3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
b'MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen binding protein
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Protein binding
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
3TWKA 2F5NA 4DUZM 1N34M 2E5LM 4B3TM 4G4QA 5LMUM 3JAMS 3U6QA 3U6EA 2HHHM 1Z5AA 3SBJA 2VQEM 2ZBKB 5FLXS 3U6MA 3U6SA 4LF7M 4LF9M 4GKKM 3GPYA 4DV5M 1Q3CA 4JI8M 4LF4M 4JI0M 1EE8A 4DV1M 1PJJA 1HNXM 4CISA 3JR5A 4ITQA 1PM5A 1FJGM 3T1HM 1HNWM 4YY3M 3GPUA 1Z5CA 4DV2M 4LF8M 5ITXA 5ITYA 3U6PA 4DV0M 3SAVA 1MX0A 2XZFA 2UXCM 3JR4A 1XNRM 4PDGA 4DR1M 1XMQM 1HR0M 1L2BA 1IBMM 3U6CA 2UXDM 4DR4M 4DV6M 1MU5A 3A46A 2UUCM 1K3XA 1J5EM 3GPXA 1L2DA 4JI1M 1TDZA 4LFBM 4JI2M 1PJIA 1K3WA 1KFVA 2HKJA 2F4VM 1Q3BA 4G4NA 2F5QA 4LF6M 4JI4M 2F5PA 1XC8A 1L1TA 3SARA 4DR6M 3GPPA 4DV7M 4JV5M 4JI5M 2EA0A 2OPFA 3DOAA 3VK8A 4LFAM 1N36M 4NXNM 4B3MM 3SAWA 2Q2EB 4DV4M 4X66M 4DR2M 4DR7M 4AQYM 2OQ4A 2XZUA 5IT9S 3SAUA 4PCZA 4NXMM 4OX9M 3VK7A 3TWLA 5BR8M 5ITRA 3J7AS 3GO8A 2F5SA 1HNZM 3A45A 4PD2A 4LFCM 3A42A 5ITUA 5A2QS 4GKJM 3GQ3A 4LF5M 4JI6M 4NRWA 4B3SM 5ITXE 3J81S 3GQ4A 3SASA 4JI7M 3TWMA 3U6DA 3W0FA 5ITQA 4DR3M 4DUYM 2VQFM 2F5OA 3GQ5A 1K82A 2UU9M 1N33M 4PDIA 1L1ZA 4B3RM 1IBKM 2UUAM 3OTOM 4JYAM 1Q39A 4K0KM 4DV3M 4NRVA 3U6LA 2UUBM 1R2ZA 3T1YM 1Z59A 2ZM6M 1L2CA 1N32M 5IWAM 4YHHM 5ITTA 4MB7A 3C58A 4KHPM 4X62M 1IBLM 3U6OA 1NNJA 5LMNM 1TDHA 1Z5BA 1I94M 1XNQM 2UXBM 3GP1A 5H3XA 4X65M 4G4RA 4G4OA 3J80S 4JI3M 4X64M 1XMOM 4DR5M 1R2YA 3SATA
chains in the Genus database with same CATH superfamily
3L2AA 2JWSA 1YSYA 3KOZE 1L8QA 2HWJA 2LVAA 4AKGA 1OQYA 2R6FA 4B3TM 2KHHA 2V1UA 1GLNA 2DZOB 2G3QA 3ZQJA 3B9PA 2JUJA 2R62A 3MK6A 5IZ7D 2HHHM 1QHKA 2D7GA 4I4LA 2WZJA 3GLFA 3MJ5A 2NQ8C 3CGWA 1HT2E 2Y20A 4CJ6A 7CATA 1MN3A 1XXHA 1OIZA 2MJ5B 3AFHA 4OVZB 1HT1E 1EE8A 1PJJA 1HNXM 3JR5A 3MMPA 4B7FA 5FTMA 1JB0F 4R71A 3KS8A 4OW0A 1SXJD 3L29A 3KDSE 1WXQA 3I51A 2FH0A 3PNYA 1Z5CA 3Q8XA 4DV2M 4LF8M 5ITXA 1XHBA 3HWSA 5ITYA 1UFZA 3FTFA 2CHGA 3UJNA 3L25A 2XSZA 3PMQA 2RRUA 4IBBA 3JR4A 1XNRM 1XMQM 3QAUA 3IHPA 3B74A 3SYKA 3FYCA 1XB2B 2RGOA 1NNUC 4DV6M 1JR3E 2KXEA 2VF7A 3FRIA 3QYBA 4QHTA 3TQSA 1K3XA 2H5XA 4JI1M 3HJ8A 3TE6A 4LFBM 4FW9A 4AW4A 1K3WA 1NJGA 2D7HA 1NY5A 2JNHA 1IN8A 3SMPA 4IBEA 3LW5F 4JI4M 2XLJA 4LF6M 1GJTA 4DR6M 2EUCA 4I81A 4WW0A 4JV5M 2P5TA 4LJ9A 4JI5M 3SYLA 2MROB 1WIVA 2ZANA 3DOAA 3VK8A 2DZLA 4NSRA 2DAMA 3SHGB 1R4GA 4FVMA 4M9XA 4B3MM 4DR2M 4AQYM 3FRHA 2MR9A 3J27B 3DFZA 3FD9A 4P16A 1IN5A 4LJ6A 4KLNA 2HCBA 2J7NA 3HJSA 1YE9A 3U5ZA 3FTDA 5EJCA 4QNRA 4PD2A 3A42A 2KA6B 4RF0A 3AKZA 2C98A 5EQTA 5A2QS 4GKJM 1JR3A 3RFWA 3FYDA 1D0MA 4GIPA 1KYIA 2DAKA 1E9SA 3LVWA 5E6JA 1G4AE 4G6ZA 4XBOA 1QUTA 3IG5A 1TGUA 3GRVA 2KZUA 2C9OA 4LJ8A 2MGWA 2BWBA 2FFJA 2R0IA 3WHKA 3GQ5A 2UU9M 1N33M 2DAGA 4FCWA 2OOAA 2R18A 3B7NA 1Q39A 5L8RF 3OTOM 1IXZA 4Z6YA 4GHLA 3D8BA 2UUBM 3LCVB 1OTRA 1V92A 2EKKA 4B7GA 4MGZE 3FTCA 3GLFB 2LVOC 5FTJA 4B7HA 4AG6A 1QDRA 1ZMWA 2RKOA 1G3IA 3FE3A 1C7YA 1XXHB 1PGYA 1YUBA 4FWHA 1TDHA 3NBXX 4KO8A 4M0WA 3DA1A 1N77A 4X65M 4KT0F 4D80A 3K9PA 1ZMVA 1IN6A 4G4OA 4JI3M 1GKIA 1XMOM 3RE8A 3GLHE 3C3DA 4II7A 2X49A 2ZTDA 3HKPA 2F5NA 1PJSA 2N35A 3IECA 1ZAEA 2D7EA 1DGHB 3H4MA 1DGFA 5EP1A 4LRTA 5DFLA 3JAMS 2Z8YM 3J7BA 2L4EA 2WSEF 4QHSA 3GLIB 2BJVA 3U6QA 5KQ8A 4XGIA 3PNVA 3HHYA 4IBGA 2QNJA 5FLXS 3U6SA 4A3VB 3PVSA 2Y21A 1Q3CA 3AOGA 1QDTA 3F92A 2Z4RA 4XK8F 3CF6E 1PM5A 1YLAA 4IBJA 3E9SA 3ZCBB 1D0KA 2ZAOA 2DWLA 2QPAA 2L7HA 1NHGC 4LJ5A 4YY3M 4QOZC 2LXEA 3FUVA 1LTMA 2HL7A 1ORYB 1QZMA 4LGMA 3U6PA 4IIWA 4L78A 2CHVA 3BXWA 5BPVA 2XZFA 2UXCM 2Z3XA 2DENA 1IBMM 4I8OA 1MU5A 4AG5A 1T6OA 1XWIA 2H1RA 3I4YA 4FWDA 2QENA 2JY6B 2QSFX 3UK6A 2KZSA 3A46A 4AI6A 3U5ZB 1L2DA 1SXJE 1TDZA 1OKSA 1VEKA 3TL4X 1HQYE 1PJIA 4JI2M 2HKJA 2F4VM 4W5WA 1Q02A 3KW6A 3AOEC 4IBDA 2XFTA 3W67A 3GRRA 4G4NA 1EFUB 1A5TA 1TH4A 2F5PA 1GL7A 3SARA 2QQ8A 4LZJA 2CFOA 3GPPA 1F4IA 5E26A 3EIHA 2KNAA 1VDDA 2M60A 2EA0A 3KS4A 1N75A 4LFAM 3KXEC 4MGHA 1IQPA 2BWEA 2CUZA 4L6V6 4NXNM 4NL4H 1RU3A 3W0LB 3R9XB 4DR7M 3PXGA 2DAIA 1QYRA 2KNVA 1SXJC 2A5YB 3AOEA 4Q7JA 1ZQ9A 5GKNA 2JA2A 3VDPA 1J09A 3ZC7B 8CATA 3SAUA 1G71A 4FCVA 3HHXA 2L6OA 3TWLA 4NXMM 3J7AS 2K0BX 4M0DA 1E9RA 3A45A 4HEOA 4HLQA 4LFCM 4CGYB 2YNMD 2XF3A 3HU1A 3KOWE 3KP1E 1SG9A 4QNMA 5DYIA 1QANA 3GQ3A 4LF5M 1WJ7A 4IBKA 4JI6M 3TPZA 4L8RC 1NV9A 3UMMA 3SASA 5C1BA 4RNAA 1SXJA 4GITA 1D0LA 4QOSA 4JI7M 3KSXA 3L28A 4S12A 2LBCA 5ITQA 1P3QQ 2EJSA 2XEPA 2EO2A 1IFYA 5DNYA 2FE8A 2F5OA 2VDBB 1GJSA 3U61B 1K82A 3CF2A 1X37A 2OOBA 4K0KM 1G8PA 4DV3M 2I7NA 3U60B 2KDLA 5KQDA 4OU7A 1NV8A 3LQRA 3T1YM 1Z59A 3KP0E 1N32M 3KVWA 1NO1A 4REZA 1N36M 5FTKA 4EIWA 1PRBA 1NNJA 1OFHA 4AKHA 3MHVC 3HZJA 1OAIA 1DGGA 1Z5BA 4GRIA 3BOSA 1I94M 3HHWA 1IXRC 4JN6A 1XNQM 3GP1A 2UXBM 1GL6A 1DO0A 4L16A 2G5GX 2X4AA 2VIIA 3E46A 4LZZA 3SMSA 1GABA 2KEBA 4DUZM 3C3EA 4NC6A 1N34M 2FOIC 2LHCA 2E5LM 2LTUA 3VFDA 5EP4A 2CV2A 2GNOA 1WGNA 5JI2E 2HAKA 2FS1A 3C9PA 4D81A 5LMUM 2CV0A 3U6EA 2Y0QA 1VEGA 3HX3A 3M0EA 3SBJA 2VQEM 4FD2A 5KPRA 2DHYA 2JZ1A 2ZBKB 1Z6TA 3HGIA 4OVZA 3BL4A 2QP9X 3B7ZA 2CWBA 2C9CA 4LJ4A 4DV5M 1QAOA 2O01F 4JI8M 4LG2A 1TR8A 2JY5A 4LF4M 1UM8A 4BBAA 1R5LA 2BNKA 3Q8GA 4ITQA 2W82A 1E32A 1TF0B 3T1HM 1VQ1A 5FSWA 2YFQA 2OO9A 2JXNA 3LVVA 3GPUA 3GRUA 5FTLA 4P17A 3FUUA 3SFZA 4DV0M 3NBIA 1MX0A 2LH0A 2DVWB 2CRUA 2C99A 4NSOB 2CEAA 4WP2A 4PDGA 4DR4M 5DYGA 5EP2A 3UGJA 1H6UA 5F3WA 5KO3A 2UUCM 3WHLA 1OJLA 2L4FA 1J5EM 3CTWB 4GH9A 1BVSA 2R44A 1Q3BA 4TUWA 2DXIA 2ZAMA 4GMQA 2F5QA 3KSJA 3E21A 3FTEA 3B7QA 2LHGA 3LQQA 3AV0A 4DV7M 2DWNA 4RF1A 2KRKA 2KNZA 4Y28F 2OPFA 1VEJA 2B3TA 1TH2A 2K6BA 1NSFA 1JQJC 2LWXA 3I4VA 4IBCA 4X66M 3SAWA 2L2DA 2XZUA 4GC9A 4DBGB 4BB9A 1HJPA 1IY0A 4MH0E 1R7RA 1G59A 5IT9S 1XXHE 4IJFA 4PCZA 3GLHA 3GLGE 3HJQA 2QCUA 5BR8M 1QZEA 2YQZA 3L27A 4FCTA 4LY6A 4JXJA 3PFIA 1TH3A 3HU3A 2F5SA 1ZV1A 1V34A 5ITUA 2DAEA 2R45A 2DWMA 2XGNA 5H37D 1IM2A 2KRUA 4B3SM 4GEWA 5ITXE 2R4JA 2LVPC 4GC5A 3T38A 3GQ4A 3TWMA 3U6DA 1QAQA 3QYEA 4ANRA 4CHTB 1AIPC 1DO2A 3VKGA 4DR3M 3H4JA 4M9SA 4MGIE 4DUYM 2VQFM 2L7IA 3GLIE 2Z7JA 3LMMA 1Y8GA 4PDIA 4PT5A 1IBKM 2UUAM 4IJEA 1R6BX 4JYAM 4L15A 1KSFX 3FKEA 2I7PA 2XSZD 4MGKE 3B89A 5IREB 2R46A 1IXSA 4WURA 2X8AA 4ZPXA 1NVMA 1R2ZA 1L2CA 4NOOB 4YHHM 4AZFA 3K9OA 1S3SA 4LJAA 5KPZA 3SHFA 4KHPM 1IY2A 3RGPA 5C18A 3QWLA 3IG8A 4X62M 3VLFB 1G41A 3GLGA 2DZNB 2O25A 3U6OA 4BLCA 3R8FA 1D2NA 4KODA 2FNAA 1DV0A 2G8LA 4RKUF 3I01M 4M9ZA 4G4RA 1EIJA 3J80S 4B08A 4X64M 2QZ4A 3ZH9B 2DHRA 4LJ7A 4DR5M 1R2YA 1HR0M 2K47A 3RGSA 1DGHA 3TWKA 1W5SA 3K8ZA 2QBYA 2YR0A 4G4QA 3GLIA 3VDUA 4R3DA 1QQWA 2J5YA 3T15A 1Z5AA 3BSUA 1NHWC 3LCUA 2JY8A 3NWLA 1TTEA 2J7OA 3U6MA 4LF7M 1QVRA 4FWGA 4LF9M 3M7GA 4GKKM 3GPYA 5FTNA 1VDLA 4JI0M 4DV1M 4CISA 1JR3D 2Z4SA 3A98B 5EP3A 4UN2B 2O5RA 1FJGM 1MJGM 2XFSA 4IBFA 2AHMA 2DNAA 4MGYE 1HNWM 3VKHA 3GRYA 1NY6A 2R4EA 5KPTA 3L26A 5EXPA 1E94E 2CP8A 4G3OA 3EIEA 4MM3B 2DKLA 4IBIA 4LRSA 1T3TA 3SAVA 4F1IA 4DR1M 2R65A 2V6ZM 2ZTCA 3U6CA 1L2BA 2UXDM 2EKFA 3E4RA 2L09A 4R7GA 3GLHB 3DZDA 1FNNA 3GPXA 1CUKA 2WSCF 2Y0TA 4AKIA 5JI3E 1KFVA 2C96A 2CV1A 1OIPA 1QAMA 1XC8A 1L1TA 2JP7A 2CE7A 2QHOB 2VF8A 3BBZA 1NJFA 2XH9A 1OAOC 3M6AA 1PJQA 2GQFA 2RGHA 3SC3A 1C1KA 1LV7A 1T43A 2Q2EB 2KW0A 4DV4M 1WGLA 3KOXE 3UZUA 2OQ4A 3HU2A 3V76A 3I04M 3HY5A 4OX9M 1IXSB 3VK7A 1IY1A 5ITRA 1V33A 3GO8A 3FUXA 1PJTA 2CHQA 2ERCA 1J7KA 1HNZM 3GITA 3K2LA 4HL4A 4F2LA 3GLGB 1GVNA 2M5ZA 3K92A 4NRWA 1WR1B 3J81S 3HHZA 2BJWA 3FUWA 3W0FA 1SXJB 3U61A 1I4WA 2DWZB 3AL0C 2K9DA 5EXSA 4LGYA 1WHCA 1HQCA 3J2PB 1L1ZA 1VG5A 4B3RM 3D8LA 3ILKA 3AJIB 3GLFE 3U60A 1ZMUA 2WSFF 4D82A 4CIZA 3KOYE 2QBYB 2LNHC 4NRVA 1DGBA 1GO5A 3U6LA 3KFUG 1OFIA 1AUAA 1N78A 1QUSA 2LVNC 2ZM6M 5IWAM 4LCBA 2C5RA 5ITTA 4MB7A 4GHAA 2DI0A 3C58A 1IN4A 3T6PA 3W68A 2V1CA 2APLA 1IBLM 3FUTA 5EXTA 1W5TA 5LMNM 3CF0A 3K1JA 5EXXA 4Z8XA 5H3XA 2JZ0A 1IN7A 4I5SA 3THGA 2JY7A 2MH8A 4L4UA 2LVQD 3SATA
chains in the Genus database with same CATH topology
3L2AA 3KOZE 1YSYA 1L8QA 4AKGA 4B3TM 2V1UA 1GLNA 2DZOB 3B9PA 2R62A 3MK6A 5IZ7D 2HHHM 2D7GA 4I4LA 3GLFA 3MJ5A 2NQ8C 1HT2E 2Y20A 7CATA 1XXHA 4OVZB 3AFHA 1HT1E 1EE8A 1PJJA 1HNXM 3JR5A 4B7FA 5FTMA 3KS8A 4OW0A 1SXJD 3L29A 3KDSE 1WXQA 3I51A 3PNYA 1Z5CA 3Q8XA 4DV2M 4LF8M 5ITXA 1XHBA 3HWSA 5ITYA 3FTFA 2CHGA 3UJNA 3L25A 2XSZA 4IBBA 3JR4A 1XNRM 1XMQM 3QAUA 3SYKA 3FYCA 2RGOA 1NNUC 4DV6M 2KXEA 4QHTA 3TQSA 1K3XA 4JI1M 3HJ8A 3TE6A 4LFBM 4FW9A 4AW4A 1K3WA 1NJGA 2D7HA 1NY5A 1IN8A 3SMPA 4IBEA 4LF6M 4JI4M 2XLJA 4DR6M 2EUCA 4I81A 4WW0A 4JV5M 2P5TA 4LJ9A 4JI5M 3SYLA 2ZANA 3DOAA 3VK8A 4NSRA 3SHGB 4FVMA 4M9XA 4B3MM 4DR2M 4AQYM 3J27B 3DFZA 3FD9A 4P16A 1IN5A 4LJ6A 4KLNA 2HCBA 2J7NA 3HJSA 1YE9A 3U5ZA 3FTDA 5EJCA 4QNRA 4PD2A 3A42A 2KA6B 4RF0A 3AKZA 2C98A 5EQTA 5A2QS 4GKJM 1JR3A 3RFWA 3FYDA 4GIPA 1KYIA 1E9SA 3LVWA 5E6JA 1G4AE 4G6ZA 4XBOA 3IG5A 1TGUA 3GRVA 2KZUA 2C9OA 4LJ8A 2FFJA 3WHKA 3GQ5A 2UU9M 1N33M 4FCWA 3OTOM 2R18A 1Q39A 1IXZA 4Z6YA 4GHLA 3D8BA 2UUBM 4B7GA 3GLFB 4MGZE 3FTCA 5FTJA 4B7HA 4AG6A 2RKOA 1G3IA 1XXHB 1YUBA 4FWHA 1TDHA 4KO8A 4M0WA 3DA1A 1N77A 4X65M 4G4OA 4D80A 1IN6A 4JI3M 1GKIA 1XMOM 3RE8A 4II7A 3HKPA 2X49A 2F5NA 1ZAEA 2D7EA 1DGHB 3H4MA 1DGFA 5EP1A 4LRTA 3JAMS 3J7BA 3U6QA 4QHSA 3GLIB 2BJVA 5KQ8A 4XGIA 3PNVA 3HHYA 4IBGA 5FLXS 3U6SA 4A3VB 3PVSA 2Y21A 1Q3CA 3AOGA 2Z4RA 3CF6E 1PM5A 4IBJA 3E9SA 3ZCBB 2ZAOA 2DWLA 2QPAA 2L7HA 1NHGC 4LJ5A 4YY3M 4QOZC 2LXEA 3FUVA 2HL7A 1ORYB 1QZMA 4LGMA 3U6PA 4IIWA 4L78A 2CHVA 5BPVA 2XZFA 2UXCM 2Z3XA 1IBMM 4I8OA 1MU5A 4AG5A 1XWIA 2H1RA 3I4YA 4FWDA 2QENA 3A46A 3UK6A 2KZSA 4AI6A 3U5ZB 1L2DA 1SXJE 1TDZA 3TL4X 1HQYE 1PJIA 4JI2M 2HKJA 2F4VM 4W5WA 3KW6A 4G4NA 3AOEC 4IBDA 2XFTA 3GRRA 1TH4A 2F5PA 3SARA 1GL7A 4LZJA 2CFOA 3GPPA 5E26A 3EIHA 1VDDA 2M60A 2EA0A 3KS4A 1N75A 4LFAM 3KXEC 4MGHA 1IQPA 2CUZA 4NXNM 3W0LB 1N36M 4NL4H 3R9XB 4DR7M 3PXGA 1QYRA 1SXJC 2A5YB 3AOEA 5GKNA 1ZQ9A 3VDPA 2JA2A 3ZC7B 1J09A 8CATA 3SAUA 4NXMM 4FCVA 3HHXA 2L6OA 3TWLA 3J7AS 4M0DA 1E9RA 3A45A 4HLQA 4LFCM 4CGYB 2YNMD 2XF3A 3HU1A 3KOWE 3KP1E 4QNMA 5DYIA 1QANA 3GQ3A 4LF5M 4IBKA 4JI6M 3TPZA 4L8RC 3UMMA 3SASA 5C1BA 4RNAA 1SXJA 4GITA 4JI7M 4QOSA 3KSXA 3L28A 4S12A 5ITQA 2XEPA 2EO2A 5DNYA 2FE8A 2F5OA 3U61B 1K82A 3CF2A 1X37A 4K0KM 1G8PA 4DV3M 2I7NA 3U60B 5KQDA 4OU7A 3LQRA 3T1YM 1Z59A 3KP0E 1N32M 3KVWA 4REZA 5FTKA 4EIWA 1NNJA 1OFHA 4AKHA 3MHVC 1DGGA 1Z5BA 4GRIA 3BOSA 1I94M 3HHWA 1IXRC 4JN6A 1XNQM 3GP1A 2UXBM 1GL6A 1DO0A 4L16A 2G5GX 2X4AA 2VIIA 4LZZA 3SMSA 2KEBA 4DUZM 1N34M 2FOIC 2E5LM 3VFDA 5EP4A 2CV2A 5JI2E 4D81A 5LMUM 2CV0A 3U6EA 2Y0QA 3M0EA 3SBJA 2VQEM 4FD2A 5KPRA 4OVZA 2ZBKB 1Z6TA 3HGIA 2QP9X 4LJ4A 2C9CA 4DV5M 1QAOA 4JI8M 4LG2A 4LF4M 1UM8A 4BBAA 2BNKA 4ITQA 2W82A 1E32A 3T1HM 5FSWA 2YFQA 3LVVA 3GPUA 3GRUA 5FTLA 3FUUA 3SFZA 4DV0M 3NBIA 1MX0A 2LH0A 2DVWB 2C99A 4NSOB 2CEAA 4PDGA 4DR4M 5DYGA 5EP2A 3UGJA 1H6UA 5F3WA 5KO3A 2UUCM 3WHLA 1OJLA 1J5EM 3CTWB 4GH9A 1Q3BA 4TUWA 2DXIA 2ZAMA 4GMQA 2F5QA 3KSJA 3FTEA 3LQQA 4DV7M 3AV0A 2DWNA 4RF1A 2KRKA 2OPFA 1TH2A 1NSFA 1JQJC 2LWXA 3I4VA 4IBCA 4X66M 3SAWA 2XZUA 4GC9A 4BB9A 1G59A 1IY0A 4MH0E 1R7RA 5IT9S 4IJFA 4PCZA 3GLHA 3HJQA 2QCUA 5BR8M 4FCTA 2YQZA 3L27A 4LY6A 2F5SA 4JXJA 3PFIA 1TH3A 3HU3A 5ITUA 2DWMA 2R45A 2XGNA 5H37D 1IM2A 2KRUA 4B3SM 5ITXE 2R4JA 4GC5A 3T38A 3GQ4A 3TWMA 3U6DA 1QAQA 4CHTB 1DO2A 3VKGA 4DR3M 4MGIE 4M9SA 4DUYM 2VQFM 2L7IA 2Z7JA 3LMMA 4PDIA 4PT5A 1IBKM 2UUAM 4IJEA 1R6BX 4JYAM 4L15A 1KSFX 3FKEA 2I7PA 2XSZD 4MGKE 5IREB 2R46A 4ZPXA 4WURA 2X8AA 1NVMA 1R2ZA 1L2CA 4NOOB 4YHHM 4AZFA 5KPZA 1S3SA 4LJAA 3SHFA 4KHPM 1IY2A 3RGPA 5C18A 3QWLA 3IG8A 4X62M 3VLFB 1G41A 3GLGA 2DZNB 3U6OA 4BLCA 3R8FA 1D2NA 4KODA 2FNAA 2G8LA 4G4RA 4M9ZA 3J80S 4B08A 4X64M 2QZ4A 3ZH9B 2DHRA 4LJ7A 4DR5M 1R2YA 1HR0M 2K47A 3RGSA 1DGHA 3TWKA 1W5SA 3K8ZA 2QBYA 2YR0A 4G4QA 3GLIA 3VDUA 4R3DA 1QQWA 3T15A 1Z5AA 1NHWC 3NWLA 4LF7M 2J7OA 3U6MA 4LF9M 4GKKM 1QVRA 4FWGA 3M7GA 3GPYA 5FTNA 4JI0M 4DV1M 4CISA 1JR3D 2Z4SA 3A98B 5EP3A 2O5RA 1FJGM 2XFSA 4IBFA 2AHMA 4MGYE 1HNWM 3VKHA 3GRYA 1NY6A 2R4EA 5KPTA 3L26A 5EXPA 1E94E 3EIEA 4MM3B 4IBIA 4LRSA 1T3TA 3SAVA 4DR1M 2R65A 2V6ZM 1L2BA 3U6CA 2UXDM 3E4RA 2L09A 4R7GA 3GLHB 3DZDA 1FNNA 3GPXA 4AKIA 2Y0TA 5JI3E 1KFVA 2C96A 2CV1A 1QAMA 1XC8A 1L1TA 2CE7A 1NJFA 2XH9A 3M6AA 2RGHA 3SC3A 1C1KA 1LV7A 2Q2EB 2KW0A 4DV4M 3KOXE 3UZUA 2OQ4A 3HU2A 4OX9M 1IXSB 3VK7A 1IY1A 5ITRA 3GO8A 3FUXA 2ERCA 2CHQA 1HNZM 1J7KA 3K2LA 4HL4A 3GLGB 1GVNA 2M5ZA 3K92A 4NRWA 3J81S 3HHZA 2BJWA 3FUWA 3W0FA 1SXJB 3U61A 1I4WA 2DWZB 3AL0C 5EXSA 4LGYA 1HQCA 3J2PB 1L1ZA 4B3RM 3D8LA 3ILKA 3AJIB 3U60A 4D82A 3KOYE 2QBYB 2LNHC 4NRVA 1DGBA 3U6LA 3KFUG 1OFIA 1N78A 2ZM6M 5IWAM 4LCBA 2C5RA 5ITTA 4MB7A 4GHAA 3C58A 1IN4A 2V1CA 1IBLM 3FUTA 5EXTA 1W5TA 5LMNM 3CF0A 3K1JA 5EXXA 4Z8XA 5H3XA 1IN7A 4I5SA 3THGA 4L4UA 3SATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWK A;  2F5N A;  4DUZ M;  1N34 M;  2E5L M;  4B3T M;  4G4Q A;  5LMU M;  3JAM S;  3U6Q A;  3U6E A;  2HHH M;  1Z5A A;  3SBJ A;  2VQE M;  2ZBK B;  5FLX S;  3U6M A;  3U6S A;  4LF7 M;  4LF9 M;  4GKK M;  3GPY A;  4DV5 M;  1Q3C A;  4JI8 M;  4LF4 M;  4JI0 M;  1EE8 A;  4DV1 M;  1PJJ A;  1HNX M;  4CIS A;  3JR5 A;  4ITQ A;  1PM5 A;  1FJG M;  3T1H M;  1HNW M;  4YY3 M;  3GPU A;  1Z5C A;  4DV2 M;  4LF8 M;  5ITX A;  5ITY A;  3U6P A;  4DV0 M;  3SAV A;  1MX0 A;  2XZF A;  2UXC M;  3JR4 A;  1XNR M;  4PDG A;  4DR1 M;  1XMQ M;  1HR0 M;  1L2B A;  1IBM M;  3U6C A;  2UXD M;  4DR4 M;  4DV6 M;  1MU5 A;  3A46 A;  2UUC M;  1K3X A;  1J5E M;  3GPX A;  1L2D A;  4JI1 M;  1TDZ A;  4LFB M;  4JI2 M;  1PJI A;  1K3W A;  1KFV A;  2HKJ A;  2F4V M;  1Q3B A;  4G4N A;  2F5Q A;  4LF6 M;  4JI4 M;  2F5P A;  1XC8 A;  1L1T A;  3SAR A;  4DR6 M;  3GPP A;  4DV7 M;  4JV5 M;  4JI5 M;  2EA0 A;  2OPF A;  3DOA A;  3VK8 A;  4LFA M;  1N36 M;  4NXN M;  4B3M M;  3SAW A;  2Q2E B;  4DV4 M;  4X66 M;  4DR2 M;  4DR7 M;  4AQY M;  2OQ4 A;  2XZU A;  5IT9 S;  3SAU A;  4PCZ A;  4NXM M;  4OX9 M;  3VK7 A;  3TWL A;  5BR8 M;  5ITR A;  3J7A S;  3GO8 A;  2F5S A;  1HNZ M;  3A45 A;  4PD2 A;  4LFC M;  3A42 A;  5ITU A;  5A2Q S;  4GKJ M;  3GQ3 A;  4LF5 M;  4JI6 M;  4NRW A;  4B3S M;  5ITX E;  3J81 S;  3GQ4 A;  3SAS A;  4JI7 M;  3TWM A;  3U6D A;  3W0F A;  5ITQ A;  4DR3 M;  4DUY M;  2VQF M;  2F5O A;  3GQ5 A;  1K82 A;  2UU9 M;  1N33 M;  4PDI A;  1L1Z A;  4B3R M;  1IBK M;  2UUA M;  3OTO M;  4JYA M;  1Q39 A;  4K0K M;  4DV3 M;  4NRV A;  3U6L A;  2UUB M;  1R2Z A;  3T1Y M;  1Z59 A;  2ZM6 M;  1L2C A;  1N32 M;  5IWA M;  4YHH M;  5ITT A;  4MB7 A;  3C58 A;  4KHP M;  4X62 M;  1IBL M;  3U6O A;  1NNJ A;  5LMN M;  1TDH A;  1Z5B A;  1I94 M;  1XNQ M;  2UXB M;  3GP1 A;  5H3X A;  4X65 M;  4G4R A;  4G4O A;  3J80 S;  4JI3 M;  4X64 M;  1XMO M;  4DR5 M;  1R2Y A;  3SAT A; 
#chains in the Genus database with same CATH topology
 3L2A A;  2JWS A;  1YSY A;  3KOZ E;  1L8Q A;  2HWJ A;  2LVA A;  4AKG A;  1OQY A;  2R6F A;  4B3T M;  2KHH A;  2V1U A;  1GLN A;  2DZO B;  2G3Q A;  3ZQJ A;  3B9P A;  2JUJ A;  2R62 A;  3MK6 A;  5IZ7 D;  2HHH M;  1QHK A;  2D7G A;  4I4L A;  2WZJ A;  3GLF A;  3MJ5 A;  2NQ8 C;  3CGW A;  1HT2 E;  2Y20 A;  4CJ6 A;  7CAT A;  1MN3 A;  1XXH A;  1OIZ A;  2MJ5 B;  3AFH A;  4OVZ B;  1HT1 E;  1EE8 A;  1PJJ A;  1HNX M;  3JR5 A;  3MMP A;  4B7F A;  5FTM A;  1JB0 F;  4R71 A;  3KS8 A;  4OW0 A;  1SXJ D;  3L29 A;  3KDS E;  1WXQ A;  3I51 A;  2FH0 A;  3PNY A;  1Z5C A;  3Q8X A;  4DV2 M;  4LF8 M;  5ITX A;  1XHB A;  3HWS A;  5ITY A;  1UFZ A;  3FTF A;  2CHG A;  3UJN A;  3L25 A;  2XSZ A;  3PMQ A;  2RRU A;  4IBB A;  3JR4 A;  1XNR M;  1XMQ M;  3QAU A;  3IHP A;  3B74 A;  3SYK A;  3FYC A;  1XB2 B;  2RGO A;  1NNU C;  4DV6 M;  1JR3 E;  2KXE A;  2VF7 A;  3FRI A;  3QYB A;  4QHT A;  3TQS A;  1K3X A;  2H5X A;  4JI1 M;  3HJ8 A;  3TE6 A;  4LFB M;  4FW9 A;  4AW4 A;  1K3W A;  1NJG A;  2D7H A;  1NY5 A;  2JNH A;  1IN8 A;  3SMP A;  4IBE A;  3LW5 F;  4JI4 M;  2XLJ A;  4LF6 M;  1GJT A;  4DR6 M;  2EUC A;  4I81 A;  4WW0 A;  4JV5 M;  2P5T A;  4LJ9 A;  4JI5 M;  3SYL A;  2MRO B;  1WIV A;  2ZAN A;  3DOA A;  3VK8 A;  2DZL A;  4NSR A;  2DAM A;  3SHG B;  1R4G A;  4FVM A;  4M9X A;  4B3M M;  4DR2 M;  4AQY M;  3FRH A;  2MR9 A;  3J27 B;  3DFZ A;  3FD9 A;  4P16 A;  1IN5 A;  4LJ6 A;  4KLN A;  2HCB A;  2J7N A;  3HJS A;  1YE9 A;  3U5Z A;  3FTD A;  5EJC A;  4QNR A;  4PD2 A;  3A42 A;  2KA6 B;  4RF0 A;  3AKZ A;  2C98 A;  5EQT A;  5A2Q S;  4GKJ M;  1JR3 A;  3RFW A;  3FYD A;  1D0M A;  4GIP A;  1KYI A;  2DAK A;  1E9S A;  3LVW A;  5E6J A;  1G4A E;  4G6Z A;  4XBO A;  1QUT A;  3IG5 A;  1TGU A;  3GRV A;  2KZU A;  2C9O A;  4LJ8 A;  2MGW A;  2BWB A;  2FFJ A;  2R0I A;  3WHK A;  3GQ5 A;  2UU9 M;  1N33 M;  2DAG A;  4FCW A;  2OOA A;  2R18 A;  3B7N A;  1Q39 A;  5L8R F;  3OTO M;  1IXZ A;  4Z6Y A;  4GHL A;  3D8B A;  2UUB M;  3LCV B;  1OTR A;  1V92 A;  2EKK A;  4B7G A;  4MGZ E;  3FTC A;  3GLF B;  2LVO C;  5FTJ A;  4B7H A;  4AG6 A;  1QDR A;  1ZMW A;  2RKO A;  1G3I A;  3FE3 A;  1C7Y A;  1XXH B;  1PGY A;  1YUB A;  4FWH A;  1TDH A;  3NBX X;  4KO8 A;  4M0W A;  3DA1 A;  1N77 A;  4X65 M;  4KT0 F;  4D80 A;  3K9P A;  1ZMV A;  1IN6 A;  4G4O A;  4JI3 M;  1GKI A;  1XMO M;  3RE8 A;  3GLH E;  3C3D A;  4II7 A;  2X49 A;  2ZTD A;  3HKP A;  2F5N A;  1PJS A;  2N35 A;  3IEC A;  1ZAE A;  2D7E A;  1DGH B;  3H4M A;  1DGF A;  5EP1 A;  4LRT A;  5DFL A;  3JAM S;  2Z8Y M;  3J7B A;  2L4E A;  2WSE F;  4QHS A;  3GLI B;  2BJV A;  3U6Q A;  5KQ8 A;  4XGI A;  3PNV A;  3HHY A;  4IBG A;  2QNJ A;  5FLX S;  3U6S A;  4A3V B;  3PVS A;  2Y21 A;  1Q3C A;  3AOG A;  1QDT A;  3F92 A;  2Z4R A;  4XK8 F;  3CF6 E;  1PM5 A;  1YLA A;  4IBJ A;  3E9S A;  3ZCB B;  1D0K A;  2ZAO A;  2DWL A;  2QPA A;  2L7H A;  1NHG C;  4LJ5 A;  4YY3 M;  4QOZ C;  2LXE A;  3FUV A;  1LTM A;  2HL7 A;  1ORY B;  1QZM A;  4LGM A;  3U6P A;  4IIW A;  4L78 A;  2CHV A;  3BXW A;  5BPV A;  2XZF A;  2UXC M;  2Z3X A;  2DEN A;  1IBM M;  4I8O A;  1MU5 A;  4AG5 A;  1T6O A;  1XWI A;  2H1R A;  3I4Y A;  4FWD A;  2QEN A;  2JY6 B;  2QSF X;  3UK6 A;  2KZS A;  3A46 A;  4AI6 A;  3U5Z B;  1L2D A;  1SXJ E;  1TDZ A;  1OKS A;  1VEK A;  3TL4 X;  1HQY E;  1PJI A;  4JI2 M;  2HKJ A;  2F4V M;  4W5W A;  1Q02 A;  3KW6 A;  3AOE C;  4IBD A;  2XFT A;  3W67 A;  3GRR A;  4G4N A;  1EFU B;  1A5T A;  1TH4 A;  2F5P A;  1GL7 A;  3SAR A;  2QQ8 A;  4LZJ A;  2CFO A;  3GPP A;  1F4I A;  5E26 A;  3EIH A;  2KNA A;  1VDD A;  2M60 A;  2EA0 A;  3KS4 A;  1N75 A;  4LFA M;  3KXE C;  4MGH A;  1IQP A;  2BWE A;  2CUZ A;  4L6V 6;  4NXN M;  4NL4 H;  1RU3 A;  3W0L B;  3R9X B;  4DR7 M;  3PXG A;  2DAI A;  1QYR A;  2KNV A;  1SXJ C;  2A5Y B;  3AOE A;  4Q7J A;  1ZQ9 A;  5GKN A;  2JA2 A;  3VDP A;  1J09 A;  3ZC7 B;  8CAT A;  3SAU A;  1G71 A;  4FCV A;  3HHX A;  2L6O A;  3TWL A;  4NXM M;  3J7A S;  2K0B X;  4M0D A;  1E9R A;  3A45 A;  4HEO A;  4HLQ A;  4LFC M;  4CGY B;  2YNM D;  2XF3 A;  3HU1 A;  3KOW E;  3KP1 E;  1SG9 A;  4QNM A;  5DYI A;  1QAN A;  3GQ3 A;  4LF5 M;  1WJ7 A;  4IBK A;  4JI6 M;  3TPZ A;  4L8R C;  1NV9 A;  3UMM A;  3SAS A;  5C1B A;  4RNA A;  1SXJ A;  4GIT A;  1D0L A;  4QOS A;  4JI7 M;  3KSX A;  3L28 A;  4S12 A;  2LBC A;  5ITQ A;  1P3Q Q;  2EJS A;  2XEP A;  2EO2 A;  1IFY A;  5DNY A;  2FE8 A;  2F5O A;  2VDB B;  1GJS A;  3U61 B;  1K82 A;  3CF2 A;  1X37 A;  2OOB A;  4K0K M;  1G8P A;  4DV3 M;  2I7N A;  3U60 B;  2KDL A;  5KQD A;  4OU7 A;  1NV8 A;  3LQR A;  3T1Y M;  1Z59 A;  3KP0 E;  1N32 M;  3KVW A;  1NO1 A;  4REZ A;  1N36 M;  5FTK A;  4EIW A;  1PRB A;  1NNJ A;  1OFH A;  4AKH A;  3MHV C;  3HZJ A;  1OAI A;  1DGG A;  1Z5B A;  4GRI A;  3BOS A;  1I94 M;  3HHW A;  1IXR C;  4JN6 A;  1XNQ M;  3GP1 A;  2UXB M;  1GL6 A;  1DO0 A;  4L16 A;  2G5G X;  2X4A A;  2VII A;  3E46 A;  4LZZ A;  3SMS A;  1GAB A;  2KEB A;  4DUZ M;  3C3E A;  4NC6 A;  1N34 M;  2FOI C;  2LHC A;  2E5L M;  2LTU A;  3VFD A;  5EP4 A;  2CV2 A;  2GNO A;  1WGN A;  5JI2 E;  2HAK A;  2FS1 A;  3C9P A;  4D81 A;  5LMU M;  2CV0 A;  3U6E A;  2Y0Q A;  1VEG A;  3HX3 A;  3M0E A;  3SBJ A;  2VQE M;  4FD2 A;  5KPR A;  2DHY A;  2JZ1 A;  2ZBK B;  1Z6T A;  3HGI A;  4OVZ A;  3BL4 A;  2QP9 X;  3B7Z A;  2CWB A;  2C9C A;  4LJ4 A;  4DV5 M;  1QAO A;  2O01 F;  4JI8 M;  4LG2 A;  1TR8 A;  2JY5 A;  4LF4 M;  1UM8 A;  4BBA A;  1R5L A;  2BNK A;  3Q8G A;  4ITQ A;  2W82 A;  1E32 A;  1TF0 B;  3T1H M;  1VQ1 A;  5FSW A;  2YFQ A;  2OO9 A;  2JXN A;  3LVV A;  3GPU A;  3GRU A;  5FTL A;  4P17 A;  3FUU A;  3SFZ A;  4DV0 M;  3NBI A;  1MX0 A;  2LH0 A;  2DVW B;  2CRU A;  2C99 A;  4NSO B;  2CEA A;  4WP2 A;  4PDG A;  4DR4 M;  5DYG A;  5EP2 A;  3UGJ A;  1H6U A;  5F3W A;  5KO3 A;  2UUC M;  3WHL A;  1OJL A;  2L4F A;  1J5E M;  3CTW B;  4GH9 A;  1BVS A;  2R44 A;  1Q3B A;  4TUW A;  2DXI A;  2ZAM A;  4GMQ A;  2F5Q A;  3KSJ A;  3E21 A;  3FTE A;  3B7Q A;  2LHG A;  3LQQ A;  3AV0 A;  4DV7 M;  2DWN A;  4RF1 A;  2KRK A;  2KNZ A;  4Y28 F;  2OPF A;  1VEJ A;  2B3T A;  1TH2 A;  2K6B A;  1NSF A;  1JQJ C;  2LWX A;  3I4V A;  4IBC A;  4X66 M;  3SAW A;  2L2D A;  2XZU A;  4GC9 A;  4DBG B;  4BB9 A;  1HJP A;  1IY0 A;  4MH0 E;  1R7R A;  1G59 A;  5IT9 S;  1XXH E;  4IJF A;  4PCZ A;  3GLH A;  3GLG E;  3HJQ A;  2QCU A;  5BR8 M;  1QZE A;  2YQZ A;  3L27 A;  4FCT A;  4LY6 A;  4JXJ A;  3PFI A;  1TH3 A;  3HU3 A;  2F5S A;  1ZV1 A;  1V34 A;  5ITU A;  2DAE A;  2R45 A;  2DWM A;  2XGN A;  5H37 D;  1IM2 A;  2KRU A;  4B3S M;  4GEW A;  5ITX E;  2R4J A;  2LVP C;  4GC5 A;  3T38 A;  3GQ4 A;  3TWM A;  3U6D A;  1QAQ A;  3QYE A;  4ANR A;  4CHT B;  1AIP C;  1DO2 A;  3VKG A;  4DR3 M;  3H4J A;  4M9S A;  4MGI E;  4DUY M;  2VQF M;  2L7I A;  3GLI E;  2Z7J A;  3LMM A;  1Y8G A;  4PDI A;  4PT5 A;  1IBK M;  2UUA M;  4IJE A;  1R6B X;  4JYA M;  4L15 A;  1KSF X;  3FKE A;  2I7P A;  2XSZ D;  4MGK E;  3B89 A;  5IRE B;  2R46 A;  1IXS A;  4WUR A;  2X8A A;  4ZPX A;  1NVM A;  1R2Z A;  1L2C A;  4NOO B;  4YHH M;  4AZF A;  3K9O A;  1S3S A;  4LJA A;  5KPZ A;  3SHF A;  4KHP M;  1IY2 A;  3RGP A;  5C18 A;  3QWL A;  3IG8 A;  4X62 M;  3VLF B;  1G41 A;  3GLG A;  2DZN B;  2O25 A;  3U6O A;  4BLC A;  3R8F A;  1D2N A;  4KOD A;  2FNA A;  1DV0 A;  2G8L A;  4RKU F;  3I01 M;  4M9Z A;  4G4R A;  1EIJ A;  3J80 S;  4B08 A;  4X64 M;  2QZ4 A;  3ZH9 B;  2DHR A;  4LJ7 A;  4DR5 M;  1R2Y A;  1HR0 M;  2K47 A;  3RGS A;  1DGH A;  3TWK A;  1W5S A;  3K8Z A;  2QBY A;  2YR0 A;  4G4Q A;  3GLI A;  3VDU A;  4R3D A;  1QQW A;  2J5Y A;  3T15 A;  1Z5A A;  3BSU A;  1NHW C;  3LCU A;  2JY8 A;  3NWL A;  1TTE A;  2J7O A;  3U6M A;  4LF7 M;  1QVR A;  4FWG A;  4LF9 M;  3M7G A;  4GKK M;  3GPY A;  5FTN A;  1VDL A;  4JI0 M;  4DV1 M;  4CIS A;  1JR3 D;  2Z4S A;  3A98 B;  5EP3 A;  4UN2 B;  2O5R A;  1FJG M;  1MJG M;  2XFS A;  4IBF A;  2AHM A;  2DNA A;  4MGY E;  1HNW M;  3VKH A;  3GRY A;  1NY6 A;  2R4E A;  5KPT A;  3L26 A;  5EXP A;  1E94 E;  2CP8 A;  4G3O A;  3EIE A;  4MM3 B;  2DKL A;  4IBI A;  4LRS A;  1T3T A;  3SAV A;  4F1I A;  4DR1 M;  2R65 A;  2V6Z M;  2ZTC A;  3U6C A;  1L2B A;  2UXD M;  2EKF A;  3E4R A;  2L09 A;  4R7G A;  3GLH B;  3DZD A;  1FNN A;  3GPX A;  1CUK A;  2WSC F;  2Y0T A;  4AKI A;  5JI3 E;  1KFV A;  2C96 A;  2CV1 A;  1OIP A;  1QAM A;  1XC8 A;  1L1T A;  2JP7 A;  2CE7 A;  2QHO B;  2VF8 A;  3BBZ A;  1NJF A;  2XH9 A;  1OAO C;  3M6A A;  1PJQ A;  2GQF A;  2RGH A;  3SC3 A;  1C1K A;  1LV7 A;  1T43 A;  2Q2E B;  2KW0 A;  4DV4 M;  1WGL A;  3KOX E;  3UZU A;  2OQ4 A;  3HU2 A;  3V76 A;  3I04 M;  3HY5 A;  4OX9 M;  1IXS B;  3VK7 A;  1IY1 A;  5ITR A;  1V33 A;  3GO8 A;  3FUX A;  1PJT A;  2CHQ A;  2ERC A;  1J7K A;  1HNZ M;  3GIT A;  3K2L A;  4HL4 A;  4F2L A;  3GLG B;  1GVN A;  2M5Z A;  3K92 A;  4NRW A;  1WR1 B;  3J81 S;  3HHZ A;  2BJW A;  3FUW A;  3W0F A;  1SXJ B;  3U61 A;  1I4W A;  2DWZ B;  3AL0 C;  2K9D A;  5EXS A;  4LGY A;  1WHC A;  1HQC A;  3J2P B;  1L1Z A;  1VG5 A;  4B3R M;  3D8L A;  3ILK A;  3AJI B;  3GLF E;  3U60 A;  1ZMU A;  2WSF F;  4D82 A;  4CIZ A;  3KOY E;  2QBY B;  2LNH C;  4NRV A;  1DGB A;  1GO5 A;  3U6L A;  3KFU G;  1OFI A;  1AUA A;  1N78 A;  1QUS A;  2LVN C;  2ZM6 M;  5IWA M;  4LCB A;  2C5R A;  5ITT A;  4MB7 A;  4GHA A;  2DI0 A;  3C58 A;  1IN4 A;  3T6P A;  3W68 A;  2V1C A;  2APL A;  1IBL M;  3FUT A;  5EXT A;  1W5T A;  5LMN M;  3CF0 A;  3K1J A;  5EXX A;  4Z8X A;  5H3X A;  2JZ0 A;  1IN7 A;  4I5S A;  3THG A;  2JY7 A;  2MH8 A;  4L4U A;  2LVQ D;  3SAT A; 
#chains in the Genus database with same CATH homology
 3L2A A;  3KOZ E;  1YSY A;  1L8Q A;  4AKG A;  4B3T M;  2V1U A;  1GLN A;  2DZO B;  3B9P A;  2R62 A;  3MK6 A;  5IZ7 D;  2HHH M;  2D7G A;  4I4L A;  3GLF A;  3MJ5 A;  2NQ8 C;  1HT2 E;  2Y20 A;  7CAT A;  1XXH A;  4OVZ B;  3AFH A;  1HT1 E;  1EE8 A;  1PJJ A;  1HNX M;  3JR5 A;  4B7F A;  5FTM A;  3KS8 A;  4OW0 A;  1SXJ D;  3L29 A;  3KDS E;  1WXQ A;  3I51 A;  3PNY A;  1Z5C A;  3Q8X A;  4DV2 M;  4LF8 M;  5ITX A;  1XHB A;  3HWS A;  5ITY A;  3FTF A;  2CHG A;  3UJN A;  3L25 A;  2XSZ A;  4IBB A;  3JR4 A;  1XNR M;  1XMQ M;  3QAU A;  3SYK A;  3FYC A;  2RGO A;  1NNU C;  4DV6 M;  2KXE A;  4QHT A;  3TQS A;  1K3X A;  4JI1 M;  3HJ8 A;  3TE6 A;  4LFB M;  4FW9 A;  4AW4 A;  1K3W A;  1NJG A;  2D7H A;  1NY5 A;  1IN8 A;  3SMP A;  4IBE A;  4LF6 M;  4JI4 M;  2XLJ A;  4DR6 M;  2EUC A;  4I81 A;  4WW0 A;  4JV5 M;  2P5T A;  4LJ9 A;  4JI5 M;  3SYL A;  2ZAN A;  3DOA A;  3VK8 A;  4NSR A;  3SHG B;  4FVM A;  4M9X A;  4B3M M;  4DR2 M;  4AQY M;  3J27 B;  3DFZ A;  3FD9 A;  4P16 A;  1IN5 A;  4LJ6 A;  4KLN A;  2HCB A;  2J7N A;  3HJS A;  1YE9 A;  3U5Z A;  3FTD A;  5EJC A;  4QNR A;  4PD2 A;  3A42 A;  2KA6 B;  4RF0 A;  3AKZ A;  2C98 A;  5EQT A;  5A2Q S;  4GKJ M;  1JR3 A;  3RFW A;  3FYD A;  4GIP A;  1KYI A;  1E9S A;  3LVW A;  5E6J A;  1G4A E;  4G6Z A;  4XBO A;  3IG5 A;  1TGU A;  3GRV A;  2KZU A;  2C9O A;  4LJ8 A;  2FFJ A;  3WHK A;  3GQ5 A;  2UU9 M;  1N33 M;  4FCW A;  3OTO M;  2R18 A;  1Q39 A;  1IXZ A;  4Z6Y A;  4GHL A;  3D8B A;  2UUB M;  4B7G A;  3GLF B;  4MGZ E;  3FTC A;  5FTJ A;  4B7H A;  4AG6 A;  2RKO A;  1G3I A;  1XXH B;  1YUB A;  4FWH A;  1TDH A;  4KO8 A;  4M0W A;  3DA1 A;  1N77 A;  4X65 M;  4G4O A;  4D80 A;  1IN6 A;  4JI3 M;  1GKI A;  1XMO M;  3RE8 A;  4II7 A;  3HKP A;  2X49 A;  2F5N A;  1ZAE A;  2D7E A;  1DGH B;  3H4M A;  1DGF A;  5EP1 A;  4LRT A;  3JAM S;  3J7B A;  3U6Q A;  4QHS A;  3GLI B;  2BJV A;  5KQ8 A;  4XGI A;  3PNV A;  3HHY A;  4IBG A;  5FLX S;  3U6S A;  4A3V B;  3PVS A;  2Y21 A;  1Q3C A;  3AOG A;  2Z4R A;  3CF6 E;  1PM5 A;  4IBJ A;  3E9S A;  3ZCB B;  2ZAO A;  2DWL A;  2QPA A;  2L7H A;  1NHG C;  4LJ5 A;  4YY3 M;  4QOZ C;  2LXE A;  3FUV A;  2HL7 A;  1ORY B;  1QZM A;  4LGM A;  3U6P A;  4IIW A;  4L78 A;  2CHV A;  5BPV A;  2XZF A;  2UXC M;  2Z3X A;  1IBM M;  4I8O A;  1MU5 A;  4AG5 A;  1XWI A;  2H1R A;  3I4Y A;  4FWD A;  2QEN A;  3A46 A;  3UK6 A;  2KZS A;  4AI6 A;  3U5Z B;  1L2D A;  1SXJ E;  1TDZ A;  3TL4 X;  1HQY E;  1PJI A;  4JI2 M;  2HKJ A;  2F4V M;  4W5W A;  3KW6 A;  4G4N A;  3AOE C;  4IBD A;  2XFT A;  3GRR A;  1TH4 A;  2F5P A;  3SAR A;  1GL7 A;  4LZJ A;  2CFO A;  3GPP A;  5E26 A;  3EIH A;  1VDD A;  2M60 A;  2EA0 A;  3KS4 A;  1N75 A;  4LFA M;  3KXE C;  4MGH A;  1IQP A;  2CUZ A;  4NXN M;  3W0L B;  1N36 M;  4NL4 H;  3R9X B;  4DR7 M;  3PXG A;  1QYR A;  1SXJ C;  2A5Y B;  3AOE A;  5GKN A;  1ZQ9 A;  3VDP A;  2JA2 A;  3ZC7 B;  1J09 A;  8CAT A;  3SAU A;  4NXM M;  4FCV A;  3HHX A;  2L6O A;  3TWL A;  3J7A S;  4M0D A;  1E9R A;  3A45 A;  4HLQ A;  4LFC M;  4CGY B;  2YNM D;  2XF3 A;  3HU1 A;  3KOW E;  3KP1 E;  4QNM A;  5DYI A;  1QAN A;  3GQ3 A;  4LF5 M;  4IBK A;  4JI6 M;  3TPZ A;  4L8R C;  3UMM A;  3SAS A;  5C1B A;  4RNA A;  1SXJ A;  4GIT A;  4JI7 M;  4QOS A;  3KSX A;  3L28 A;  4S12 A;  5ITQ A;  2XEP A;  2EO2 A;  5DNY A;  2FE8 A;  2F5O A;  3U61 B;  1K82 A;  3CF2 A;  1X37 A;  4K0K M;  1G8P A;  4DV3 M;  2I7N A;  3U60 B;  5KQD A;  4OU7 A;  3LQR A;  3T1Y M;  1Z59 A;  3KP0 E;  1N32 M;  3KVW A;  4REZ A;  5FTK A;  4EIW A;  1NNJ A;  1OFH A;  4AKH A;  3MHV C;  1DGG A;  1Z5B A;  4GRI A;  3BOS A;  1I94 M;  3HHW A;  1IXR C;  4JN6 A;  1XNQ M;  3GP1 A;  2UXB M;  1GL6 A;  1DO0 A;  4L16 A;  2G5G X;  2X4A A;  2VII A;  4LZZ A;  3SMS A;  2KEB A;  4DUZ M;  1N34 M;  2FOI C;  2E5L M;  3VFD A;  5EP4 A;  2CV2 A;  5JI2 E;  4D81 A;  5LMU M;  2CV0 A;  3U6E A;  2Y0Q A;  3M0E A;  3SBJ A;  2VQE M;  4FD2 A;  5KPR A;  4OVZ A;  2ZBK B;  1Z6T A;  3HGI A;  2QP9 X;  4LJ4 A;  2C9C A;  4DV5 M;  1QAO A;  4JI8 M;  4LG2 A;  4LF4 M;  1UM8 A;  4BBA A;  2BNK A;  4ITQ A;  2W82 A;  1E32 A;  3T1H M;  5FSW A;  2YFQ A;  3LVV A;  3GPU A;  3GRU A;  5FTL A;  3FUU A;  3SFZ A;  4DV0 M;  3NBI A;  1MX0 A;  2LH0 A;  2DVW B;  2C99 A;  4NSO B;  2CEA A;  4PDG A;  4DR4 M;  5DYG A;  5EP2 A;  3UGJ A;  1H6U A;  5F3W A;  5KO3 A;  2UUC M;  3WHL A;  1OJL A;  1J5E M;  3CTW B;  4GH9 A;  1Q3B A;  4TUW A;  2DXI A;  2ZAM A;  4GMQ A;  2F5Q A;  3KSJ A;  3FTE A;  3LQQ A;  4DV7 M;  3AV0 A;  2DWN A;  4RF1 A;  2KRK A;  2OPF A;  1TH2 A;  1NSF A;  1JQJ C;  2LWX A;  3I4V A;  4IBC A;  4X66 M;  3SAW A;  2XZU A;  4GC9 A;  4BB9 A;  1G59 A;  1IY0 A;  4MH0 E;  1R7R A;  5IT9 S;  4IJF A;  4PCZ A;  3GLH A;  3HJQ A;  2QCU A;  5BR8 M;  4FCT A;  2YQZ A;  3L27 A;  4LY6 A;  2F5S A;  4JXJ A;  3PFI A;  1TH3 A;  3HU3 A;  5ITU A;  2DWM A;  2R45 A;  2XGN A;  5H37 D;  1IM2 A;  2KRU A;  4B3S M;  5ITX E;  2R4J A;  4GC5 A;  3T38 A;  3GQ4 A;  3TWM A;  3U6D A;  1QAQ A;  4CHT B;  1DO2 A;  3VKG A;  4DR3 M;  4MGI E;  4M9S A;  4DUY M;  2VQF M;  2L7I A;  2Z7J A;  3LMM A;  4PDI A;  4PT5 A;  1IBK M;  2UUA M;  4IJE A;  1R6B X;  4JYA M;  4L15 A;  1KSF X;  3FKE A;  2I7P A;  2XSZ D;  4MGK E;  5IRE B;  2R46 A;  4ZPX A;  4WUR A;  2X8A A;  1NVM A;  1R2Z A;  1L2C A;  4NOO B;  4YHH M;  4AZF A;  5KPZ A;  1S3S A;  4LJA A;  3SHF A;  4KHP M;  1IY2 A;  3RGP A;  5C18 A;  3QWL A;  3IG8 A;  4X62 M;  3VLF B;  1G41 A;  3GLG A;  2DZN B;  3U6O A;  4BLC A;  3R8F A;  1D2N A;  4KOD A;  2FNA A;  2G8L A;  4G4R A;  4M9Z A;  3J80 S;  4B08 A;  4X64 M;  2QZ4 A;  3ZH9 B;  2DHR A;  4LJ7 A;  4DR5 M;  1R2Y A;  1HR0 M;  2K47 A;  3RGS A;  1DGH A;  3TWK A;  1W5S A;  3K8Z A;  2QBY A;  2YR0 A;  4G4Q A;  3GLI A;  3VDU A;  4R3D A;  1QQW A;  3T15 A;  1Z5A A;  1NHW C;  3NWL A;  4LF7 M;  2J7O A;  3U6M A;  4LF9 M;  4GKK M;  1QVR A;  4FWG A;  3M7G A;  3GPY A;  5FTN A;  4JI0 M;  4DV1 M;  4CIS A;  1JR3 D;  2Z4S A;  3A98 B;  5EP3 A;  2O5R A;  1FJG M;  2XFS A;  4IBF A;  2AHM A;  4MGY E;  1HNW M;  3VKH A;  3GRY A;  1NY6 A;  2R4E A;  5KPT A;  3L26 A;  5EXP A;  1E94 E;  3EIE A;  4MM3 B;  4IBI A;  4LRS A;  1T3T A;  3SAV A;  4DR1 M;  2R65 A;  2V6Z M;  1L2B A;  3U6C A;  2UXD M;  3E4R A;  2L09 A;  4R7G A;  3GLH B;  3DZD A;  1FNN A;  3GPX A;  4AKI A;  2Y0T A;  5JI3 E;  1KFV A;  2C96 A;  2CV1 A;  1QAM A;  1XC8 A;  1L1T A;  2CE7 A;  1NJF A;  2XH9 A;  3M6A A;  2RGH A;  3SC3 A;  1C1K A;  1LV7 A;  2Q2E B;  2KW0 A;  4DV4 M;  3KOX E;  3UZU A;  2OQ4 A;  3HU2 A;  4OX9 M;  1IXS B;  3VK7 A;  1IY1 A;  5ITR A;  3GO8 A;  3FUX A;  2ERC A;  2CHQ A;  1HNZ M;  1J7K A;  3K2L A;  4HL4 A;  3GLG B;  1GVN A;  2M5Z A;  3K92 A;  4NRW A;  3J81 S;  3HHZ A;  2BJW A;  3FUW A;  3W0F A;  1SXJ B;  3U61 A;  1I4W A;  2DWZ B;  3AL0 C;  5EXS A;  4LGY A;  1HQC A;  3J2P B;  1L1Z A;  4B3R M;  3D8L A;  3ILK A;  3AJI B;  3U60 A;  4D82 A;  3KOY E;  2QBY B;  2LNH C;  4NRV A;  1DGB A;  3U6L A;  3KFU G;  1OFI A;  1N78 A;  2ZM6 M;  5IWA M;  4LCB A;  2C5R A;  5ITT A;  4MB7 A;  4GHA A;  3C58 A;  1IN4 A;  2V1C A;  1IBL M;  3FUT A;  5EXT A;  1W5T A;  5LMN M;  3CF0 A;  3K1J A;  5EXX A;  4Z8X A;  5H3X A;  1IN7 A;  4I5S A;  3THG A;  4L4U A;  3SAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...