The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
8
|
sequence length |
47
|
structure length |
47
|
Chain Sequence |
GNFYAVRKGRETGIYNTWNECKNQVDGYGGAIYKKFNSYEQAKSFLG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR structure of the N-terminal domain of Saccharomyces cerevisiae RNase HI reveals a fold with a strong resemblance to the N-terminal domain of ribosomal protein L9.
pubmed doi rcsb |
| molecule keywords |
PROTEIN (RIBONUCLEASE HI)
|
| molecule tags |
Hydrolase
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
8
|
| structure length |
47
|
| sequence length |
47
|
| ec nomenclature |
ec
3.1.26.4: Ribonuclease H. |
| pdb deposition date | 1999-05-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01693 | Cauli_VI | Caulimovirus viroplasmin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Ribonuclease HI; Chain A | Ribonuclease H1, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1QHK A; 3BSU A; #chains in the Genus database with same CATH topology 5H3X A; 3PMQ A; 3BSU A; 1RU3 A; 1QHK A; 1OAO C; 3BL4 A; 2Z8Y M; 3I01 M; 3GIT A; 1MJG M; 3DOA A; 3I04 M; #chains in the Genus database with same CATH homology 1QHK A; 3BSU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...