5H9FB

Crystal structure of e. coli cascade bound to a pam-containing dsdna target at 2.45 angstrom resolution.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
153
Chain Sequence
DEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKKTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
molecule keywords CRISPR system Cascade subunit CasA
molecule tags Immune system/rna
source organism Escherichia coli (strain k12)
total genus 49
structure length 153
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09485 CRISPR_Cse2 CRISPR-associated protein Cse2 (CRISPR_cse2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.40 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 5h9fB00
4U7UB 4H7AA 3WA8A 4H79A 5CD4J 5H9FB 5H9EB 2ZCAA 4QYZB
chains in the Genus database with same CATH superfamily
1GZBA 3M2DA 2YCGA 1BEKA 1ABVA 5KQ6A 2EUOA 3FM6A 1KXNA 1LY8A 2GHDX 1LLPA 4BM1A 3ATJA 2CYPA 3X16A 2RBZX 5ABOA 1CPDA 1AEMA 2AS1A 4JN0A 2BO5A 1CK6A 1AEJA 1AEQA 1YYDA 5CIGA 1Z53A 2VCFX 1MKQA 5SW5A 3FM1A 4JPTA 1V0HX 2XILA 1ZBYA 1CCGA 4CZQA 5KQ0A 1CCEA 2Y5AA 1AEOA 2EURA 1GWOA 4A6ZA 5H9EB 1AEVA 1AEGA 5KQIA 3Q3UA 5CIHA 4BLZA 1YZRA 2RBWX 3M29A 5SYKA 1CCIA 2XJ5A 1H5AA 1HSRA 1MN2A 4NVNB 2AS3A 4NVIB 2EUQA 2ZOPA 2JTIA 1AEBA 1AEFA 1GWTA 5L02A 1H5EA 1SOGA 3E2NA 2EUPA 3ZCGA 4BLNA 5CICA 2RC0X 4JMTA 4A7MA 3FM4A 1GWUA 3M2CA 4NVDA 2XI6A 2B0ZA 4CCPA 4BLKA 4CCXA 4XV7A 5KQ3A 2A7UB 3VLMA 1AEHA 1OAGA 5L05A 4G05A 1CCPA 1LYCA 2EUNA 1KXMA 2E3AA 1APXA 4XV6A 5SYWA 1IYNA 1SBMA 1C8IA 5ABQA 4A71A 1ARPA 4JM8A 4NVCA 4BM4A 1BJ9A 5CIFA 4NFGA 2GGNX 5AL9A 4JMBA 1AC8A 2W23A 3M27A 1CPFA 1H57A 4JB4A 4BM2A 5SXTA 5SYVA 1W4YA 4FEFA 5JQRA 4NVFA 5SXSA 4XV8A 1RYCA 2CCAA 5CD4J 1A2GA 4FCSA 4JM6A 2B12A 5SW6A 5CJHA 3WNUA 5JPRA 1CCAA 2XIFA 5CIEA 4BM3A 4JQJA 2B11A 4C50A 1STQA 1CCJA 3M2BA 3M2AA 2CEPA 1BEPA 2E3BA 1DSPA 2X08A 2WD4A 1AEUA 2EUUA 2IA8A 1AA4A 4BLXA 1H58A 1AEDA 1CMUA 2XJ6A 4JQMA 4BLLA 4USCA 3R99A 1DS4A 4CZPA 2EUTA 2VCNA 3CCXA 4JMWA 5SX2A 1DSGA 1H3JA 1AC4A 1U2LA 1HCHA 5AMMA 1MK8A 3RRWA 2AS4A 3R98A 5SYUA 3VLIA 1AENA 5L86A 1KOKA 2ICVA 4JM5A 1A2FA 3FJWA 1BESA 2CCPA 2N18A 1B82A 5KSKA 1ARXA 2RC1X 1CMQA 5H9FB 1H5MA 2E39A 3UW8A 2X07A 1ITKA 1DSEA 2RBYX 4C51A 2CCDA 4XV4A 5KQKA 3M25A 4XV5A 1KRJA 5EJXA 1H5GA 1CCCA 4NVEA 2RBUX 5CIDA 7CCPA 1ARUA 1ATJA 4A78A 3VLLA 2GHEX 3E2OA 5SYIA 2V2EA 1H5CA 2GB8A 4NVAA 4BLYA 5ABNA 2AS6A 1QPAA 1H5JA 4NVMB 4BM0A 1LY9A 5FNEA 5SX0A 5D6MA 2GHKX 3WA8A 5SYXA 4CUOA 2EUSA 1ZBZA 2ATJA 1W4WA 2CL4X 2AS2A 2XJ8A 1AETA 4CVJA 3M28A 2YLJA 1U75A 1PA2A 1QO4A 1CYFA 1H5IA 1U2KA 1GZAA 2VCSA 2AQDA 5JHXA 1CMPA 4P4QA 1H5LA 4FDQA 4JPUA 1CCKA 3X1LF 1QGJA 3M2IA 2VNXX 4JQNA 5SX0B 5KQHA 3RIWA 5SXXA 3WXOA 1CCLA 7ATJA 3M23A 2RBTX 1CMTA 1ARWA 1H5HA 2ZCAA 3EXBA 1DJ5A 1U2JA 5SXRA 2OEBA 3VLJA 1BEJA 1S73A 2RC2X 1SDQA 5SX6A 4JMVA 5SX7A 4JQKA 1AEEA 5CCPA 2VKAA 4JZAA 4CZOA 2VNZX 1BGPA 3M2GA 1YYGA 1ARYA 4JMAA 2RBXX 5SYLA 2GHCX 1AESA 1EBEA 3M2FA 5SXQA 3M2HA 1LYKA 2VO2X 5AOGA 3FKGA 2BCNA 4PAEA 5SXWA 3M8MA 4CVIA 2PCCA 5JHYA 2BOQA 3ZCYA 5KQ2A 1H55A 4NVBA 2XIHA 3FMUA 1CCBA 3UT2A 3CCPA 3VLKA 1OAFA 4CZNA 1U74A 1H5DA 1JDRA 1GW2A 1KZMA 1BEQA 4JM9A 1AEKA 4JMSA 2Y6BA 2WSSS 5EJTA 3HDLA 4GKFA 3M5QA 1CPGA 5FNBA 4QYZB 4NVLA 1BVAA 4H7AA 4NVHB 5SX1A 5KSFA 4CZRA 3RIVA 4ATJA 1H5FA 1LGAA 3M26A 2GHHX 1MNPA 3M2EA 5ALAA 5SYJA 5JHZA 2Y6AA 5CIBA 1MN1A 2RBVX 1DSOA 5SYHA 1ARVA 1SCHA 4GEDA 4JMZA 1BEMA 1H5KA 4XVAA 6CCPA 4NVJB 2ANZA 4JPLA 4NVOB 4FCNA 1JCIA 6ATJA 3ZCHA 1YZPA 2B10A 1FHFA 2JMXA 4U7UB 1B80A 4OQ7A 1B85A 1S6VA 1SJ2A 2PCBA 5SYYA 4NVKB 1UB2A 1MKRA 1ML2A 2V23A 5SW4A 1CPEA 3VLHA 1GX2A 1DCCA 4A5GA 4NVGB 1DJ1A 4H79A 5SX3A
chains in the Genus database with same CATH topology
1GZBA 3M2DA 2YCGA 1BEKA 5KQ6A 2EUOA 3FM6A 1KXNA 1LY8A 2GHDX 1LLPA 4BM1A 3ATJA 2CYPA 3X16A 2RBZX 5ABOA 1CPDA 1AEMA 2AS1A 4JN0A 1CK6A 1AEJA 1AEQA 1YYDA 5CIGA 1Z53A 2VCFX 1MKQA 5SW5A 3FM1A 4JPTA 1V0HX 2XILA 1ZBYA 1CCGA 4CZQA 5KQ0A 1CCEA 2Y5AA 1AEOA 2EURA 1GWOA 4A6ZA 5H9EB 1AEVA 1AEGA 5KQIA 3Q3UA 5CIHA 4BLZA 1YZRA 2RBWX 3M29A 5SYKA 1CCIA 2XJ5A 1H5AA 1HSRA 4NVNB 1MN2A 2AS3A 4NVIB 2EUQA 2JTIA 1AEBA 1AEFA 1GWTA 5L02A 1H5EA 1SOGA 3E2NA 2EUPA 3ZCGA 4BLNA 5CICA 2RC0X 4JMTA 4A7MA 3FM4A 1GWUA 3M2CA 4NVDA 2XI6A 2B0ZA 4CCPA 4BLKA 4CCXA 4XV7A 5KQ3A 3VLMA 1AEHA 1OAGA 5L05A 4G05A 1CCPA 1LYCA 2EUNA 1KXMA 2E3AA 1APXA 4XV6A 5SYWA 1IYNA 1SBMA 1C8IA 5ABQA 4A71A 1ARPA 4JM8A 4NVCA 4BM4A 1BJ9A 5CIFA 4NFGA 2GGNX 5AL9A 4JMBA 1AC8A 2W23A 3M27A 1CPFA 1H57A 4JB4A 4BM2A 5SXTA 5SYVA 1W4YA 4FEFA 5JQRA 4NVFA 5SXSA 4XV8A 1RYCA 2CCAA 5CD4J 1A2GA 4FCSA 4JM6A 2B12A 5SW6A 5CJHA 3WNUA 5JPRA 1CCAA 2XIFA 5CIEA 4BM3A 4JQJA 2B11A 4C50A 1STQA 1CCJA 3M2BA 3M2AA 2CEPA 1BEPA 2E3BA 1DSPA 2X08A 2WD4A 1AEUA 2EUUA 2IA8A 1AA4A 4BLXA 1H58A 1AEDA 1CMUA 2XJ6A 4JQMA 4BLLA 4USCA 3R99A 1DS4A 4CZPA 2EUTA 2VCNA 3CCXA 4JMWA 5SX2A 1DSGA 1H3JA 1AC4A 1U2LA 1HCHA 5AMMA 1MK8A 3RRWA 2AS4A 3R98A 5SYUA 3VLIA 1AENA 5L86A 1KOKA 2ICVA 4JM5A 1A2FA 3FJWA 1BESA 2CCPA 2N18A 1B82A 5KSKA 1ARXA 2RC1X 1CMQA 5H9FB 1H5MA 2E39A 3UW8A 2X07A 1ITKA 1DSEA 2RBYX 4C51A 2CCDA 4XV4A 5KQKA 3M25A 4XV5A 1KRJA 5EJXA 1H5GA 1CCCA 4NVEA 2RBUX 5CIDA 7CCPA 1ARUA 1ATJA 4A78A 3VLLA 2GHEX 3E2OA 5SYIA 2V2EA 1H5CA 2GB8A 4NVAA 4BLYA 5ABNA 2AS6A 1QPAA 1H5JA 4NVMB 4BM0A 1LY9A 5FNEA 5SX0A 5D6MA 2GHKX 3WA8A 5SYXA 4CUOA 2EUSA 1ZBZA 2ATJA 1W4WA 2CL4X 2AS2A 2XJ8A 1AETA 4CVJA 3M28A 2YLJA 1U75A 1PA2A 1QO4A 1CYFA 1H5IA 1U2KA 1GZAA 2VCSA 2AQDA 5JHXA 1CMPA 4P4QA 1H5LA 4FDQA 4JPUA 1CCKA 1QGJA 3M2IA 2VNXX 4JQNA 5SX0B 5KQHA 3RIWA 5SXXA 3WXOA 1CCLA 7ATJA 3M23A 2RBTX 1CMTA 1ARWA 1H5HA 2ZCAA 3EXBA 1DJ5A 1U2JA 5SXRA 3VLJA 1BEJA 1S73A 2RC2X 1SDQA 5SX6A 4JMVA 5SX7A 4JQKA 1AEEA 5CCPA 2VKAA 4JZAA 4CZOA 2VNZX 1BGPA 3M2GA 1YYGA 1ARYA 4JMAA 2RBXX 5SYLA 2GHCX 1AESA 1EBEA 3M2FA 5SXQA 3M2HA 1LYKA 2VO2X 5AOGA 3FKGA 2BCNA 4PAEA 5SXWA 3M8MA 4CVIA 2PCCA 5JHYA 2BOQA 3ZCYA 5KQ2A 1H55A 4NVBA 2XIHA 3FMUA 1CCBA 3UT2A 3CCPA 3VLKA 1OAFA 4CZNA 1U74A 1H5DA 1JDRA 1GW2A 1KZMA 1BEQA 4JM9A 1AEKA 4JMSA 2Y6BA 5EJTA 3HDLA 3M5QA 1CPGA 5FNBA 4QYZB 4NVLA 1BVAA 4H7AA 4NVHB 5SX1A 5KSFA 4CZRA 3RIVA 4ATJA 1H5FA 1LGAA 3M26A 2GHHX 1MNPA 3M2EA 5ALAA 5SYJA 5JHZA 2Y6AA 5CIBA 1MN1A 2RBVX 1DSOA 5SYHA 1ARVA 1SCHA 4GEDA 4JMZA 1BEMA 1H5KA 4XVAA 6CCPA 4NVJB 2ANZA 4JPLA 4NVOB 4FCNA 1JCIA 6ATJA 3ZCHA 1YZPA 2B10A 1FHFA 4U7UB 1B80A 4OQ7A 1B85A 1S6VA 1SJ2A 2PCBA 5SYYA 4NVKB 1UB2A 1MKRA 1ML2A 2V23A 5SW4A 1CPEA 3VLHA 1GX2A 1DCCA 4A5GA 4NVGB 1DJ1A 4H79A 5SX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7U B;  4H7A A;  3WA8 A;  4H79 A;  5CD4 J;  5H9F B;  5H9E B;  2ZCA A;  4QYZ B; 
#chains in the Genus database with same CATH topology
 1GZB A;  3M2D A;  2YCG A;  1BEK A;  1ABV A;  5KQ6 A;  2EUO A;  3FM6 A;  1KXN A;  1LY8 A;  2GHD X;  1LLP A;  4BM1 A;  3ATJ A;  2CYP A;  3X16 A;  2RBZ X;  5ABO A;  1CPD A;  1AEM A;  2AS1 A;  4JN0 A;  2BO5 A;  1CK6 A;  1AEJ A;  1AEQ A;  1YYD A;  5CIG A;  1Z53 A;  2VCF X;  1MKQ A;  5SW5 A;  3FM1 A;  4JPT A;  1V0H X;  2XIL A;  1ZBY A;  1CCG A;  4CZQ A;  5KQ0 A;  1CCE A;  2Y5A A;  1AEO A;  2EUR A;  1GWO A;  4A6Z A;  5H9E B;  1AEV A;  1AEG A;  5KQI A;  3Q3U A;  5CIH A;  4BLZ A;  1YZR A;  2RBW X;  3M29 A;  5SYK A;  1CCI A;  2XJ5 A;  1H5A A;  1HSR A;  1MN2 A;  4NVN B;  2AS3 A;  4NVI B;  2EUQ A;  2ZOP A;  2JTI A;  1AEB A;  1AEF A;  1GWT A;  5L02 A;  1H5E A;  1SOG A;  3E2N A;  2EUP A;  3ZCG A;  4BLN A;  5CIC A;  2RC0 X;  4JMT A;  4A7M A;  3FM4 A;  1GWU A;  3M2C A;  4NVD A;  2XI6 A;  2B0Z A;  4CCP A;  4BLK A;  4CCX A;  4XV7 A;  5KQ3 A;  2A7U B;  3VLM A;  1AEH A;  1OAG A;  5L05 A;  4G05 A;  1CCP A;  1LYC A;  2EUN A;  1KXM A;  2E3A A;  1APX A;  4XV6 A;  5SYW A;  1IYN A;  1SBM A;  1C8I A;  5ABQ A;  4A71 A;  1ARP A;  4JM8 A;  4NVC A;  4BM4 A;  1BJ9 A;  5CIF A;  4NFG A;  2GGN X;  5AL9 A;  4JMB A;  1AC8 A;  2W23 A;  3M27 A;  1CPF A;  1H57 A;  4JB4 A;  4BM2 A;  5SXT A;  5SYV A;  1W4Y A;  4FEF A;  5JQR A;  4NVF A;  5SXS A;  4XV8 A;  1RYC A;  2CCA A;  5CD4 J;  1A2G A;  4FCS A;  4JM6 A;  2B12 A;  5SW6 A;  5CJH A;  3WNU A;  5JPR A;  1CCA A;  2XIF A;  5CIE A;  4BM3 A;  4JQJ A;  2B11 A;  4C50 A;  1STQ A;  1CCJ A;  3M2B A;  3M2A A;  2CEP A;  1BEP A;  2E3B A;  1DSP A;  2X08 A;  2WD4 A;  1AEU A;  2EUU A;  2IA8 A;  1AA4 A;  4BLX A;  1H58 A;  1AED A;  1CMU A;  2XJ6 A;  4JQM A;  4BLL A;  4USC A;  3R99 A;  1DS4 A;  4CZP A;  2EUT A;  2VCN A;  3CCX A;  4JMW A;  5SX2 A;  1DSG A;  1H3J A;  1AC4 A;  1U2L A;  1HCH A;  5AMM A;  1MK8 A;  3RRW A;  2AS4 A;  3R98 A;  5SYU A;  3VLI A;  1AEN A;  5L86 A;  1KOK A;  2ICV A;  4JM5 A;  1A2F A;  3FJW A;  1BES A;  2CCP A;  2N18 A;  1B82 A;  5KSK A;  1ARX A;  2RC1 X;  1CMQ A;  5H9F B;  1H5M A;  2E39 A;  3UW8 A;  2X07 A;  1ITK A;  1DSE A;  2RBY X;  4C51 A;  2CCD A;  4XV4 A;  5KQK A;  3M25 A;  4XV5 A;  1KRJ A;  5EJX A;  1H5G A;  1CCC A;  4NVE A;  2RBU X;  5CID A;  7CCP A;  1ARU A;  1ATJ A;  4A78 A;  3VLL A;  2GHE X;  3E2O A;  5SYI A;  2V2E A;  1H5C A;  2GB8 A;  4NVA A;  4BLY A;  5ABN A;  2AS6 A;  1QPA A;  1H5J A;  4NVM B;  4BM0 A;  1LY9 A;  5FNE A;  5SX0 A;  5D6M A;  2GHK X;  3WA8 A;  5SYX A;  4CUO A;  2EUS A;  1ZBZ A;  2ATJ A;  1W4W A;  2CL4 X;  2AS2 A;  2XJ8 A;  1AET A;  4CVJ A;  3M28 A;  2YLJ A;  1U75 A;  1PA2 A;  1QO4 A;  1CYF A;  1H5I A;  1U2K A;  1GZA A;  2VCS A;  2AQD A;  5JHX A;  1CMP A;  4P4Q A;  1H5L A;  4FDQ A;  4JPU A;  1CCK A;  3X1L F;  1QGJ A;  3M2I A;  2VNX X;  4JQN A;  5SX0 B;  5KQH A;  3RIW A;  5SXX A;  3WXO A;  1CCL A;  7ATJ A;  3M23 A;  2RBT X;  1CMT A;  1ARW A;  1H5H A;  2ZCA A;  3EXB A;  1DJ5 A;  1U2J A;  5SXR A;  2OEB A;  3VLJ A;  1BEJ A;  1S73 A;  2RC2 X;  1SDQ A;  5SX6 A;  4JMV A;  5SX7 A;  4JQK A;  1AEE A;  5CCP A;  2VKA A;  4JZA A;  4CZO A;  2VNZ X;  1BGP A;  3M2G A;  1YYG A;  1ARY A;  4JMA A;  2RBX X;  5SYL A;  2GHC X;  1AES A;  1EBE A;  3M2F A;  5SXQ A;  3M2H A;  1LYK A;  2VO2 X;  5AOG A;  3FKG A;  2BCN A;  4PAE A;  5SXW A;  3M8M A;  4CVI A;  2PCC A;  5JHY A;  2BOQ A;  3ZCY A;  5KQ2 A;  1H55 A;  4NVB A;  2XIH A;  3FMU A;  1CCB A;  3UT2 A;  3CCP A;  3VLK A;  1OAF A;  4CZN A;  1U74 A;  1H5D A;  1JDR A;  1GW2 A;  1KZM A;  1BEQ A;  4JM9 A;  1AEK A;  4JMS A;  2Y6B A;  2WSS S;  5EJT A;  3HDL A;  4GKF A;  3M5Q A;  1CPG A;  5FNB A;  4QYZ B;  4NVL A;  1BVA A;  4H7A A;  4NVH B;  5SX1 A;  5KSF A;  4CZR A;  3RIV A;  4ATJ A;  1H5F A;  1LGA A;  3M26 A;  2GHH X;  1MNP A;  3M2E A;  5ALA A;  5SYJ A;  5JHZ A;  2Y6A A;  5CIB A;  1MN1 A;  2RBV X;  1DSO A;  5SYH A;  1ARV A;  1SCH A;  4GED A;  4JMZ A;  1BEM A;  1H5K A;  4XVA A;  6CCP A;  4NVJ B;  2ANZ A;  4JPL A;  4NVO B;  4FCN A;  1JCI A;  6ATJ A;  3ZCH A;  1YZP A;  2B10 A;  1FHF A;  2JMX A;  4U7U B;  1B80 A;  4OQ7 A;  1B85 A;  1S6V A;  1SJ2 A;  2PCB A;  5SYY A;  4NVK B;  1UB2 A;  1MKR A;  1ML2 A;  2V23 A;  5SW4 A;  1CPE A;  3VLH A;  1GX2 A;  1DCC A;  4A5G A;  4NVG B;  1DJ1 A;  4H79 A;  5SX3 A; 
#chains in the Genus database with same CATH homology
 1GZB A;  3M2D A;  2YCG A;  1BEK A;  5KQ6 A;  2EUO A;  3FM6 A;  1KXN A;  1LY8 A;  2GHD X;  1LLP A;  4BM1 A;  3ATJ A;  2CYP A;  3X16 A;  2RBZ X;  5ABO A;  1CPD A;  1AEM A;  2AS1 A;  4JN0 A;  1CK6 A;  1AEJ A;  1AEQ A;  1YYD A;  5CIG A;  1Z53 A;  2VCF X;  1MKQ A;  5SW5 A;  3FM1 A;  4JPT A;  1V0H X;  2XIL A;  1ZBY A;  1CCG A;  4CZQ A;  5KQ0 A;  1CCE A;  2Y5A A;  1AEO A;  2EUR A;  1GWO A;  4A6Z A;  5H9E B;  1AEV A;  1AEG A;  5KQI A;  3Q3U A;  5CIH A;  4BLZ A;  1YZR A;  2RBW X;  3M29 A;  5SYK A;  1CCI A;  2XJ5 A;  1H5A A;  1HSR A;  4NVN B;  1MN2 A;  2AS3 A;  4NVI B;  2EUQ A;  2JTI A;  1AEB A;  1AEF A;  1GWT A;  5L02 A;  1H5E A;  1SOG A;  3E2N A;  2EUP A;  3ZCG A;  4BLN A;  5CIC A;  2RC0 X;  4JMT A;  4A7M A;  3FM4 A;  1GWU A;  3M2C A;  4NVD A;  2XI6 A;  2B0Z A;  4CCP A;  4BLK A;  4CCX A;  4XV7 A;  5KQ3 A;  3VLM A;  1AEH A;  1OAG A;  5L05 A;  4G05 A;  1CCP A;  1LYC A;  2EUN A;  1KXM A;  2E3A A;  1APX A;  4XV6 A;  5SYW A;  1IYN A;  1SBM A;  1C8I A;  5ABQ A;  4A71 A;  1ARP A;  4JM8 A;  4NVC A;  4BM4 A;  1BJ9 A;  5CIF A;  4NFG A;  2GGN X;  5AL9 A;  4JMB A;  1AC8 A;  2W23 A;  3M27 A;  1CPF A;  1H57 A;  4JB4 A;  4BM2 A;  5SXT A;  5SYV A;  1W4Y A;  4FEF A;  5JQR A;  4NVF A;  5SXS A;  4XV8 A;  1RYC A;  2CCA A;  5CD4 J;  1A2G A;  4FCS A;  4JM6 A;  2B12 A;  5SW6 A;  5CJH A;  3WNU A;  5JPR A;  1CCA A;  2XIF A;  5CIE A;  4BM3 A;  4JQJ A;  2B11 A;  4C50 A;  1STQ A;  1CCJ A;  3M2B A;  3M2A A;  2CEP A;  1BEP A;  2E3B A;  1DSP A;  2X08 A;  2WD4 A;  1AEU A;  2EUU A;  2IA8 A;  1AA4 A;  4BLX A;  1H58 A;  1AED A;  1CMU A;  2XJ6 A;  4JQM A;  4BLL A;  4USC A;  3R99 A;  1DS4 A;  4CZP A;  2EUT A;  2VCN A;  3CCX A;  4JMW A;  5SX2 A;  1DSG A;  1H3J A;  1AC4 A;  1U2L A;  1HCH A;  5AMM A;  1MK8 A;  3RRW A;  2AS4 A;  3R98 A;  5SYU A;  3VLI A;  1AEN A;  5L86 A;  1KOK A;  2ICV A;  4JM5 A;  1A2F A;  3FJW A;  1BES A;  2CCP A;  2N18 A;  1B82 A;  5KSK A;  1ARX A;  2RC1 X;  1CMQ A;  5H9F B;  1H5M A;  2E39 A;  3UW8 A;  2X07 A;  1ITK A;  1DSE A;  2RBY X;  4C51 A;  2CCD A;  4XV4 A;  5KQK A;  3M25 A;  4XV5 A;  1KRJ A;  5EJX A;  1H5G A;  1CCC A;  4NVE A;  2RBU X;  5CID A;  7CCP A;  1ARU A;  1ATJ A;  4A78 A;  3VLL A;  2GHE X;  3E2O A;  5SYI A;  2V2E A;  1H5C A;  2GB8 A;  4NVA A;  4BLY A;  5ABN A;  2AS6 A;  1QPA A;  1H5J A;  4NVM B;  4BM0 A;  1LY9 A;  5FNE A;  5SX0 A;  5D6M A;  2GHK X;  3WA8 A;  5SYX A;  4CUO A;  2EUS A;  1ZBZ A;  2ATJ A;  1W4W A;  2CL4 X;  2AS2 A;  2XJ8 A;  1AET A;  4CVJ A;  3M28 A;  2YLJ A;  1U75 A;  1PA2 A;  1QO4 A;  1CYF A;  1H5I A;  1U2K A;  1GZA A;  2VCS A;  2AQD A;  5JHX A;  1CMP A;  4P4Q A;  1H5L A;  4FDQ A;  4JPU A;  1CCK A;  1QGJ A;  3M2I A;  2VNX X;  4JQN A;  5SX0 B;  5KQH A;  3RIW A;  5SXX A;  3WXO A;  1CCL A;  7ATJ A;  3M23 A;  2RBT X;  1CMT A;  1ARW A;  1H5H A;  2ZCA A;  3EXB A;  1DJ5 A;  1U2J A;  5SXR A;  3VLJ A;  1BEJ A;  1S73 A;  2RC2 X;  1SDQ A;  5SX6 A;  4JMV A;  5SX7 A;  4JQK A;  1AEE A;  5CCP A;  2VKA A;  4JZA A;  4CZO A;  2VNZ X;  1BGP A;  3M2G A;  1YYG A;  1ARY A;  4JMA A;  2RBX X;  5SYL A;  2GHC X;  1AES A;  1EBE A;  3M2F A;  5SXQ A;  3M2H A;  1LYK A;  2VO2 X;  5AOG A;  3FKG A;  2BCN A;  4PAE A;  5SXW A;  3M8M A;  4CVI A;  2PCC A;  5JHY A;  2BOQ A;  3ZCY A;  5KQ2 A;  1H55 A;  4NVB A;  2XIH A;  3FMU A;  1CCB A;  3UT2 A;  3CCP A;  3VLK A;  1OAF A;  4CZN A;  1U74 A;  1H5D A;  1JDR A;  1GW2 A;  1KZM A;  1BEQ A;  4JM9 A;  1AEK A;  4JMS A;  2Y6B A;  5EJT A;  3HDL A;  3M5Q A;  1CPG A;  5FNB A;  4QYZ B;  4NVL A;  1BVA A;  4H7A A;  4NVH B;  5SX1 A;  5KSF A;  4CZR A;  3RIV A;  4ATJ A;  1H5F A;  1LGA A;  3M26 A;  2GHH X;  1MNP A;  3M2E A;  5ALA A;  5SYJ A;  5JHZ A;  2Y6A A;  5CIB A;  1MN1 A;  2RBV X;  1DSO A;  5SYH A;  1ARV A;  1SCH A;  4GED A;  4JMZ A;  1BEM A;  1H5K A;  4XVA A;  6CCP A;  4NVJ B;  2ANZ A;  4JPL A;  4NVO B;  4FCN A;  1JCI A;  6ATJ A;  3ZCH A;  1YZP A;  2B10 A;  1FHF A;  4U7U B;  1B80 A;  4OQ7 A;  1B85 A;  1S6V A;  1SJ2 A;  2PCB A;  5SYY A;  4NVK B;  1UB2 A;  1MKR A;  1ML2 A;  2V23 A;  5SW4 A;  1CPE A;  3VLH A;  1GX2 A;  1DCC A;  4A5G A;  4NVG B;  1DJ1 A;  4H79 A;  5SX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...