3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen binding protein
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Protein binding
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
2UUAM 3W0FA 2OQ4A 4DR4M 2OPFA 1XMQM 1N33M 4DV3M 4CISA 3U6SA 1Z5AA 4DR2M 3SBJA 4YY3M 1MU5A 1FJGM 1MX0A 3VK7A 4JI0M 3T1YM 3OTOM 4JI4M 4LF7M 4B3SM 4JI1M 1Q3CA 4G4OA 4LF4M 4GKJM 4X65M 5ITUA 2F5PA 4LF6M 4DR6M 3DOAA 3SARA 4G4RA 5ITQA 4DV6M 2E5LM 3GPPA 4ITQA 4JI8M 1HNZM 5IT9S 4DV1M 2F5QA 2ZM6M 1IBKM 2UXDM 5ITRA 4G4NA 3JAMS 4LFBM 4LF5M 4X64M 2F4VM 3GPUA 1K82A 2UXBM 1Z5CA 4X62M 4KHPM 1XNRM 3JR5A 3GPYA 4JV5M 4DR1M 4DUYM 4DUZM 3SAUA 1I94M 4LFAM 3C58A 4JI3M 3T1HM 3U6PA 1PJIA 4DV4M 1Q39A 4MB7A 2F5NA 3U6OA 1K3WA 1L1ZA 4PD2A 4NRVA 4G4QA 4LF8M 2ZBKB 3TWLA 4JI7M 5ITYA 2UUCM 1N36M 2F5SA 1NNJA 1HNWM 5FLXS 2UUBM 5ITXA 3SAVA 4PDGA 2VQFM 5IWAM 2HKJA 3U6DA 4NXNM 3GQ3A 1HR0M 4NXMM 3TWKA 4DR7M 1PM5A 1IBLM 1XC8A 3J81S 3A46A 1PJJA 5ITXE 2UU9M 1EE8A 3U6CA 4NRWA 4PDIA 1R2ZA 4GKKM 1K3XA 2UXCM 4LF9M 4X66M 2XZUA 4PCZA 1Z59A 5BR8M 1Z5BA 4JI2M 3GQ5A 3U6QA 4K0KM 2EA0A 1L2CA 2F5OA 4JI6M 4YHHM 3GP1A 4DR3M 2XZFA 1L2BA 3SATA 3JR4A 1XMOM 1L2DA 3GO8A 3TWMA 4JYAM 1N34M 4DV0M 3J80S 5A2QS 2Q2EB 4DV2M 3U6LA 1XNQM 3U6EA 3GPXA 3SAWA 1J5EM 1KFVA 1IBMM 5LMUM 3A45A 3U6MA 1L1TA 3GQ4A 4B3TM 4OX9M 3A42A 1TDZA 5LMNM 4DV5M 4DV7M 1R2YA 3J7AS 4B3MM 1TDHA 1N32M 4DR5M 2VQEM 5ITTA 2HHHM 4JI5M 4LFCM 4AQYM 3SASA 5H3XA 1Q3BA 3VK8A 1HNXM 4B3RM
chains in the Genus database with same CATH superfamily
1VQ1A 3W0FA 5DNYA 1OFHA 5C1BA 2OPFA 2C9OA 2KRUA 4CISA 3MJ5A 3KW6A 4GHAA 2NQ8C 1XB2B 2JWSA 4LZZA 2QP9X 2DI0A 2R65A 1IN8A 4JI4M 3L29A 3U60B 4R7GA 5E26A 4W5WA 1Q3CA 4BB9A 3GLIB 4LF4M 2XSZD 2L6OA 2RKOA 3GLGE 3SARA 3J2PB 1VEJA 3J7BA 4IBJA 3UGJA 2E5LM 3TQSA 4MM3B 1V92A 2C96A 4LGMA 3FTDA 3HHXA 4IBCA 4D82A 1KSFX 1SXJB 4G4NA 4LFBM 4CJ6A 2CE7A 4X64M 4LF5M 1UFZA 3SFZA 5FTLA 3HY5A 1Z5CA 3GRRA 3AJIB 4R71A 3UJNA 2ZAMA 2J5YA 2QHOB 5EXSA 3HU2A 4X62M 3KFUG 4JV5M 2Y0QA 3FUTA 2C98A 2LNHC 4LFAM 4FVMA 1OQYA 3RGSA 5KPRA 3B9PA 2XLJA 3U6PA 3CF6E 4L4UA 1SXJD 4FD2A 2F5NA 3B7NA 2JUJA 4LCBA 3B7ZA 2KZUA 1HJPA 2O5RA 3U60A 2J7OA 3H4JA 3HGIA 4NRVA 1JB0F 4XBOA 3AOEC 2LTUA 2LVPC 3VKHA 3L28A 1G4AE 2BWEA 4OU7A 5E6JA 1QAMA 2G8LA 3AOEA 1HT2E 1OAIA 3RGPA 2D7EA 5ITYA 3BSUA 4ANRA 1QUTA 2DAGA 2LXEA 3FRIA 3K8ZA 2QNJA 4QOSA 5FLXS 4G6ZA 2YR0A 1P3QQ 4QHTA 2VQFM 3RFWA 2O01F 3GLHB 1NO1A 4MH0E 3NBIA 1HR0M 1GLNA 3R9XB 1QZEA 2DKLA 3K1JA 2I7PA 1D0LA 2KDLA 5L8RF 4AKHA 3J81S 2Z8YM 3KOXE 2QSFX 4F1IA 4OVZB 5KPZA 3U6CA 1D2NA 4PDIA 4MGIE 2YFQA 4QNRA 2VDBB 1BVSA 4NOOB 5EP4A 4OW0A 3L26A 3SYLA 1Z59A 3GQ5A 3LW5F 1TTEA 2QCUA 5EXTA 2EA0A 3HHWA 1TH2A 3EIEA 3FTCA 4MGHA 2XZFA 1L2BA 3FD9A 2DWLA 2CV0A 3SATA 1XXHE 1E32A 1GL7A 3GO8A 2VF7A 4JYAM 3CTWB 3L2AA 3HU1A 4KLNA 3KXEC 3J80S 4DV2M 1N78A 3BOSA 5F3WA 2R46A 4RKUF 1IBMM 1OKSA 1HQCA 1XWIA 3E4RA 4AG6A 3HHZA 3GQ4A 5LMUM 1YUBA 4D80A 3U6MA 4NL4H 3RE8A 2DVWB 3I4VA 1PRBA 3LCVB 1D0MA 4B7HA 2R44A 4OVZA 1N32M 1I4WA 2CEAA 5GKNA 2DWMA 1IN4A 3ZCBB 2Y21A 3KP1E 2KZSA 4AQYM 1Q3BA 2WSCF 3VK8A 2G5GX 1OTRA 3KOYE 2R0IA 3QWLA 4LJ4A 4B3RM 2UUAM 1GO5A 3M0EA 1ZMWA 2R62A 3CF0A 4FCWA 4B08A 1XMQM 2ERCA 3KDSE 5FTNA 1N33M 3SHGB 2FS1A 3BBZA 3CF2A 3I04M 4II7A 3KOWE 1DGBA 2FE8A 3KVWA 3R8FA 1MU5A 1NSFA 3VKGA 3VK7A 3QAUA 4XGIA 5FTKA 1ZMVA 4JN6A 4CIZA 4B3SM 1NNUC 4I81A 4X65M 2DXIA 4LF6M 4P17A 2KNZA 3KP0E 5ITQA 4ITQA 5IT9S 1JR3A 4XK8F 1QVRA 5FTMA 2CHVA 2DAEA 4LJ7A 3K9PA 3ZQJA 5ITRA 2F4VM 3GLIE 2DENA 1R4GA 5EXXA 3GPUA 3I01M 3QYEA 2EUCA 3KSJA 1J09A 2V1UA 4LJ8A 1XNRM 4Q7JA 4NC6A 3VDPA 1IFYA 5BPVA 1X37A 4DUYM 3SAUA 1YLAA 3F92A 1OIZA 1WIVA 1SXJE 2J7NA 2O25A 4UN2B 3GRVA 3FE3A 3HJ8A 2MROB 3PNYA 4JXJA 1OFIA 4PD2A 2DAKA 4G4QA 3SMSA 4IBDA 3LCUA 2Y20A 1IN7A 1KYIA 2JZ0A 4WURA 3FUVA 5JI2E 3MK6A 3PMQA 3TWLA 4JI7M 2KEBA 1EFUB 4QNMA 3DFZA 3LQRA 1NNJA 4AKGA 3AL0C 5IWAM 3FUXA 2HKJA 4IBGA 3DA1A 3U6DA 3U61B 3HWSA 2R6FA 5EXPA 4IBEA 3FTEA 3I4YA 4A3VB 4NXMM 2I7NA 4DR7M 1G8PA 3A46A 2A5YB 1PJJA 5ITXE 2DHYA 1PJSA 4HEOA 1HQYE 4WP2A 2MGWA 4AKIA 3UMMA 4NRWA 1L8QA 1D0KA 1TF0B 4GMQA 3GLHE 2V1CA 4FWHA 3GLFA 3IG8A 4FWGA 3U6QA 4K0KM 3C3EA 2BWBA 1TH3A 4YHHM 4M9SA 2KNVA 2Z7JA 3GP1A 2X49A 1LV7A 1NHWC 3JR4A 3GRUA 3VDUA 2MH8A 2K6BA 2Q2EB 4RNAA 1G71A 2Z3XA 2DAIA 3SAWA 1E9RA 4IBBA 1WGLA 4I8OA 3U61A 1L1TA 3A45A 4LJ9A 4B3TM 1IN6A 1VG5A 1XHBA 2L4FA 1T6OA 2ZAOA 3A42A 3IHPA 1GKIA 1TDZA 5LMNM 2HL7A 3BXWA 2KW0A 1OIPA 2MR9A 3J7AS 2H1RA 5EP1A 4B3MM 3FTFA 2DZOB 3W0LB 4MGZE 1DGGA 2R4EA 1W5SA 2CP8A 3IG5A 3NBXX 3ZH9B 1Y8GA 5ITTA 2VQEM 1QUSA 1AUAA 3D8LA 3T38A 2M5ZA 4G3OA 4Z8XA 3SASA 1Z6TA 2V6ZM 4FWDA 2L7IA 1DO2A 4GITA 3Q8XA 4DR4M 1PJQA 1NJGA 3AOGA 2D7GA 3TPZA 4L78A 3GLGA 1DO0A 4AW4A 2X8AA 3K9OA 4YY3M 2Z4SA 4DR2M 3A98B 3AKZA 1CUKA 3C3DA 1FJGM 1IXZA 4R3DA 4JI0M 3T1YM 3OTOM 1N75A 2W82A 4JI1M 3GRYA 4G4OA 2K47A 2JNHA 2X4AA 5KQ8A 3LVVA 2F5PA 1GL6A 3E9SA 2LWXA 2APLA 1NV9A 3PNVA 4JI8M 1HNZM 2HCBA 2R4JA 3EIHA 3KOZE 3L27A 5JI3E 4DV1M 2ZM6M 1IBKM 1C7YA 2F5QA 1QHKA 2UXDM 2CWBA 2LHGA 4BLCA 3JAMS 2B3TA 2G3QA 1WJ7A 2LVNC 4M0DA 3HKPA 3GITA 3UK6A 5EP3A 4KHPM 1YSYA 1E9SA 1VEGA 1NY6A 1PJTA 2JY6B 2LVAA 3WHLA 5EQTA 4DR1M 2CV2A 2FFJA 4DUZM 1JR3D 2YQZA 5FSWA 1I94M 4QHSA 3C58A 3HU3A 1MJGM 2JY7A 4JI3M 4B7FA 2Z4RA 5C18A 2BJWA 3SYKA 4MB7A 1F4IA 3SMPA 1K3WA 1L1ZA 3J27B 1RU3A 1XXHB 1DV0A 1MN3A 1YE9A 2FOIC 1IY1A 2ZBKB 2H5XA 3LVWA 2CFOA 4CHTB 2AHMA 2LBCA 2XF3A 4LJ6A 1TH4A 4LJ5A 2UUBM 4L16A 2QQ8A 3FYDA 4GH9A 5H37D 1OAOC 2QBYB 1FNNA 4IBIA 3PVSA 5DFLA 2FNAA 2D7HA 3GQ3A 1TGUA 2R45A 3H4MA 3TWKA 3VFDA 2JZ1A 1VDLA 4FW9A 4I5SA 1PM5A 3HX3A 4NSOB 3THGA 2K9DA 1S3SA 2BNKA 2UU9M 1EE8A 5EJCA 4LG2A 3VLFB 5KPTA 1K3XA 2UXCM 4LF9M 5KO3A 4X66M 3U5ZA 1XXHA 2RGHA 2XZUA 3GLFB 1N77A 4PCZA 5BR8M 1IQPA 4GIPA 1Z5BA 4JI2M 2KXEA 3WHKA 4IJEA 1TR8A 2C5RA 1L2CA 3E21A 4P16A 3SHFA 3M7GA 2DHRA 1DGFA 1ZMUA 2RRUA 3B74A 5DYIA 3HHYA 4DR3M 1J7KA 2ZANA 4HL4A 2L09A 1L2DA 2CHGA 3K92A 2QPAA 3ILKA 1N34M 2DNAA 2QBYA 3AV0A 3T15A 5A2QS 3U6LA 1XNQM 3U6EA 1QAQA 1OJLA 2C9CA 4M9ZA 4S12A 2QZ4A 1J5EM 3KSXA 1KFVA 1C1KA 1IM2A 1QQWA 1V33A 4I4LA 4OX9M 2HWJA 1W5TA 2WSEF 1G59A 4GEWA 2MJ5B 2DZLA 4AZFA 1QANA 2RGOA 4CGYB 1DGHB 2JXNA 4LRSA 4LFCM 3PXGA 1EIJA 1T3TA 4IIWA 3UZUA 5H3XA 4WW0A 1HNXM 3I51A 2KHHA 2XSZA 2CRUA 4KT0F 2OQ4A 1A5TA 4DV3M 2BJVA 3FYCA 3GLGB 3U6SA 1SG9A 1Z5AA 4GC9A 7CATA 2VF8A 3SBJA 1LTMA 4Y28F 4BBAA 1R6BX 2P5TA 1JQJC 1MX0A 4LF7M 4LZJA 3B7QA 3Q8GA 4GKJM 3GLIA 4IJFA 5ITUA 1UM8A 3BL4A 4DR6M 2JP7A 5KQDA 2KA6B 3DOAA 4G4RA 4D81A 4NSRA 1IN5A 2GNOA 1NHGC 2N35A 4DV6M 3GPPA 3B89A 2M60A 2EKFA 4FCTA 2JA2A 1DGHA 2EO2A 1IXSB 1NVMA 1NY5A 1R7RA 1SXJA 2VIIA 3FUUA 2ZTCA 5IZ7D 1VDDA 1K82A 2UXBM 2FH0A 3SC3A 2EKKA 1WGNA 4EIWA 1ZAEA 1JR3E 3JR5A 3GPYA 3L25A 2CHQA 2K0BX 3MMPA 1IY2A 1R5LA 1T43A 3MHVC 4Z6YA 3HZJA 3K2LA 1V34A 3M6AA 3T1HM 2WSFF 1ORYB 1PJIA 4QOZC 2LHCA 2KNAA 4FCVA 8CATA 4DV4M 1Q39A 2GQFA 1WHCA 4PT5A 1NJFA 4AG5A 3U6OA 4RF0A 4TUWA 3FKEA 2R18A 2XFTA 4LF8M 3C9PA 2LVOC 4REZA 3AFHA 2C99A 4GRIA 2DWNA 2L4EA 2UUCM 3QYBA 1N36M 3V76A 2F5SA 1IXSA 1H6UA 1NV8A 1GVNA 1QDTA 4KODA 1HNWM 5ITXA 4DBGB 2XEPA 1WXQA 3W67A 2LH0A 2XGNA 3SAVA 3CGWA 4PDGA 4HLQA 2XFSA 4NXNM 1E94E 3GLHA 5EP2A 2CV1A 4L8RC 1IBLM 4F2LA 1XC8A 3KS8A 3E46A 1G41A 3HJSA 3W68A 1R2ZA 4GC5A 1AIPC 3IECA 3T6PA 3DZDA 3U5ZB 1SXJC 4GKKM 1IXRC 1GJTA 3LMMA 3NWLA 4LGYA 4LJAA 2JY8A 4IBKA 2CUZA 1ZQ9A 4M9XA 3FRHA 2F5OA 3ZC7B 2EJSA 2ZTDA 4M0WA 4JI6M 5IREB 2DAMA 1QYRA 2JY5A 3FUWA 5DYGA 3TE6A 1XMOM 2XH9A 1PGYA 4LRTA 4LY6A 2DZNB 1QAOA 5FTJA 3GLFE 4L15A 4DV0M 3TWMA 2L7HA 3GPXA 3LQQA 1ZV1A 2KRKA 3D8BA 3HJQA 1WR1B 4B7GA 2L2DA 4RF1A 4IBFA 1IY0A 1G3IA 2HAKA 1Q02A 4L6V6 4DV5M 2WZJA 4DV7M 1R2YA 2OOAA 1VEKA 1TDHA 3KS4A 4DR5M 2OOBA 4ZPXA 2Y0TA 4GHLA 1QDRA 4MGYE 2HHHM 4MGKE 4KO8A 4AI6A 2DWZB 2YNMD 4JI5M 1GABA 1GJSA 2LVQD 2QENA 2OO9A 3PFIA 1HT1E 1QZMA 3TL4X
chains in the Genus database with same CATH topology
3W0FA 5DNYA 1OFHA 5C1BA 2OPFA 2C9OA 2KRUA 4CISA 3MJ5A 3KW6A 4GHAA 2NQ8C 4LZZA 2QP9X 2R65A 1IN8A 4JI4M 3L29A 3U60B 4R7GA 5E26A 4W5WA 1Q3CA 4BB9A 3GLIB 4LF4M 2XSZD 2L6OA 2RKOA 3SARA 3J2PB 3J7BA 4IBJA 3UGJA 2E5LM 3TQSA 4MM3B 2C96A 4LGMA 3FTDA 3HHXA 4IBCA 4D82A 1KSFX 1SXJB 4G4NA 4LFBM 4LF5M 2CE7A 4X64M 3SFZA 5FTLA 1Z5CA 3GRRA 3AJIB 3UJNA 4X62M 2ZAMA 3KFUG 5EXSA 3HU2A 4JV5M 2Y0QA 3FUTA 2C98A 2LNHC 4LFAM 4FVMA 3RGSA 5KPRA 3B9PA 2XLJA 3U6PA 3CF6E 4L4UA 1SXJD 4FD2A 2F5NA 4LCBA 2KZUA 2O5RA 3U60A 2J7OA 3HGIA 4NRVA 4XBOA 3AOEC 3VKHA 3L28A 1G4AE 4OU7A 5E6JA 1QAMA 2G8LA 3RGPA 1HT2E 5ITYA 2D7EA 2LXEA 3K8ZA 4QOSA 5FLXS 4G6ZA 2YR0A 4QHTA 2VQFM 3RFWA 3GLHB 4MH0E 3NBIA 1HR0M 1GLNA 3R9XB 3K1JA 2I7PA 4AKHA 3J81S 3KOXE 5KPZA 4OVZB 3U6CA 1D2NA 4PDIA 4MGIE 2YFQA 4QNRA 4NOOB 5EP4A 4OW0A 3L26A 3SYLA 1Z59A 3GQ5A 2QCUA 5EXTA 2EA0A 3HHWA 1TH2A 3EIEA 3FTCA 4MGHA 2XZFA 1L2BA 3FD9A 2DWLA 2CV0A 3SATA 1E32A 1GL7A 3GO8A 4JYAM 3CTWB 3L2AA 3HU1A 4KLNA 3KXEC 3J80S 4DV2M 1N78A 3BOSA 5F3WA 2R46A 1IBMM 1HQCA 1XWIA 3E4RA 4AG6A 3HHZA 3GQ4A 5LMUM 1YUBA 4D80A 3U6MA 4NL4H 3RE8A 2DVWB 3I4VA 4B7HA 4OVZA 1N32M 1I4WA 2CEAA 5GKNA 2DWMA 1IN4A 3ZCBB 2Y21A 3KP1E 2KZSA 4AQYM 1Q3BA 3VK8A 2G5GX 3KOYE 3QWLA 4LJ4A 4B3RM 2UUAM 3M0EA 2R62A 3CF0A 4FCWA 4B08A 1XMQM 2ERCA 3KDSE 5FTNA 1N33M 3SHGB 3CF2A 3R8FA 4II7A 3KOWE 1DGBA 2FE8A 3KVWA 1MU5A 1NSFA 3VKGA 3VK7A 3QAUA 4XGIA 5FTKA 4JN6A 4B3SM 1NNUC 4I81A 4X65M 2DXIA 4LF6M 3KP0E 5ITQA 4ITQA 5IT9S 1JR3A 1QVRA 5FTMA 2CHVA 4LJ7A 5ITRA 2F4VM 5EXXA 3GPUA 2EUCA 3KSJA 1J09A 2V1UA 4LJ8A 1XNRM 3VDPA 5BPVA 1X37A 4DUYM 3SAUA 1SXJE 2J7NA 3GRVA 3HJ8A 3PNYA 4JXJA 1OFIA 4PD2A 4G4QA 3SMSA 4IBDA 2Y20A 1IN7A 1KYIA 4WURA 5JI2E 3FUVA 3MK6A 3TWLA 4JI7M 2KEBA 4QNMA 3DFZA 3LQRA 1NNJA 4AKGA 3AL0C 5IWAM 3FUXA 2HKJA 4IBGA 3DA1A 3U6DA 3U61B 3HWSA 5EXPA 4IBEA 3FTEA 3I4YA 4A3VB 4NXMM 2I7NA 4DR7M 1G8PA 3A46A 2A5YB 1PJJA 5ITXE 1HQYE 4AKIA 3UMMA 4NRWA 1L8QA 4GMQA 2V1CA 4FWHA 3GLFA 3IG8A 4FWGA 3U6QA 4K0KM 1TH3A 4YHHM 4M9SA 2Z7JA 3GP1A 2X49A 1LV7A 1NHWC 3JR4A 3GRUA 3VDUA 2Q2EB 4RNAA 2Z3XA 3SAWA 1E9RA 4IBBA 4I8OA 3U61A 1L1TA 3A45A 4LJ9A 4B3TM 1IN6A 1XHBA 2ZAOA 3A42A 1TDZA 1GKIA 5LMNM 2HL7A 2KW0A 3J7AS 2H1RA 5EP1A 4B3MM 3FTFA 2DZOB 3W0LB 4MGZE 1DGGA 2R4EA 1W5SA 3IG5A 3ZH9B 2VQEM 5ITTA 3D8LA 3T38A 2M5ZA 3SASA 4Z8XA 1Z6TA 2V6ZM 4FWDA 2L7IA 1DO2A 4GITA 3Q8XA 4DR4M 1NJGA 3AOGA 2D7GA 3TPZA 4L78A 3GLGA 1DO0A 4AW4A 2X8AA 4YY3M 4DR2M 2Z4SA 3A98B 3AKZA 1FJGM 1IXZA 4R3DA 4JI0M 3T1YM 3OTOM 1N75A 2W82A 4JI1M 3GRYA 4G4OA 2K47A 2X4AA 5KQ8A 3LVVA 2F5PA 1GL6A 3E9SA 2LWXA 3PNVA 4JI8M 1HNZM 2HCBA 2R4JA 3EIHA 3KOZE 3L27A 5JI3E 4DV1M 2ZM6M 1IBKM 2F5QA 2UXDM 4BLCA 3JAMS 4M0DA 3HKPA 3UK6A 5EP3A 4KHPM 1YSYA 1E9SA 1NY6A 3WHLA 4DR1M 2CV2A 5EQTA 2FFJA 4DUZM 1JR3D 2YQZA 5FSWA 1I94M 4QHSA 3C58A 3HU3A 4JI3M 5C18A 4B7FA 2Z4RA 2BJWA 3SYKA 4MB7A 3SMPA 1K3WA 1L1ZA 3J27B 1XXHB 1YE9A 2FOIC 1IY1A 2ZBKB 3LVWA 2CFOA 1HT1E 4CHTB 2AHMA 2XF3A 4LJ6A 1TH4A 4LJ5A 2UUBM 4L16A 3FYDA 4GH9A 5H37D 2QBYB 1FNNA 4IBIA 3PVSA 2FNAA 2D7HA 3GQ3A 1TGUA 2R45A 3H4MA 3TWKA 3VFDA 4FW9A 4I5SA 1PM5A 4NSOB 3THGA 1S3SA 2BNKA 2UU9M 1EE8A 5EJCA 4LG2A 3VLFB 5KPTA 1K3XA 2UXCM 4LF9M 5KO3A 4X66M 3U5ZA 1XXHA 2RGHA 2XZUA 3GLFB 1N77A 4PCZA 5BR8M 1IQPA 4GIPA 1Z5BA 4JI2M 2KXEA 3WHKA 4IJEA 2C5RA 1L2CA 4P16A 3SHFA 3M7GA 2DHRA 1DGFA 5DYIA 3HHYA 4DR3M 1J7KA 2ZANA 4HL4A 2L09A 1L2DA 2CHGA 3K92A 2QPAA 3ILKA 1N34M 2QBYA 3AV0A 3T15A 5A2QS 3U6LA 1XNQM 3U6EA 1QAQA 1OJLA 2C9CA 4M9ZA 4S12A 2QZ4A 1J5EM 3KSXA 1KFVA 1C1KA 1IM2A 1QQWA 4OX9M 4I4LA 1W5TA 1G59A 4AZFA 1QANA 2RGOA 4CGYB 1DGHB 4LRSA 4LFCM 3PXGA 1T3TA 4IIWA 3UZUA 5H3XA 4WW0A 1HNXM 3I51A 2XSZA 2OQ4A 4DV3M 2BJVA 3FYCA 3GLGB 3U6SA 1Z5AA 4GC9A 7CATA 3SBJA 4BBAA 1R6BX 2P5TA 1JQJC 1MX0A 4LF7M 4LZJA 4GKJM 3GLIA 4IJFA 5ITUA 1UM8A 4DR6M 5KQDA 2KA6B 3DOAA 4G4RA 4D81A 4NSRA 1IN5A 1NHGC 4DV6M 3GPPA 2M60A 4FCTA 1DGHA 2JA2A 2EO2A 1NVMA 1IXSB 1NY5A 1R7RA 1SXJA 2VIIA 3FUUA 5IZ7D 1VDDA 1K82A 2UXBM 3SC3A 4EIWA 1ZAEA 3JR5A 3GPYA 3L25A 2CHQA 1IY2A 3MHVC 4Z6YA 3K2LA 3M6AA 3T1HM 1ORYB 1PJIA 4QOZC 8CATA 4FCVA 4DV4M 1Q39A 4PT5A 1NJFA 4AG5A 3U6OA 4RF0A 4TUWA 3FKEA 2R18A 2XFTA 4LF8M 4REZA 3AFHA 2C99A 4GRIA 2DWNA 2UUCM 1N36M 2F5SA 1H6UA 4KODA 1HNWM 1GVNA 5ITXA 3SAVA 2XEPA 1WXQA 2LH0A 2XGNA 4PDGA 4HLQA 2XFSA 4NXNM 1E94E 3GLHA 5EP2A 2CV1A 1IBLM 3KS8A 1XC8A 1G41A 3HJSA 1R2ZA 4GC5A 4GKKM 3U5ZB 3DZDA 1SXJC 1IXRC 3LMMA 3NWLA 4LGYA 4LJAA 4IBKA 2CUZA 1ZQ9A 4M9XA 2F5OA 3ZC7B 4JI6M 4M0WA 5IREB 1QYRA 3FUWA 5DYGA 3TE6A 1XMOM 2XH9A 4LY6A 4LRTA 3TWMA 2DZNB 1QAOA 5FTJA 4DV0M 4L15A 4L8RC 2L7HA 3GPXA 3LQQA 2KRKA 3D8BA 3HJQA 4B7GA 4RF1A 4IBFA 1IY0A 1G3IA 4DV5M 4DV7M 1R2YA 1TDHA 3KS4A 4DR5M 4ZPXA 4GHLA 2Y0TA 4MGYE 2HHHM 4MGKE 4KO8A 4AI6A 2DWZB 2YNMD 4JI5M 2QENA 3PFIA 3AOEA 1QZMA 3TL4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA M;  3W0F A;  2OQ4 A;  4DR4 M;  2OPF A;  1XMQ M;  1N33 M;  4DV3 M;  4CIS A;  3U6S A;  1Z5A A;  4DR2 M;  3SBJ A;  4YY3 M;  1MU5 A;  1FJG M;  1MX0 A;  3VK7 A;  4JI0 M;  3T1Y M;  3OTO M;  4JI4 M;  4LF7 M;  4B3S M;  4JI1 M;  1Q3C A;  4G4O A;  4LF4 M;  4GKJ M;  4X65 M;  5ITU A;  2F5P A;  4LF6 M;  4DR6 M;  3DOA A;  3SAR A;  4G4R A;  5ITQ A;  4DV6 M;  2E5L M;  3GPP A;  4ITQ A;  4JI8 M;  1HNZ M;  5IT9 S;  4DV1 M;  2F5Q A;  2ZM6 M;  1IBK M;  2UXD M;  5ITR A;  4G4N A;  3JAM S;  4LFB M;  4LF5 M;  4X64 M;  2F4V M;  3GPU A;  1K82 A;  2UXB M;  1Z5C A;  4X62 M;  4KHP M;  1XNR M;  3JR5 A;  3GPY A;  4JV5 M;  4DR1 M;  4DUY M;  4DUZ M;  3SAU A;  1I94 M;  4LFA M;  3C58 A;  4JI3 M;  3T1H M;  3U6P A;  1PJI A;  4DV4 M;  1Q39 A;  4MB7 A;  2F5N A;  3U6O A;  1K3W A;  1L1Z A;  4PD2 A;  4NRV A;  4G4Q A;  4LF8 M;  2ZBK B;  3TWL A;  4JI7 M;  5ITY A;  2UUC M;  1N36 M;  2F5S A;  1NNJ A;  1HNW M;  5FLX S;  2UUB M;  5ITX A;  3SAV A;  4PDG A;  2VQF M;  5IWA M;  2HKJ A;  3U6D A;  4NXN M;  3GQ3 A;  1HR0 M;  4NXM M;  3TWK A;  4DR7 M;  1PM5 A;  1IBL M;  1XC8 A;  3J81 S;  3A46 A;  1PJJ A;  5ITX E;  2UU9 M;  1EE8 A;  3U6C A;  4NRW A;  4PDI A;  1R2Z A;  4GKK M;  1K3X A;  2UXC M;  4LF9 M;  4X66 M;  2XZU A;  4PCZ A;  1Z59 A;  5BR8 M;  1Z5B A;  4JI2 M;  3GQ5 A;  3U6Q A;  4K0K M;  2EA0 A;  1L2C A;  2F5O A;  4JI6 M;  4YHH M;  3GP1 A;  4DR3 M;  2XZF A;  1L2B A;  3SAT A;  3JR4 A;  1XMO M;  1L2D A;  3GO8 A;  3TWM A;  4JYA M;  1N34 M;  4DV0 M;  3J80 S;  5A2Q S;  2Q2E B;  4DV2 M;  3U6L A;  1XNQ M;  3U6E A;  3GPX A;  3SAW A;  1J5E M;  1KFV A;  1IBM M;  5LMU M;  3A45 A;  3U6M A;  1L1T A;  3GQ4 A;  4B3T M;  4OX9 M;  3A42 A;  1TDZ A;  5LMN M;  4DV5 M;  4DV7 M;  1R2Y A;  3J7A S;  4B3M M;  1TDH A;  1N32 M;  4DR5 M;  2VQE M;  5ITT A;  2HHH M;  4JI5 M;  4LFC M;  4AQY M;  3SAS A;  5H3X A;  1Q3B A;  3VK8 A;  1HNX M;  4B3R M; 
#chains in the Genus database with same CATH topology
 1VQ1 A;  3W0F A;  5DNY A;  1OFH A;  5C1B A;  2OPF A;  2C9O A;  2KRU A;  4CIS A;  3MJ5 A;  3KW6 A;  4GHA A;  2NQ8 C;  1XB2 B;  2JWS A;  4LZZ A;  2QP9 X;  2DI0 A;  2R65 A;  1IN8 A;  4JI4 M;  3L29 A;  3U60 B;  4R7G A;  5E26 A;  4W5W A;  1Q3C A;  4BB9 A;  3GLI B;  4LF4 M;  2XSZ D;  2L6O A;  2RKO A;  3GLG E;  3SAR A;  3J2P B;  1VEJ A;  3J7B A;  4IBJ A;  3UGJ A;  2E5L M;  3TQS A;  4MM3 B;  1V92 A;  2C96 A;  4LGM A;  3FTD A;  3HHX A;  4IBC A;  4D82 A;  1KSF X;  1SXJ B;  4G4N A;  4LFB M;  4CJ6 A;  2CE7 A;  4X64 M;  4LF5 M;  1UFZ A;  3SFZ A;  5FTL A;  3HY5 A;  1Z5C A;  3GRR A;  3AJI B;  4R71 A;  3UJN A;  2ZAM A;  2J5Y A;  2QHO B;  5EXS A;  3HU2 A;  4X62 M;  3KFU G;  4JV5 M;  2Y0Q A;  3FUT A;  2C98 A;  2LNH C;  4LFA M;  4FVM A;  1OQY A;  3RGS A;  5KPR A;  3B9P A;  2XLJ A;  3U6P A;  3CF6 E;  4L4U A;  1SXJ D;  4FD2 A;  2F5N A;  3B7N A;  2JUJ A;  4LCB A;  3B7Z A;  2KZU A;  1HJP A;  2O5R A;  3U60 A;  2J7O A;  3H4J A;  3HGI A;  4NRV A;  1JB0 F;  4XBO A;  3AOE C;  2LTU A;  2LVP C;  3VKH A;  3L28 A;  1G4A E;  2BWE A;  4OU7 A;  5E6J A;  1QAM A;  2G8L A;  3AOE A;  1HT2 E;  1OAI A;  3RGP A;  2D7E A;  5ITY A;  3BSU A;  4ANR A;  1QUT A;  2DAG A;  2LXE A;  3FRI A;  3K8Z A;  2QNJ A;  4QOS A;  5FLX S;  4G6Z A;  2YR0 A;  1P3Q Q;  4QHT A;  2VQF M;  3RFW A;  2O01 F;  3GLH B;  1NO1 A;  4MH0 E;  3NBI A;  1HR0 M;  1GLN A;  3R9X B;  1QZE A;  2DKL A;  3K1J A;  2I7P A;  1D0L A;  2KDL A;  5L8R F;  4AKH A;  3J81 S;  2Z8Y M;  3KOX E;  2QSF X;  4F1I A;  4OVZ B;  5KPZ A;  3U6C A;  1D2N A;  4PDI A;  4MGI E;  2YFQ A;  4QNR A;  2VDB B;  1BVS A;  4NOO B;  5EP4 A;  4OW0 A;  3L26 A;  3SYL A;  1Z59 A;  3GQ5 A;  3LW5 F;  1TTE A;  2QCU A;  5EXT A;  2EA0 A;  3HHW A;  1TH2 A;  3EIE A;  3FTC A;  4MGH A;  2XZF A;  1L2B A;  3FD9 A;  2DWL A;  2CV0 A;  3SAT A;  1XXH E;  1E32 A;  1GL7 A;  3GO8 A;  2VF7 A;  4JYA M;  3CTW B;  3L2A A;  3HU1 A;  4KLN A;  3KXE C;  3J80 S;  4DV2 M;  1N78 A;  3BOS A;  5F3W A;  2R46 A;  4RKU F;  1IBM M;  1OKS A;  1HQC A;  1XWI A;  3E4R A;  4AG6 A;  3HHZ A;  3GQ4 A;  5LMU M;  1YUB A;  4D80 A;  3U6M A;  4NL4 H;  3RE8 A;  2DVW B;  3I4V A;  1PRB A;  3LCV B;  1D0M A;  4B7H A;  2R44 A;  4OVZ A;  1N32 M;  1I4W A;  2CEA A;  5GKN A;  2DWM A;  1IN4 A;  3ZCB B;  2Y21 A;  3KP1 E;  2KZS A;  4AQY M;  1Q3B A;  2WSC F;  3VK8 A;  2G5G X;  1OTR A;  3KOY E;  2R0I A;  3QWL A;  4LJ4 A;  4B3R M;  2UUA M;  1GO5 A;  3M0E A;  1ZMW A;  2R62 A;  3CF0 A;  4FCW A;  4B08 A;  1XMQ M;  2ERC A;  3KDS E;  5FTN A;  1N33 M;  3SHG B;  2FS1 A;  3BBZ A;  3CF2 A;  3I04 M;  4II7 A;  3KOW E;  1DGB A;  2FE8 A;  3KVW A;  3R8F A;  1MU5 A;  1NSF A;  3VKG A;  3VK7 A;  3QAU A;  4XGI A;  5FTK A;  1ZMV A;  4JN6 A;  4CIZ A;  4B3S M;  1NNU C;  4I81 A;  4X65 M;  2DXI A;  4LF6 M;  4P17 A;  2KNZ A;  3KP0 E;  5ITQ A;  4ITQ A;  5IT9 S;  1JR3 A;  4XK8 F;  1QVR A;  5FTM A;  2CHV A;  2DAE A;  4LJ7 A;  3K9P A;  3ZQJ A;  5ITR A;  2F4V M;  3GLI E;  2DEN A;  1R4G A;  5EXX A;  3GPU A;  3I01 M;  3QYE A;  2EUC A;  3KSJ A;  1J09 A;  2V1U A;  4LJ8 A;  1XNR M;  4Q7J A;  4NC6 A;  3VDP A;  1IFY A;  5BPV A;  1X37 A;  4DUY M;  3SAU A;  1YLA A;  3F92 A;  1OIZ A;  1WIV A;  1SXJ E;  2J7N A;  2O25 A;  4UN2 B;  3GRV A;  3FE3 A;  3HJ8 A;  2MRO B;  3PNY A;  4JXJ A;  1OFI A;  4PD2 A;  2DAK A;  4G4Q A;  3SMS A;  4IBD A;  3LCU A;  2Y20 A;  1IN7 A;  1KYI A;  2JZ0 A;  4WUR A;  3FUV A;  5JI2 E;  3MK6 A;  3PMQ A;  3TWL A;  4JI7 M;  2KEB A;  1EFU B;  4QNM A;  3DFZ A;  3LQR A;  1NNJ A;  4AKG A;  3AL0 C;  5IWA M;  3FUX A;  2HKJ A;  4IBG A;  3DA1 A;  3U6D A;  3U61 B;  3HWS A;  2R6F A;  5EXP A;  4IBE A;  3FTE A;  3I4Y A;  4A3V B;  4NXM M;  2I7N A;  4DR7 M;  1G8P A;  3A46 A;  2A5Y B;  1PJJ A;  5ITX E;  2DHY A;  1PJS A;  4HEO A;  1HQY E;  4WP2 A;  2MGW A;  4AKI A;  3UMM A;  4NRW A;  1L8Q A;  1D0K A;  1TF0 B;  4GMQ A;  3GLH E;  2V1C A;  4FWH A;  3GLF A;  3IG8 A;  4FWG A;  3U6Q A;  4K0K M;  3C3E A;  2BWB A;  1TH3 A;  4YHH M;  4M9S A;  2KNV A;  2Z7J A;  3GP1 A;  2X49 A;  1LV7 A;  1NHW C;  3JR4 A;  3GRU A;  3VDU A;  2MH8 A;  2K6B A;  2Q2E B;  4RNA A;  1G71 A;  2Z3X A;  2DAI A;  3SAW A;  1E9R A;  4IBB A;  1WGL A;  4I8O A;  3U61 A;  1L1T A;  3A45 A;  4LJ9 A;  4B3T M;  1IN6 A;  1VG5 A;  1XHB A;  2L4F A;  1T6O A;  2ZAO A;  3A42 A;  3IHP A;  1GKI A;  1TDZ A;  5LMN M;  2HL7 A;  3BXW A;  2KW0 A;  1OIP A;  2MR9 A;  3J7A S;  2H1R A;  5EP1 A;  4B3M M;  3FTF A;  2DZO B;  3W0L B;  4MGZ E;  1DGG A;  2R4E A;  1W5S A;  2CP8 A;  3IG5 A;  3NBX X;  3ZH9 B;  1Y8G A;  5ITT A;  2VQE M;  1QUS A;  1AUA A;  3D8L A;  3T38 A;  2M5Z A;  4G3O A;  4Z8X A;  3SAS A;  1Z6T A;  2V6Z M;  4FWD A;  2L7I A;  1DO2 A;  4GIT A;  3Q8X A;  4DR4 M;  1PJQ A;  1NJG A;  3AOG A;  2D7G A;  3TPZ A;  4L78 A;  3GLG A;  1DO0 A;  4AW4 A;  2X8A A;  3K9O A;  4YY3 M;  2Z4S A;  4DR2 M;  3A98 B;  3AKZ A;  1CUK A;  3C3D A;  1FJG M;  1IXZ A;  4R3D A;  4JI0 M;  3T1Y M;  3OTO M;  1N75 A;  2W82 A;  4JI1 M;  3GRY A;  4G4O A;  2K47 A;  2JNH A;  2X4A A;  5KQ8 A;  3LVV A;  2F5P A;  1GL6 A;  3E9S A;  2LWX A;  2APL A;  1NV9 A;  3PNV A;  4JI8 M;  1HNZ M;  2HCB A;  2R4J A;  3EIH A;  3KOZ E;  3L27 A;  5JI3 E;  4DV1 M;  2ZM6 M;  1IBK M;  1C7Y A;  2F5Q A;  1QHK A;  2UXD M;  2CWB A;  2LHG A;  4BLC A;  3JAM S;  2B3T A;  2G3Q A;  1WJ7 A;  2LVN C;  4M0D A;  3HKP A;  3GIT A;  3UK6 A;  5EP3 A;  4KHP M;  1YSY A;  1E9S A;  1VEG A;  1NY6 A;  1PJT A;  2JY6 B;  2LVA A;  3WHL A;  5EQT A;  4DR1 M;  2CV2 A;  2FFJ A;  4DUZ M;  1JR3 D;  2YQZ A;  5FSW A;  1I94 M;  4QHS A;  3C58 A;  3HU3 A;  1MJG M;  2JY7 A;  4JI3 M;  4B7F A;  2Z4R A;  5C18 A;  2BJW A;  3SYK A;  4MB7 A;  1F4I A;  3SMP A;  1K3W A;  1L1Z A;  3J27 B;  1RU3 A;  1XXH B;  1DV0 A;  1MN3 A;  1YE9 A;  2FOI C;  1IY1 A;  2ZBK B;  2H5X A;  3LVW A;  2CFO A;  4CHT B;  2AHM A;  2LBC A;  2XF3 A;  4LJ6 A;  1TH4 A;  4LJ5 A;  2UUB M;  4L16 A;  2QQ8 A;  3FYD A;  4GH9 A;  5H37 D;  1OAO C;  2QBY B;  1FNN A;  4IBI A;  3PVS A;  5DFL A;  2FNA A;  2D7H A;  3GQ3 A;  1TGU A;  2R45 A;  3H4M A;  3TWK A;  3VFD A;  2JZ1 A;  1VDL A;  4FW9 A;  4I5S A;  1PM5 A;  3HX3 A;  4NSO B;  3THG A;  2K9D A;  1S3S A;  2BNK A;  2UU9 M;  1EE8 A;  5EJC A;  4LG2 A;  3VLF B;  5KPT A;  1K3X A;  2UXC M;  4LF9 M;  5KO3 A;  4X66 M;  3U5Z A;  1XXH A;  2RGH A;  2XZU A;  3GLF B;  1N77 A;  4PCZ A;  5BR8 M;  1IQP A;  4GIP A;  1Z5B A;  4JI2 M;  2KXE A;  3WHK A;  4IJE A;  1TR8 A;  2C5R A;  1L2C A;  3E21 A;  4P16 A;  3SHF A;  3M7G A;  2DHR A;  1DGF A;  1ZMU A;  2RRU A;  3B74 A;  5DYI A;  3HHY A;  4DR3 M;  1J7K A;  2ZAN A;  4HL4 A;  2L09 A;  1L2D A;  2CHG A;  3K92 A;  2QPA A;  3ILK A;  1N34 M;  2DNA A;  2QBY A;  3AV0 A;  3T15 A;  5A2Q S;  3U6L A;  1XNQ M;  3U6E A;  1QAQ A;  1OJL A;  2C9C A;  4M9Z A;  4S12 A;  2QZ4 A;  1J5E M;  3KSX A;  1KFV A;  1C1K A;  1IM2 A;  1QQW A;  1V33 A;  4I4L A;  4OX9 M;  2HWJ A;  1W5T A;  2WSE F;  1G59 A;  4GEW A;  2MJ5 B;  2DZL A;  4AZF A;  1QAN A;  2RGO A;  4CGY B;  1DGH B;  2JXN A;  4LRS A;  4LFC M;  3PXG A;  1EIJ A;  1T3T A;  4IIW A;  3UZU A;  5H3X A;  4WW0 A;  1HNX M;  3I51 A;  2KHH A;  2XSZ A;  2CRU A;  4KT0 F;  2OQ4 A;  1A5T A;  4DV3 M;  2BJV A;  3FYC A;  3GLG B;  3U6S A;  1SG9 A;  1Z5A A;  4GC9 A;  7CAT A;  2VF8 A;  3SBJ A;  1LTM A;  4Y28 F;  4BBA A;  1R6B X;  2P5T A;  1JQJ C;  1MX0 A;  4LF7 M;  4LZJ A;  3B7Q A;  3Q8G A;  4GKJ M;  3GLI A;  4IJF A;  5ITU A;  1UM8 A;  3BL4 A;  4DR6 M;  2JP7 A;  5KQD A;  2KA6 B;  3DOA A;  4G4R A;  4D81 A;  4NSR A;  1IN5 A;  2GNO A;  1NHG C;  2N35 A;  4DV6 M;  3GPP A;  3B89 A;  2M60 A;  2EKF A;  4FCT A;  2JA2 A;  1DGH A;  2EO2 A;  1IXS B;  1NVM A;  1NY5 A;  1R7R A;  1SXJ A;  2VII A;  3FUU A;  2ZTC A;  5IZ7 D;  1VDD A;  1K82 A;  2UXB M;  2FH0 A;  3SC3 A;  2EKK A;  1WGN A;  4EIW A;  1ZAE A;  1JR3 E;  3JR5 A;  3GPY A;  3L25 A;  2CHQ A;  2K0B X;  3MMP A;  1IY2 A;  1R5L A;  1T43 A;  3MHV C;  4Z6Y A;  3HZJ A;  3K2L A;  1V34 A;  3M6A A;  3T1H M;  2WSF F;  1ORY B;  1PJI A;  4QOZ C;  2LHC A;  2KNA A;  4FCV A;  8CAT A;  4DV4 M;  1Q39 A;  2GQF A;  1WHC A;  4PT5 A;  1NJF A;  4AG5 A;  3U6O A;  4RF0 A;  4TUW A;  3FKE A;  2R18 A;  2XFT A;  4LF8 M;  3C9P A;  2LVO C;  4REZ A;  3AFH A;  2C99 A;  4GRI A;  2DWN A;  2L4E A;  2UUC M;  3QYB A;  1N36 M;  3V76 A;  2F5S A;  1IXS A;  1H6U A;  1NV8 A;  1GVN A;  1QDT A;  4KOD A;  1HNW M;  5ITX A;  4DBG B;  2XEP A;  1WXQ A;  3W67 A;  2LH0 A;  2XGN A;  3SAV A;  3CGW A;  4PDG A;  4HLQ A;  2XFS A;  4NXN M;  1E94 E;  3GLH A;  5EP2 A;  2CV1 A;  4L8R C;  1IBL M;  4F2L A;  1XC8 A;  3KS8 A;  3E46 A;  1G41 A;  3HJS A;  3W68 A;  1R2Z A;  4GC5 A;  1AIP C;  3IEC A;  3T6P A;  3DZD A;  3U5Z B;  1SXJ C;  4GKK M;  1IXR C;  1GJT A;  3LMM A;  3NWL A;  4LGY A;  4LJA A;  2JY8 A;  4IBK A;  2CUZ A;  1ZQ9 A;  4M9X A;  3FRH A;  2F5O A;  3ZC7 B;  2EJS A;  2ZTD A;  4M0W A;  4JI6 M;  5IRE B;  2DAM A;  1QYR A;  2JY5 A;  3FUW A;  5DYG A;  3TE6 A;  1XMO M;  2XH9 A;  1PGY A;  4LRT A;  4LY6 A;  2DZN B;  1QAO A;  5FTJ A;  3GLF E;  4L15 A;  4DV0 M;  3TWM A;  2L7H A;  3GPX A;  3LQQ A;  1ZV1 A;  2KRK A;  3D8B A;  3HJQ A;  1WR1 B;  4B7G A;  2L2D A;  4RF1 A;  4IBF A;  1IY0 A;  1G3I A;  2HAK A;  1Q02 A;  4L6V 6;  4DV5 M;  2WZJ A;  4DV7 M;  1R2Y A;  2OOA A;  1VEK A;  1TDH A;  3KS4 A;  4DR5 M;  2OOB A;  4ZPX A;  2Y0T A;  4GHL A;  1QDR A;  4MGY E;  2HHH M;  4MGK E;  4KO8 A;  4AI6 A;  2DWZ B;  2YNM D;  4JI5 M;  1GAB A;  1GJS A;  2LVQ D;  2QEN A;  2OO9 A;  3PFI A;  1HT1 E;  1QZM A;  3TL4 X; 
#chains in the Genus database with same CATH homology
 3W0F A;  5DNY A;  1OFH A;  5C1B A;  2OPF A;  2C9O A;  2KRU A;  4CIS A;  3MJ5 A;  3KW6 A;  4GHA A;  2NQ8 C;  4LZZ A;  2QP9 X;  2R65 A;  1IN8 A;  4JI4 M;  3L29 A;  3U60 B;  4R7G A;  5E26 A;  4W5W A;  1Q3C A;  4BB9 A;  3GLI B;  4LF4 M;  2XSZ D;  2L6O A;  2RKO A;  3SAR A;  3J2P B;  3J7B A;  4IBJ A;  3UGJ A;  2E5L M;  3TQS A;  4MM3 B;  2C96 A;  4LGM A;  3FTD A;  3HHX A;  4IBC A;  4D82 A;  1KSF X;  1SXJ B;  4G4N A;  4LFB M;  4LF5 M;  2CE7 A;  4X64 M;  3SFZ A;  5FTL A;  1Z5C A;  3GRR A;  3AJI B;  3UJN A;  4X62 M;  2ZAM A;  3KFU G;  5EXS A;  3HU2 A;  4JV5 M;  2Y0Q A;  3FUT A;  2C98 A;  2LNH C;  4LFA M;  4FVM A;  3RGS A;  5KPR A;  3B9P A;  2XLJ A;  3U6P A;  3CF6 E;  4L4U A;  1SXJ D;  4FD2 A;  2F5N A;  4LCB A;  2KZU A;  2O5R A;  3U60 A;  2J7O A;  3HGI A;  4NRV A;  4XBO A;  3AOE C;  3VKH A;  3L28 A;  1G4A E;  4OU7 A;  5E6J A;  1QAM A;  2G8L A;  3RGP A;  1HT2 E;  5ITY A;  2D7E A;  2LXE A;  3K8Z A;  4QOS A;  5FLX S;  4G6Z A;  2YR0 A;  4QHT A;  2VQF M;  3RFW A;  3GLH B;  4MH0 E;  3NBI A;  1HR0 M;  1GLN A;  3R9X B;  3K1J A;  2I7P A;  4AKH A;  3J81 S;  3KOX E;  5KPZ A;  4OVZ B;  3U6C A;  1D2N A;  4PDI A;  4MGI E;  2YFQ A;  4QNR A;  4NOO B;  5EP4 A;  4OW0 A;  3L26 A;  3SYL A;  1Z59 A;  3GQ5 A;  2QCU A;  5EXT A;  2EA0 A;  3HHW A;  1TH2 A;  3EIE A;  3FTC A;  4MGH A;  2XZF A;  1L2B A;  3FD9 A;  2DWL A;  2CV0 A;  3SAT A;  1E32 A;  1GL7 A;  3GO8 A;  4JYA M;  3CTW B;  3L2A A;  3HU1 A;  4KLN A;  3KXE C;  3J80 S;  4DV2 M;  1N78 A;  3BOS A;  5F3W A;  2R46 A;  1IBM M;  1HQC A;  1XWI A;  3E4R A;  4AG6 A;  3HHZ A;  3GQ4 A;  5LMU M;  1YUB A;  4D80 A;  3U6M A;  4NL4 H;  3RE8 A;  2DVW B;  3I4V A;  4B7H A;  4OVZ A;  1N32 M;  1I4W A;  2CEA A;  5GKN A;  2DWM A;  1IN4 A;  3ZCB B;  2Y21 A;  3KP1 E;  2KZS A;  4AQY M;  1Q3B A;  3VK8 A;  2G5G X;  3KOY E;  3QWL A;  4LJ4 A;  4B3R M;  2UUA M;  3M0E A;  2R62 A;  3CF0 A;  4FCW A;  4B08 A;  1XMQ M;  2ERC A;  3KDS E;  5FTN A;  1N33 M;  3SHG B;  3CF2 A;  3R8F A;  4II7 A;  3KOW E;  1DGB A;  2FE8 A;  3KVW A;  1MU5 A;  1NSF A;  3VKG A;  3VK7 A;  3QAU A;  4XGI A;  5FTK A;  4JN6 A;  4B3S M;  1NNU C;  4I81 A;  4X65 M;  2DXI A;  4LF6 M;  3KP0 E;  5ITQ A;  4ITQ A;  5IT9 S;  1JR3 A;  1QVR A;  5FTM A;  2CHV A;  4LJ7 A;  5ITR A;  2F4V M;  5EXX A;  3GPU A;  2EUC A;  3KSJ A;  1J09 A;  2V1U A;  4LJ8 A;  1XNR M;  3VDP A;  5BPV A;  1X37 A;  4DUY M;  3SAU A;  1SXJ E;  2J7N A;  3GRV A;  3HJ8 A;  3PNY A;  4JXJ A;  1OFI A;  4PD2 A;  4G4Q A;  3SMS A;  4IBD A;  2Y20 A;  1IN7 A;  1KYI A;  4WUR A;  5JI2 E;  3FUV A;  3MK6 A;  3TWL A;  4JI7 M;  2KEB A;  4QNM A;  3DFZ A;  3LQR A;  1NNJ A;  4AKG A;  3AL0 C;  5IWA M;  3FUX A;  2HKJ A;  4IBG A;  3DA1 A;  3U6D A;  3U61 B;  3HWS A;  5EXP A;  4IBE A;  3FTE A;  3I4Y A;  4A3V B;  4NXM M;  2I7N A;  4DR7 M;  1G8P A;  3A46 A;  2A5Y B;  1PJJ A;  5ITX E;  1HQY E;  4AKI A;  3UMM A;  4NRW A;  1L8Q A;  4GMQ A;  2V1C A;  4FWH A;  3GLF A;  3IG8 A;  4FWG A;  3U6Q A;  4K0K M;  1TH3 A;  4YHH M;  4M9S A;  2Z7J A;  3GP1 A;  2X49 A;  1LV7 A;  1NHW C;  3JR4 A;  3GRU A;  3VDU A;  2Q2E B;  4RNA A;  2Z3X A;  3SAW A;  1E9R A;  4IBB A;  4I8O A;  3U61 A;  1L1T A;  3A45 A;  4LJ9 A;  4B3T M;  1IN6 A;  1XHB A;  2ZAO A;  3A42 A;  1TDZ A;  1GKI A;  5LMN M;  2HL7 A;  2KW0 A;  3J7A S;  2H1R A;  5EP1 A;  4B3M M;  3FTF A;  2DZO B;  3W0L B;  4MGZ E;  1DGG A;  2R4E A;  1W5S A;  3IG5 A;  3ZH9 B;  2VQE M;  5ITT A;  3D8L A;  3T38 A;  2M5Z A;  3SAS A;  4Z8X A;  1Z6T A;  2V6Z M;  4FWD A;  2L7I A;  1DO2 A;  4GIT A;  3Q8X A;  4DR4 M;  1NJG A;  3AOG A;  2D7G A;  3TPZ A;  4L78 A;  3GLG A;  1DO0 A;  4AW4 A;  2X8A A;  4YY3 M;  4DR2 M;  2Z4S A;  3A98 B;  3AKZ A;  1FJG M;  1IXZ A;  4R3D A;  4JI0 M;  3T1Y M;  3OTO M;  1N75 A;  2W82 A;  4JI1 M;  3GRY A;  4G4O A;  2K47 A;  2X4A A;  5KQ8 A;  3LVV A;  2F5P A;  1GL6 A;  3E9S A;  2LWX A;  3PNV A;  4JI8 M;  1HNZ M;  2HCB A;  2R4J A;  3EIH A;  3KOZ E;  3L27 A;  5JI3 E;  4DV1 M;  2ZM6 M;  1IBK M;  2F5Q A;  2UXD M;  4BLC A;  3JAM S;  4M0D A;  3HKP A;  3UK6 A;  5EP3 A;  4KHP M;  1YSY A;  1E9S A;  1NY6 A;  3WHL A;  4DR1 M;  2CV2 A;  5EQT A;  2FFJ A;  4DUZ M;  1JR3 D;  2YQZ A;  5FSW A;  1I94 M;  4QHS A;  3C58 A;  3HU3 A;  4JI3 M;  5C18 A;  4B7F A;  2Z4R A;  2BJW A;  3SYK A;  4MB7 A;  3SMP A;  1K3W A;  1L1Z A;  3J27 B;  1XXH B;  1YE9 A;  2FOI C;  1IY1 A;  2ZBK B;  3LVW A;  2CFO A;  1HT1 E;  4CHT B;  2AHM A;  2XF3 A;  4LJ6 A;  1TH4 A;  4LJ5 A;  2UUB M;  4L16 A;  3FYD A;  4GH9 A;  5H37 D;  2QBY B;  1FNN A;  4IBI A;  3PVS A;  2FNA A;  2D7H A;  3GQ3 A;  1TGU A;  2R45 A;  3H4M A;  3TWK A;  3VFD A;  4FW9 A;  4I5S A;  1PM5 A;  4NSO B;  3THG A;  1S3S A;  2BNK A;  2UU9 M;  1EE8 A;  5EJC A;  4LG2 A;  3VLF B;  5KPT A;  1K3X A;  2UXC M;  4LF9 M;  5KO3 A;  4X66 M;  3U5Z A;  1XXH A;  2RGH A;  2XZU A;  3GLF B;  1N77 A;  4PCZ A;  5BR8 M;  1IQP A;  4GIP A;  1Z5B A;  4JI2 M;  2KXE A;  3WHK A;  4IJE A;  2C5R A;  1L2C A;  4P16 A;  3SHF A;  3M7G A;  2DHR A;  1DGF A;  5DYI A;  3HHY A;  4DR3 M;  1J7K A;  2ZAN A;  4HL4 A;  2L09 A;  1L2D A;  2CHG A;  3K92 A;  2QPA A;  3ILK A;  1N34 M;  2QBY A;  3AV0 A;  3T15 A;  5A2Q S;  3U6L A;  1XNQ M;  3U6E A;  1QAQ A;  1OJL A;  2C9C A;  4M9Z A;  4S12 A;  2QZ4 A;  1J5E M;  3KSX A;  1KFV A;  1C1K A;  1IM2 A;  1QQW A;  4OX9 M;  4I4L A;  1W5T A;  1G59 A;  4AZF A;  1QAN A;  2RGO A;  4CGY B;  1DGH B;  4LRS A;  4LFC M;  3PXG A;  1T3T A;  4IIW A;  3UZU A;  5H3X A;  4WW0 A;  1HNX M;  3I51 A;  2XSZ A;  2OQ4 A;  4DV3 M;  2BJV A;  3FYC A;  3GLG B;  3U6S A;  1Z5A A;  4GC9 A;  7CAT A;  3SBJ A;  4BBA A;  1R6B X;  2P5T A;  1JQJ C;  1MX0 A;  4LF7 M;  4LZJ A;  4GKJ M;  3GLI A;  4IJF A;  5ITU A;  1UM8 A;  4DR6 M;  5KQD A;  2KA6 B;  3DOA A;  4G4R A;  4D81 A;  4NSR A;  1IN5 A;  1NHG C;  4DV6 M;  3GPP A;  2M60 A;  4FCT A;  1DGH A;  2JA2 A;  2EO2 A;  1NVM A;  1IXS B;  1NY5 A;  1R7R A;  1SXJ A;  2VII A;  3FUU A;  5IZ7 D;  1VDD A;  1K82 A;  2UXB M;  3SC3 A;  4EIW A;  1ZAE A;  3JR5 A;  3GPY A;  3L25 A;  2CHQ A;  1IY2 A;  3MHV C;  4Z6Y A;  3K2L A;  3M6A A;  3T1H M;  1ORY B;  1PJI A;  4QOZ C;  8CAT A;  4FCV A;  4DV4 M;  1Q39 A;  4PT5 A;  1NJF A;  4AG5 A;  3U6O A;  4RF0 A;  4TUW A;  3FKE A;  2R18 A;  2XFT A;  4LF8 M;  4REZ A;  3AFH A;  2C99 A;  4GRI A;  2DWN A;  2UUC M;  1N36 M;  2F5S A;  1H6U A;  4KOD A;  1HNW M;  1GVN A;  5ITX A;  3SAV A;  2XEP A;  1WXQ A;  2LH0 A;  2XGN A;  4PDG A;  4HLQ A;  2XFS A;  4NXN M;  1E94 E;  3GLH A;  5EP2 A;  2CV1 A;  1IBL M;  3KS8 A;  1XC8 A;  1G41 A;  3HJS A;  1R2Z A;  4GC5 A;  4GKK M;  3U5Z B;  3DZD A;  1SXJ C;  1IXR C;  3LMM A;  3NWL A;  4LGY A;  4LJA A;  4IBK A;  2CUZ A;  1ZQ9 A;  4M9X A;  2F5O A;  3ZC7 B;  4JI6 M;  4M0W A;  5IRE B;  1QYR A;  3FUW A;  5DYG A;  3TE6 A;  1XMO M;  2XH9 A;  4LY6 A;  4LRT A;  3TWM A;  2DZN B;  1QAO A;  5FTJ A;  4DV0 M;  4L15 A;  4L8R C;  2L7H A;  3GPX A;  3LQQ A;  2KRK A;  3D8B A;  3HJQ A;  4B7G A;  4RF1 A;  4IBF A;  1IY0 A;  1G3I A;  4DV5 M;  4DV7 M;  1R2Y A;  1TDH A;  3KS4 A;  4DR5 M;  4ZPX A;  4GHL A;  2Y0T A;  4MGY E;  2HHH M;  4MGK E;  4KO8 A;  4AI6 A;  2DWZ B;  2YNM D;  4JI5 M;  2QEN A;  3PFI A;  3AOE A;  1QZM A;  3TL4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...