The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
HMALTVKDVNILSQYISGVMARADHHAGNVEEIALALAGAILWRKDDTNIKVMAHGADTKNVLWVTINGERYAFSYNHSSEKIEMRKGNIQGNTIHEFDNSTPLSKLVEIFKGL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Unknown function
|
| molecule keywords |
Integron cassette protein
|
| publication title |
Integron gene cassettes: a repository of novel protein folds with distinct interaction sites
pubmed doi rcsb |
| source organism |
Vibrio cholerae o139
|
| total genus |
32
|
| structure length |
114
|
| sequence length |
114
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2009-08-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18315 | VCH_CASS14 | Integron cassette protein VCH_CASS1 chain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Metal Transport, Frataxin; Chain A | Metal Transport, Frataxin; Chain A |
#chains in the Genus database with same CATH superfamily 3IMO A; #chains in the Genus database with same CATH topology 3OER A; 3T3X A; 3I9V 7; 1V5R A; 3IAS 7; 3S5D A; 2EFF A; 3T3K A; 2P1X A; 1D2M A; 2FQL A; 3GD0 A; 3SSD A; 3S4M A; 4C26 A; 1WHZ A; 2GA5 A; 1EW4 A; 3SSE A; 3SSC A; 1EKG A; 3T3L A; 3S5F A; 4LP1 A; 3T3T A; 3T3J A; 4P78 C; 4LK8 A; 3GD9 A; 3IAM 7; 1LY7 A; 4EC2 A; 3A5P A; 4HS5 A; 2FUG 7; 4JPD A; 1SOY A; 3OEQ A; 4HEA 7; 3IMO A; 3S5E A; #chains in the Genus database with same CATH homology 3GD9 A; 3GD0 A; 3SSC A; 3SSE A; 3IAM 7; 3A5P A; 3I9V 7; 3SSD A; 3IAS 7; 2FUG 7; 4HEA 7; 3IMO A; 1D2M A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
