The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
73
|
structure length |
73
|
Chain Sequence |
SHMPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDKSKWEDAAAKDKQRYHDEMRNYKPEA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Dna binding protein
|
| molecule keywords |
Single-strand recognition protein
|
| publication title |
Solution structure of the HMG-box domain in the SSRP1 subunit of FACT
pubmed doi rcsb |
| source organism |
Drosophila melanogaster
|
| total genus |
16
|
| structure length |
73
|
| sequence length |
73
|
| ec nomenclature | |
| pdb deposition date | 2005-01-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00505 | HMG_box | HMG (high mobility group) box |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA Binding (I), subunit A | High mobility group box domain |
#chains in the Genus database with same CATH superfamily 3U2B C; 2CTO A; 1WXL A; 2CS1 A; 2D7L A; 2YUK A; 1CKT A; 2YRQ A; 3TQ6 A; 3FGH A; 1WGF A; 4EUW A; 1V64 A; 3NM9 A; 1WZ6 A; 1L8Z A; 4A3N A; 1J5N A; 1HRY A; 1HRZ A; 4NNU A; 1HMF A; 1J3X A; 1HSM A; 2E6O A; 2LE4 A; 1J47 A; 4Y60 C; 1QRV A; 2HDZ A; 2LEF A; 3F27 D; 1AAB A; 2YQI A; 4QR9 A; 4NOD A; 1I11 A; 1HMA A; 1J3D A; 2CO9 A; 1HME A; 4S2Q D; 3TMM A; 1GT0 D; 1NHM A; 1NHN A; 2YUL A; 1HSN A; 1V63 A; 2CRJ A; 2LHJ A; 2RTU A; 2EQZ A; 1E7J A; 1L8Y A; 1CG7 A; 1LWM A; 1J46 A; 2GZK A; 2LY4 A; 1K99 A; 1O4X B; 1J3C A; #chains in the Genus database with same CATH topology 3U2B C; 2CTO A; 3ABR B; 1WXL A; 2CS1 A; 2D7L A; 2YUK A; 3ANY B; 2YRQ A; 3TQ6 A; 1CKT A; 1J3C A; 3FGH A; 1WGF A; 4EUW A; 1V64 A; 3NM9 A; 1WZ6 A; 1L8Z A; 4A3N A; 1J5N A; 1HRY A; 1HRZ A; 4NNU A; 1HMF A; 1J3X A; 1HSM A; 2E6O A; 2LE4 A; 1J47 A; 4Y60 C; 1QRV A; 2HDZ A; 2LEF A; 3ABO B; 3F27 D; 1AAB A; 2YQI A; 4QR9 A; 4NOD A; 1I11 A; 1HMA A; 3AO0 B; 1J3D A; 3ABS B; 2CO9 A; 1HME A; 4S2Q D; 3TMM A; 1GT0 D; 1NHM A; 1NHN A; 2YUL A; 1HSN A; 1V63 A; 2CRJ A; 2LHJ A; 2RTU A; 2VSF A; 4A15 A; 2EQZ A; 1E7J A; 1L8Y A; 1CG7 A; 1LWM A; 1J46 A; 2GZK A; 2LY4 A; 4KQE A; 1K99 A; 1O4X B; 5H8W A; #chains in the Genus database with same CATH homology 3U2B C; 2CTO A; 1WXL A; 2CS1 A; 2D7L A; 2YUK A; 1CKT A; 2YRQ A; 3TQ6 A; 3FGH A; 1WGF A; 4EUW A; 1V64 A; 3NM9 A; 1WZ6 A; 1L8Z A; 4A3N A; 1J5N A; 1HRY A; 1HRZ A; 4NNU A; 1HMF A; 1J3X A; 1HSM A; 2E6O A; 2LE4 A; 1J47 A; 4Y60 C; 1QRV A; 2HDZ A; 2LEF A; 3F27 D; 1AAB A; 2YQI A; 4QR9 A; 4NOD A; 1I11 A; 1HMA A; 1J3D A; 2CO9 A; 1HME A; 4S2Q D; 3TMM A; 1GT0 D; 1NHM A; 1NHN A; 2YUL A; 1HSN A; 1V63 A; 2CRJ A; 2LHJ A; 2RTU A; 2EQZ A; 1E7J A; 1L8Y A; 1CG7 A; 1LWM A; 1J46 A; 2GZK A; 2LY4 A; 1K99 A; 1O4X B; 1J3C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
