The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the SRP19 RNA complex and implications for signal recognition particle assembly.
pubmed doi rcsb |
| molecule keywords |
7S.S SRP RNA
|
| molecule tags |
Signaling protein/rna
|
| source organism |
Methanocaldococcus jannaschii
|
| total genus |
24
|
| structure length |
87
|
| sequence length |
87
|
| ec nomenclature | |
| pdb deposition date | 2002-05-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01922 | SRP19 | SRP19 protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | Signal recognition particle, SRP19-like subunit |
#chains in the Genus database with same CATH superfamily 2V3C A; 3DLU A; 1KVV A; 1MFQ B; 1KVN A; 4P3E B; 3KTV B; 1JID A; 4XCO A; 3NDB A; 5M73 B; 3KTW A; 3DLV A; 1LNG A; 1L9A A; #chains in the Genus database with same CATH topology 4DDW A; 1KVV A; 4P73 A; 2AKW B; 4DDU A; 1ND9 A; 1JID A; 3NDB A; 3DLV A; 2RHS B; 4P75 A; 1L9A A; 4P3E B; 2RHQ B; 4DDV A; 5M73 B; 2IY5 B; 2CXI A; 1LNG A; 2ALY B; 4P74 A; 4IOH A; 2V3C A; 3DLU A; 2DUL A; 1B70 B; 2AMC B; 3AXS A; 2LQ3 A; 2EJT A; 3KTW A; 4P71 A; 1EIY B; 4DDT A; 3HFZ B; 1MFQ B; 3USH A; 1PYS B; 4TVA B; 1KVN A; 4P72 A; 3KTV B; 1JJC B; 2EJU A; 4XCO A; 1B7Y B; 3PCO B; 2YTZ A; 3AXT A; 2HG7 A; 3L4G B; 3TEH B; #chains in the Genus database with same CATH homology 2V3C A; 3DLU A; 1KVV A; 1MFQ B; 1KVN A; 4P3E B; 3KTV B; 1JID A; 4XCO A; 3NDB A; 5M73 B; 3KTW A; 3DLV A; 1LNG A; 1L9A A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...