The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
Knots found |
|
sequence length |
131
|
structure length |
131
|
Chain Sequence |
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structures of Rbsd Leading to the Identification of Cytoplasmic Sugar-Binding Proteins with a Novel Folding Architecture
pubmed doi rcsb |
molecule tags |
Transport
|
molecule keywords |
HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
|
total genus |
34
|
structure length |
131
|
sequence length |
131
|
chains with identical sequence |
B, C, D, E
|
other databases |
KnotProt 2.0: S +31
|
ec nomenclature |
ec
5.4.99.62: D-ribose pyranase. |
pdb deposition date | 2003-04-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the Genus database with same CATH superfamily 1OGE A; 1OGD A; 4A34 A; 3E7N A; 1OGF A; 3P12 A; 3MVK A; 2WCV A; 2WCU A; 1OGC A; 3P13 A; 2OB5 A; #chains in the Genus database with same CATH topology 1OGE A; 1OGD A; 4A34 A; 3E7N A; 1OGF A; 3P12 A; 3MVK A; 2WCV A; 2WCU A; 1OGC A; 3P13 A; 2OB5 A; #chains in the Genus database with same CATH homology 1OGE A; 1OGD A; 4A34 A; 3E7N A; 1OGF A; 3P12 A; 3MVK A; 2WCV A; 2WCU A; 1OGC A; 3P13 A; 2OB5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...