  2E39 A;  5SX0 B;  2B12 A;  3VLL A;  4JQJ A;  1AES A;  1CCI A;  4OQ7 A;  1AEN A;  2B0Z A;  4XV7 A;  5SXS A;  3FJW A;  2AQD A;  2EUR A;  1CCP A;  1ATJ A;  1CCA A;  1GW2 A;  2N18 A;  1C8I A;  4PAE A;  2GHK X;  5KQ6 A;  3VLM A;  7CCP A;  4NVI B;  4NVA A;  1ML2 A;  1H5M A;  2RBW X;  2XIH A;  4NVH B;  5SYJ A;  1OAF A;  4JB4 A;  5SX2 A;  1H5A A;  5D6M A;  4JMV A;  5SX3 A;  1AC4 A;  3FMU A;  5L05 A;  2IA8 A;  1UB2 A;  4JM8 A;  5EJT A;  1EBE A;  4CCP A;  1AEK A;  3UT2 A;  3M2B A;  4XV5 A;  5SW4 A;  2AS2 A;  1ARU A;  2PCC A;  2RBV X;  1CPG A;  1CPE A;  5CIH A;  5SYV A;  4BLL A;  2JTI A;  3RRW A;  4A71 A;  4CZO A;  1H5E A;  2CEP A;  5CIG A;  1CMU A;  1SCH A;  1V0H X;  1H5G A;  1H5D A;  2VO2 X;  1AEF A;  1ZBZ A;  2GHC X;  1DJ1 A;  2VNX X;  1H58 A;  1U2K A;  1YYG A;  2WD4 A;  1BEJ A;  4FCN A;  1H5C A;  1SJ2 A;  1H5F A;  1QO4 A;  3E2O A;  1U2L A;  4BM4 A;  1GWT A;  3R99 A;  2AS6 A;  2EUQ A;  2EUT A;  2AS4 A;  1DS4 A;  4NVD A;  1GZB A;  5ABQ A;  4A7M A;  1KXN A;  2YCG A;  4XVA A;  1SBM A;  2VCF X;  2BCN A;  2VNZ X;  1CCG A;  4CZP A;  5SX0 A;  4NFG A;  3ATJ A;  3ZCH A;  2CYP A;  1HSR A;  4CVI A;  1W4Y A;  1BVA A;  1ARV A;  3M28 A;  4FCS A;  1BJ9 A;  4NVL A;  1CCC A;  2EUN A;  1H57 A;  2RC1 X;  3X16 A;  1YZP A;  3M23 A;  3M25 A;  4JPT A;  4CZN A;  5SXX A;  4A6Z A;  1AEO A;  4BM1 A;  2CCP A;  5SYY A;  1ITK A;  4BLK A;  1B80 A;  1DSE A;  4JMW A;  4P4Q A;  6ATJ A;  5SYL A;  1S73 A;  1BES A;  4JPL A;  5SYX A;  2Y5A A;  1CPF A;  1H55 A;  1YZR A;  1MKQ A;  2CL4 X;  2EUS A;  5SX6 A;  1GWU A;  4BLY A;  1H5L A;  5CID A;  1OAG A;  1AEU A;  4JMB A;  1CPD A;  1ARP A;  3E2N A;  3RIW A;  1H5J A;  3CCX A;  2RBZ X;  1U75 A;  1AEJ A;  1KOK A;  4NVN B;  5L02 A;  1DSP A;  1AEM A;  3M2G A;  2RBX X;  5KQK A;  1JDR A;  5JHY A;  1LYC A;  5KSF A;  2XJ8 A;  4NVM B;  1LY8 A;  2GHE X;  5CIE A;  1KZM A;  5JHX A;  1GX2 A;  1CMQ A;  1AET A;  5KQI A;  5KQ0 A;  2RBT X;  1U2J A;  5JQR A;  4GED A;  4C51 A;  5AMM A;  3FM6 A;  4XV4 A;  4BLN A;  1DSO A;  4A78 A;  5L86 A;  3ZCY A;  4ATJ A;  1HCH A;  3CCP A;  4JM5 A;  5AL9 A;  1AC8 A;  1DSG A;  4JM9 A;  4CUO A;  1ARX A;  2AS1 A;  3RIV A;  4CVJ A;  4JMS A;  1BEQ A;  2ICV A;  1FHF A;  5KQH A;  1AEG A;  1CCB A;  2XJ6 A;  1W4W A;  1CMT A;  1MK8 A;  2ATJ A;  3EXB A;  5SXR A;  2PCB A;  2RBY X;  4JQM A;  3M2A A;  1DCC A;  4NVG B;  1BEK A;  4BLX A;  1AEE A;  5CCP A;  4NVC A;  2ANZ A;  1JCI A;  1LY9 A;  2RBU X;  3M2C A;  1B85 A;  1AEB A;  2EUO A;  4G05 A;  5SW5 A;  1LYK A;  2XI6 A;  4XV6 A;  3FKG A;  7ATJ A;  5SYU A;  5CIF A;  3WXO A;  1CMP A;  3M27 A;  2RC0 X;  5ABO A;  4NVE A;  2EUP A;  4JPU A;  5CJH A;  3M2I A;  2Y6A A;  5ABN A;  1QPA A;  2X07 A;  1A2F A;  5SYK A;  5KSK A;  4NVK B;  1QGJ A;  3ZCG A;  3UW8 A;  5AOG A;  5EJX A;  3VLI A;  1IYN A;  5FNB A;  3HDL A;  1S6V A;  2CCA A;  4NVJ B;  2B10 A;  2VCS A;  1APX A;  4BLZ A;  2AS3 A;  4FDQ A;  1ARW A;  3M29 A;  1AA4 A;  5SX7 A;  3R98 A;  1YYD A;  4JMA A;  3VLJ A;  4BM0 A;  3FM4 A;  4BM3 A;  2E3B A;  3M2D A;  1CCK A;  2X08 A;  1AEQ A;  1H3J A;  2V23 A;  4NVB A;  1MNP A;  4A5G A;  2GGN X;  1PA2 A;  5SYI A;  2XJ5 A;  1RYC A;  3VLK A;  1H5H A;  2GHD X;  5SYH A;  3M8M A;  1CK6 A;  1H5K A;  2GHH X;  1CCL A;  3M26 A;  2W23 A;  1KXM A;  1BEP A;  2YLJ A;  2VKA A;  2RC2 X;  1DJ5 A;  5CIB A;  4JQK A;  4JMT A;  2EUU A;  4FEF A;  5SXT A;  1LLP A;  1CCJ A;  2GB8 A;  1SOG A;  5SX1 A;  5CIC A;  4CZQ A;  4USC A;  1B82 A;  1MN2 A;  2E3A A;  5SXW A;  1U74 A;  5SW6 A;  5SXQ A;  2BOQ A;  1AED A;  1GWO A;  1CCE A;  1LGA A;  3M2H A;  1BGP A;  2XIL A;  5JPR A;  4NVO B;  4CCX A;  1AEH A;  4JM6 A;  4BM2 A;  2V2E A;  1ARY A;  1ZBY A;  1GZA A;  3M2F A;  1MKR A;  3WNU A;  1KRJ A;  1CYF A;  2XIF A;  1STQ A;  1MN1 A;  3FM1 A;  5KQ3 A;  5JHZ A;  3M5Q A;  2VCN A;  4NVF A;  1Z53 A;  5SYW A;  1SDQ A;  3Q3U A; 
#chains in the Genus database with same CATH topology
 5KQ2 A;  1BEM A;  4JMZ A;  5ALA A;  6CCP A;  1A2G A;  2CCD A;  5FNE A;  4XV8 A;  4JN0 A;  2B11 A;  4C50 A;  3VLH A;  1H5I A;  4CZR A;  2Y6B A;  1AEV A;  3M2E A;  4JQN A;  2E39 A;  5SX0 B;  2B12 A;  3VLL A;  4JQJ A;  1AES A;  1CCI A;  4OQ7 A;  1AEN A;  2B0Z A;  4XV7 A;  5SXS A;  3FJW A;  2AQD A;  2EUR A;  1CCP A;  1ATJ A;  1CCA A;  1GW2 A;  2N18 A;  1C8I A;  4PAE A;  2GHK X;  5KQ6 A;  3VLM A;  7CCP A;  2A7U B;  2JMX A;  4NVI B;  4NVA A;  1ML2 A;  1H5M A;  2RBW X;  2XIH A;  4NVH B;  5SYJ A;  1OAF A;  4JB4 A;  5SX2 A;  1H5A A;  5D6M A;  4JMV A;  5SX3 A;  1AC4 A;  3FMU A;  4QYZ B;  5L05 A;  2IA8 A;  1UB2 A;  4JM8 A;  4JZA A;  5EJT A;  1EBE A;  4CCP A;  1AEK A;  3UT2 A;  3M2B A;  4XV5 A;  5SW4 A;  2AS2 A;  1ARU A;  2PCC A;  2RBV X;  1CPG A;  1CPE A;  5CIH A;  5SYV A;  4BLL A;  2JTI A;  3RRW A;  4A71 A;  4CZO A;  1H5E A;  2CEP A;  5CIG A;  3WA8 A;  1CMU A;  1SCH A;  1V0H X;  1H5G A;  1H5D A;  2VO2 X;  3X1L F;  1AEF A;  1ZBZ A;  2GHC X;  1DJ1 A;  2VNX X;  1H58 A;  1U2K A;  1YYG A;  2WD4 A;  1BEJ A;  4FCN A;  1H5C A;  1SJ2 A;  1H5F A;  1QO4 A;  3E2O A;  1U2L A;  4BM4 A;  1GWT A;  3R99 A;  2AS6 A;  2EUQ A;  2EUT A;  2OEB A;  2AS4 A;  1DS4 A;  4NVD A;  1GZB A;  5ABQ A;  4A7M A;  1KXN A;  2YCG A;  4XVA A;  1SBM A;  2VCF X;  2BCN A;  2VNZ X;  1CCG A;  4CZP A;  5SX0 A;  4NFG A;  3ATJ A;  3ZCH A;  2CYP A;  1HSR A;  4CVI A;  1W4Y A;  1BVA A;  1ARV A;  3M28 A;  4FCS A;  1BJ9 A;  4NVL A;  1CCC A;  2EUN A;  1H57 A;  2RC1 X;  3X16 A;  1YZP A;  3M23 A;  3M25 A;  4JPT A;  4CZN A;  5SXX A;  4A6Z A;  1AEO A;  4BM1 A;  2CCP A;  5SYY A;  1ITK A;  4BLK A;  1B80 A;  1DSE A;  4JMW A;  4P4Q A;  6ATJ A;  5SYL A;  1S73 A;  1BES A;  2BO5 A;  4JPL A;  5SYX A;  2Y5A A;  4U7U B;  1CPF A;  1H55 A;  1YZR A;  1MKQ A;  2CL4 X;  2ZCA A;  2EUS A;  5SX6 A;  1GWU A;  4BLY A;  1H5L A;  5CID A;  1OAG A;  1AEU A;  4JMB A;  1CPD A;  1ARP A;  3E2N A;  2ZOP A;  3RIW A;  5H9E B;  1H5J A;  3CCX A;  2RBZ X;  1U75 A;  1AEJ A;  1KOK A;  4NVN B;  5L02 A;  1DSP A;  1AEM A;  3M2G A;  2RBX X;  5KQK A;  1JDR A;  5JHY A;  1LYC A;  5KSF A;  2XJ8 A;  4NVM B;  1LY8 A;  2GHE X;  5CIE A;  1KZM A;  5JHX A;  1GX2 A;  1CMQ A;  1AET A;  5KQI A;  5KQ0 A;  2RBT X;  1U2J A;  5JQR A;  4GED A;  4C51 A;  5AMM A;  3FM6 A;  4XV4 A;  4BLN A;  1DSO A;  4A78 A;  5L86 A;  3ZCY A;  4ATJ A;  1HCH A;  3CCP A;  1ABV A;  4JM5 A;  5AL9 A;  1AC8 A;  1DSG A;  4JM9 A;  4CUO A;  1ARX A;  2AS1 A;  3RIV A;  4CVJ A;  4JMS A;  1BEQ A;  2ICV A;  1FHF A;  5KQH A;  1AEG A;  1CCB A;  2XJ6 A;  1W4W A;  1CMT A;  1MK8 A;  2ATJ A;  3EXB A;  5SXR A;  2WSS S;  2PCB A;  2RBY X;  4JQM A;  3M2A A;  1DCC A;  4NVG B;  1BEK A;  4BLX A;  1AEE A;  5CCP A;  4NVC A;  2ANZ A;  1JCI A;  1LY9 A;  2RBU X;  3M2C A;  1B85 A;  1AEB A;  2EUO A;  4G05 A;  4H7A A;  5SW5 A;  1LYK A;  2XI6 A;  4XV6 A;  3FKG A;  7ATJ A;  5SYU A;  5CIF A;  3WXO A;  1CMP A;  3M27 A;  2RC0 X;  5ABO A;  4NVE A;  2EUP A;  5H9F B;  4JPU A;  5CJH A;  3M2I A;  2Y6A A;  5ABN A;  1QPA A;  2X07 A;  1A2F A;  4H79 A;  5SYK A;  5KSK A;  4NVK B;  1QGJ A;  3ZCG A;  3UW8 A;  5AOG A;  5EJX A;  3VLI A;  1IYN A;  5FNB A;  3HDL A;  1S6V A;  2CCA A;  4NVJ B;  2B10 A;  2VCS A;  1APX A;  4BLZ A;  2AS3 A;  4FDQ A;  1ARW A;  3M29 A;  1AA4 A;  5SX7 A;  3R98 A;  1YYD A;  4JMA A;  3VLJ A;  4BM0 A;  3FM4 A;  4BM3 A;  2E3B A;  3M2D A;  1CCK A;  2X08 A;  1AEQ A;  1H3J A;  2V23 A;  4NVB A;  1MNP A;  4A5G A;  2GGN X;  1PA2 A;  5SYI A;  2XJ5 A;  1RYC A;  3VLK A;  4GKF A;  1H5H A;  2GHD X;  5SYH A;  3M8M A;  1CK6 A;  1H5K A;  2GHH X;  1CCL A;  3M26 A;  2W23 A;  1KXM A;  1BEP A;  2YLJ A;  2VKA A;  2RC2 X;  1DJ5 A;  5CIB A;  4JQK A;  4JMT A;  2EUU A;  4FEF A;  5SXT A;  1LLP A;  1CCJ A;  2GB8 A;  1SOG A;  5SX1 A;  5CIC A;  4CZQ A;  4USC A;  1B82 A;  1MN2 A;  2E3A A;  5SXW A;  1U74 A;  5SW6 A;  5SXQ A;  2BOQ A;  1AED A;  1GWO A;  1CCE A;  1LGA A;  3M2H A;  1BGP A;  2XIL A;  5JPR A;  4NVO B;  5CD4 J;  4CCX A;  1AEH A;  4JM6 A;  4BM2 A;  2V2E A;  1ARY A;  1ZBY A;  1GZA A;  3M2F A;  1MKR A;  3WNU A;  1KRJ A;  1CYF A;  2XIF A;  1STQ A;  1MN1 A;  3FM1 A;  5KQ3 A;  5JHZ A;  3M5Q A;  2VCN A;  4NVF A;  1Z53 A;  5SYW A;  1SDQ A;  3Q3U A; 
#chains in the Genus database with same CATH homology
 5KQ2 A;  1BEM A;  4JMZ A;  5ALA A;  6CCP A;  1A2G A;  2CCD A;  5FNE A;  4XV8 A;  4JN0 A;  2B11 A;  4C50 A;  3VLH A;  1H5I A;  4CZR A;  2Y6B A;  1AEV A;  3M2E A;  4JQN A;  2E39 A;  5SX0 B;  2B12 A;  3VLL A;  4JQJ A;  1AES A;  1CCI A;  4OQ7 A;  1AEN A;  2B0Z A;  4XV7 A;  5SXS A;  3FJW A;  2AQD A;  2EUR A;  1CCP A;  1ATJ A;  1CCA A;  1GW2 A;  2N18 A;  1C8I A;  4PAE A;  2GHK X;  5KQ6 A;  3VLM A;  7CCP A;  4NVI B;  4NVA A;  1ML2 A;  1H5M A;  2RBW X;  2XIH A;  4NVH B;  5SYJ A;  1OAF A;  4JB4 A;  5SX2 A;  1H5A A;  5D6M A;  4JMV A;  5SX3 A;  1AC4 A;  3FMU A;  4QYZ B;  5L05 A;  2IA8 A;  1UB2 A;  4JM8 A;  4JZA A;  5EJT A;  1EBE A;  4CCP A;  1AEK A;  3UT2 A;  3M2B A;  4XV5 A;  5SW4 A;  2AS2 A;  1ARU A;  2PCC A;  2RBV X;  1CPG A;  1CPE A;  5CIH A;  5SYV A;  4BLL A;  2JTI A;  3RRW A;  4A71 A;  4CZO A;  1H5E A;  2CEP A;  5CIG A;  3WA8 A;  1CMU A;  1SCH A;  1V0H X;  1H5G A;  1H5D A;  2VO2 X;  1AEF A;  1ZBZ A;  2GHC X;  1DJ1 A;  2VNX X;  1H58 A;  1U2K A;  1YYG A;  2WD4 A;  1BEJ A;  4FCN A;  1H5C A;  1SJ2 A;  1H5F A;  1QO4 A;  3E2O A;  1U2L A;  4BM4 A;  1GWT A;  3R99 A;  2AS6 A;  2EUQ A;  2EUT A;  2AS4 A;  1DS4 A;  4NVD A;  1GZB A;  5ABQ A;  4A7M A;  1KXN A;  2YCG A;  4XVA A;  1SBM A;  2VCF X;  2BCN A;  2VNZ X;  1CCG A;  4CZP A;  5SX0 A;  4NFG A;  3ATJ A;  3ZCH A;  2CYP A;  1HSR A;  4CVI A;  1W4Y A;  1BVA A;  1ARV A;  3M28 A;  4FCS A;  1BJ9 A;  4NVL A;  1CCC A;  2EUN A;  1H57 A;  2RC1 X;  3X16 A;  1YZP A;  3M23 A;  3M25 A;  4JPT A;  4CZN A;  5SXX A;  4A6Z A;  1AEO A;  4BM1 A;  2CCP A;  5SYY A;  1ITK A;  4BLK A;  1B80 A;  1DSE A;  4JMW A;  4P4Q A;  6ATJ A;  5SYL A;  1S73 A;  1BES A;  4JPL A;  5SYX A;  2Y5A A;  4U7U B;  1CPF A;  1H55 A;  1YZR A;  1MKQ A;  2CL4 X;  2ZCA A;  2EUS A;  5SX6 A;  1GWU A;  4BLY A;  1H5L A;  5CID A;  1OAG A;  1AEU A;  4JMB A;  1CPD A;  1ARP A;  3E2N A;  3RIW A;  5H9E B;  1H5J A;  3CCX A;  2RBZ X;  1U75 A;  1AEJ A;  1KOK A;  4NVN B;  5L02 A;  1DSP A;  1AEM A;  3M2G A;  2RBX X;  5KQK A;  1JDR A;  5JHY A;  1LYC A;  5KSF A;  2XJ8 A;  4NVM B;  1LY8 A;  2GHE X;  5CIE A;  1KZM A;  5JHX A;  1GX2 A;  1CMQ A;  1AET A;  5KQI A;  5KQ0 A;  2RBT X;  1U2J A;  5JQR A;  4GED A;  4C51 A;  5AMM A;  3FM6 A;  4XV4 A;  4BLN A;  1DSO A;  4A78 A;  5L86 A;  3ZCY A;  4ATJ A;  1HCH A;  3CCP A;  4JM5 A;  5AL9 A;  1AC8 A;  1DSG A;  4JM9 A;  4CUO A;  1ARX A;  2AS1 A;  3RIV A;  4CVJ A;  4JMS A;  1BEQ A;  2ICV A;  1FHF A;  5KQH A;  1AEG A;  1CCB A;  2XJ6 A;  1W4W A;  1CMT A;  1MK8 A;  2ATJ A;  3EXB A;  5SXR A;  2PCB A;  2RBY X;  4JQM A;  3M2A A;  1DCC A;  4NVG B;  1BEK A;  4BLX A;  1AEE A;  5CCP A;  4NVC A;  2ANZ A;  1JCI A;  1LY9 A;  2RBU X;  3M2C A;  1B85 A;  1AEB A;  2EUO A;  4G05 A;  4H7A A;  5SW5 A;  1LYK A;  2XI6 A;  4XV6 A;  3FKG A;  7ATJ A;  5SYU A;  5CIF A;  3WXO A;  1CMP A;  3M27 A;  2RC0 X;  5ABO A;  4NVE A;  2EUP A;  5H9F B;  4JPU A;  5CJH A;  3M2I A;  2Y6A A;  5ABN A;  1QPA A;  2X07 A;  1A2F A;  4H79 A;  5SYK A;  5KSK A;  4NVK B;  1QGJ A;  3ZCG A;  3UW8 A;  5AOG A;  5EJX A;  3VLI A;  1IYN A;  5FNB A;  3HDL A;  1S6V A;  2CCA A;  4NVJ B;  2B10 A;  2VCS A;  1APX A;  4BLZ A;  2AS3 A;  4FDQ A;  1ARW A;  3M29 A;  1AA4 A;  5SX7 A;  3R98 A;  1YYD A;  4JMA A;  3VLJ A;  4BM0 A;  3FM4 A;  4BM3 A;  2E3B A;  3M2D A;  1CCK A;  2X08 A;  1AEQ A;  1H3J A;  2V23 A;  4NVB A;  1MNP A;  4A5G A;  2GGN X;  1PA2 A;  5SYI A;  2XJ5 A;  1RYC A;  3VLK A;  1H5H A;  2GHD X;  5SYH A;  3M8M A;  1CK6 A;  1H5K A;  2GHH X;  1CCL A;  3M26 A;  2W23 A;  1KXM A;  1BEP A;  2YLJ A;  2VKA A;  2RC2 X;  1DJ5 A;  5CIB A;  4JQK A;  4JMT A;  2EUU A;  4FEF A;  5SXT A;  1LLP A;  1CCJ A;  2GB8 A;  1SOG A;  5SX1 A;  5CIC A;  4CZQ A;  4USC A;  1B82 A;  1MN2 A;  2E3A A;  5SXW A;  1U74 A;  5SW6 A;  5SXQ A;  2BOQ A;  1AED A;  1GWO A;  1CCE A;  1LGA A;  3M2H A;  1BGP A;  2XIL A;  5JPR A;  4NVO B;  5CD4 J;  4CCX A;  1AEH A;  4JM6 A;  4BM2 A;  2V2E A;  1ARY A;  1ZBY A;  1GZA A;  3M2F A;  1MKR A;  3WNU A;  1KRJ A;  1CYF A;  2XIF A;  1STQ A;  1MN1 A;  3FM1 A;  5KQ3 A;  5JHZ A;  3M5Q A;  2VCN A;  4NVF A;  1Z53 A;  5SYW A;  1SDQ A;  3Q3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...