3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Fibrinogen binding protein
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
5LMUM 1I94M 1L1TA 2EA0A 1XNQM 1XMOM 1IBKM 3U6EA 4JI4M 1IBLM 2Q2EB 2F5PA 3T1HM 1HNXM 4DR6M 3U6QA 4JI8M 4JI7M 4DR3M 2ZM6M 1K3WA 3TWMA 1KFVA 4LF4M 3GPYA 5ITRA 4B3TM 3SASA 4LF5M 3SBJA 3GQ5A 3C58A 3T1YM 1Q39A 4DV1M 5ITXA 3U6SA 3U6CA 4JI6M 1XC8A 3GQ4A 2F5SA 4DR1M 5ITYA 2F5OA 1PJJA 4K0KM 1R2ZA 2OPFA 1TDHA 4AQYM 1Z5BA 4DV2M 5IT9S 3U6MA 4DV5M 3GPUA 1K82A 1XNRM 4JV5M 3DOAA 1NNJA 1EE8A 3TWKA 3GO8A 4DR5M 4X62M 5LMNM 1N33M 1MU5A 4NXNM 1L1ZA 4DV7M 1HNZM 5ITUA 4OX9M 3GQ3A 4LF9M 1HNWM 5FLXS 2F5NA 3J80S 1Q3CA 3J7AS 3OTOM 1N32M 4JI1M 2HKJA 2UUAM 2UU9M 1Q3BA 2OQ4A 1J5EM 4X66M 5A2QS 3A46A 4G4QA 4JYAM 2F4VM 3GP1A 3U6OA 3VK8A 4G4RA 1HR0M 5H3XA 4MB7A 1N34M 1L2BA 4LF8M 4KHPM 3SAVA 1Z5CA 3W0FA 2F5QA 4B3MM 3J81S 4B3RM 4PDGA 1PM5A 3JAMS 1FJGM 4NRVA 4PDIA 4G4NA 2UXBM 1Z5AA 1R2YA 1IBMM 4GKJM 4GKKM 5ITTA 3A45A 4PD2A 4X65M 4DUZM 5ITQA 1TDZA 1K3XA 4LF7M 4PCZA 3A42A 2E5LM 4LF6M 4LFBM 3JR5A 4X64M 5BR8M 4YHHM 2HHHM 2UXCM 3GPPA 2VQEM 4NRWA 1Z59A 1L2CA 4JI0M 2ZBKB 1PJIA 3U6LA 3SARA 4JI3M 4YY3M 3VK7A 4DR4M 4DV6M 3TWLA 5IWAM 3SAWA 2UUBM 4G4OA 1XMQM 4DR7M 3U6DA 5ITXE 4LFCM 4DV0M 3SATA 3U6PA 2UXDM 3GPXA 2XZFA 4DV3M 2UUCM 1MX0A 3JR4A 4JI5M 4B3SM 4ITQA 4NXMM 2VQFM 4LFAM 4JI2M 4DUYM 2XZUA 4DR2M 3SAUA 1L2DA 4CISA 1N36M 4DV4M
chains in the Genus database with same CATH superfamily
2DAIA 2DAEA 1J09A 3VDUA 1R7RA 2R65A 3UJNA 3KOYE 1NJFA 1V33A 4HLQA 1XMOM 2DHRA 2P5TA 3AOEC 2L2DA 3KP0E 4HEOA 2NQ8C 2CHQA 2FS1A 4MGHA 4IBBA 2C98A 1HNXM 5KPRA 2QSFX 4DR6M 3FTDA 3KVWA 4JI7M 2DAMA 3GLFB 2ZM6M 4DR3M 4G3OA 3VDPA 1YUBA 2QNJA 2LBCA 1KFVA 1QZMA 3T38A 2EKKA 1I4WA 4L15A 3GPYA 1PJSA 3SASA 1DGHA 3AFHA 3L2AA 3C3DA 4AKHA 3GQ5A 2XGNA 3HU1A 2C5RA 4GEWA 3KDSE 5EXTA 3GLIB 1Q39A 5ITXA 1OTRA 1PJTA 1LV7A 2BJWA 3RE8A 1L8QA 1PJQA 3D8LA 2QQ8A 3GQ4A 1IN6A 1GO5A 2F5SA 1KSFX 2MGWA 1ZAEA 3LW5F 4FCVA 2F5OA 2L7HA 1YLAA 2DWLA 4RNAA 1E9RA 4IBDA 3KW6A 1HT1E 1NNUC 4FCWA 1QANA 4FWDA 4QOSA 2G8LA 4Y28F 2ZAMA 1D0LA 1GLNA 3CF2A 2BNKA 3TWKA 1XXHE 4LJ4A 3VLFB 2YFQA 4JXJA 1HQCA 3L25A 1SXJE 4GH9A 4NXNM 4DV7M 3HJQA 5KPTA 2EJSA 5ITUA 1FNNA 3M7GA 4BBAA 3U60B 4OX9M 1X37A 2HCBA 3GPUA 2W82A 2R46A 2CHGA 2D7GA 3SMSA 1GL6A 1GJSA 1Q3CA 2LXEA 2BWEA 3OTOM 3FTFA 1N32M 4FVMA 2DZOB 2UUAM 1JR3D 3FE3A 4AZFA 2HL7A 2WZJA 2K6BA 2OQ4A 5A2QS 3A46A 1J5EM 2JY5A 4I5SA 3A98B 2DWNA 1DV0A 3K92A 4MM3B 4G4RA 1HR0M 1VG5A 2LVQD 1OFIA 1PGYA 2EUCA 3IECA 4MB7A 1R5LA 3FYCA 2I7NA 2VDBB 2XSZA 3NWLA 4LZJA 1L2BA 1HT2E 3W0FA 5KQ8A 3SAVA 1HJPA 2LVNC 3NBXX 1G4AE 3K9PA 4NRVA 4FCTA 4CJ6A 4M9ZA 1XXHA 3MMPA 5FTMA 2XF3A 4GKKM 4RF1A 1SXJA 2X8AA 4X65M 4G6ZA 1WGLA 2KEBA 4LRTA 4MGYE 2LHCA 4LF7M 4PCZA 2LVAA 3A42A 2DWZB 3U61B 4IBCA 1OKSA 3FUWA 1VDDA 4NC6A 3U5ZB 3JR5A 2E5LM 3H4MA 4LF6M 2LNHC 4QHTA 4LFBM 1NJGA 3HX3A 2DI0A 1A5TA 1TH4A 4XGIA 2G3QA 1Q02A 4M0WA 2AHMA 3K8ZA 5JI3E 1GKIA 2L6OA 4JI3M 4YY3M 2CV2A 2DKLA 5IWAM 2LWXA 2UUBM 2MJ5B 2R6FA 2EKFA 5EP2A 3FD9A 3KSJA 1JB0F 1OAOC 1V34A 4JI5M 2Y20A 3JR4A 4I81A 2R62A 5DNYA 4ITQA 4QOZC 2KNZA 1QAOA 2ZTCA 4LY6A 1WJ7A 4Z8XA 3HJSA 4UN2B 2XZUA 1L2DA 4LJ6A 2YR0A 2X49A 2O5RA 1GABA 2EA0A 1XNQM 1XB2B 2GQFA 3R9XB 4JI4M 3DZDA 4M9XA 2Q2EB 1NY6A 3VKHA 3QYEA 1CUKA 4RF0A 3CF0A 3IG8A 1IXSB 1WIVA 3U6QA 5H37D 1XWIA 3KOXE 1QZEA 3B7ZA 2VF8A 1QAMA 4B7HA 5ITRA 2LH0A 1G3IA 2Y0TA 3SBJA 2LHGA 1IFYA 2CE7A 2JNHA 5E26A 3FRIA 1IXRC 3Q8XA 3TE6A 3B7QA 2N35A 1J7KA 2X4AA 1ZMUA 3PFIA 2LVPC 1W5TA 2C9CA 3LMMA 5E6JA 5EXPA 4DR1M 3TPZA 3M0EA 2D7EA 2JXNA 4KO8A 4L4UA 1PJJA 1EIJA 3RFWA 1NO1A 2R4EA 2OPFA 2FE8A 4P16A 4DV2M 3HHXA 3U6MA 1K82A 5EP3A 3HHYA 1XNRM 1EE8A 4X62M 1MU5A 2Y0QA 1RU3A 3U61A 5FTLA 3GQ3A 2CV1A 2R18A 2OO9A 5EQTA 3J80S 3J7AS 3HJ8A 5BPVA 2MROB 4LJ8A 2Z3XA 3HU2A 2HKJA 5C18A 4JI1M 2UU9M 4II7A 4FW9A 4ZPXA 4AG5A 3HY5A 4G4QA 4JYAM 4S12A 2OOAA 2CUZA 2DXIA 2F4VM 3H4JA 2JZ0A 2L4EA 3KFUG 1NV8A 4IBIA 4NSOB 4OU7A 1N34M 4LF8M 4KHPM 5F3WA 1Z5CA 2F5QA 1T6OA 1GJTA 2CWBA 4B3RM 3MJ5A 2DVWB 1QAQA 2APLA 4WW0A 4HL4A 2Z4SA 3AOEA 4GRIA 3JAMS 1QDRA 3ZH9B 2CHVA 3HU3A 4D82A 1IBMM 2DHYA 2KA6B 2JP7A 2R44A 4XBOA 4GKJM 3PNYA 2QZ4A 3SC3A 5ITQA 2JUJA 1S3SA 1QQWA 4TUWA 4GIPA 3E21A 3GLFE 1SG9A 1G59A 4AI6A 2H1RA 2K0BX 4GC5A 5KO3A 4YHHM 2HHHM 3B89A 3NBIA 3GLIE 3RGSA 1VDLA 1YE9A 1G8PA 2JY8A 2WSCF 3UK6A 3SARA 4DR4M 3GLHB 2ZAOA 4DV6M 3TWLA 3R8FA 3SAWA 3THGA 4G4OA 4AW4A 1XMQM 3I04M 1QHKA 2MR9A 4QNMA 2J5YA 4OVZB 3GLGA 1LTMA 2G5GX 3HGIA 2UUCM 1MX0A 2FNAA 2VQFM 4LFAM 2DAKA 5DFLA 1BVSA 3ZCBB 3SYLA 1DO2A 4DUYM 5EXXA 1C7YA 1WXQA 1IY2A 4DR2M 3SAUA 1V92A 4PT5A 4CISA 3FTEA 1PJIA 5GKNA 3W68A 1H6UA 1HQYE 2DAGA 3GLFA 3QWLA 3I4VA 1UFZA 2KNAA 3ZQJA 3M6AA 2VIIA 2QBYB 1IM2A 1GVNA 4GHAA 1E32A 3T1HM 4LJ9A 3DA1A 3GLIA 2MH8A 4L16A 4IBEA 1UM8A 2FOIC 3HHZA 3SHFA 1E9SA 2ZTDA 3C9PA 4B3TM 2H5XA 3MHVC 1N75A 1VEKA 3C58A 3T1YM 2QBYA 2L09A 4LZZA 4IBFA 3GRVA 2CFOA 4WP2A 4AKGA 8CATA 1TH2A 1QUSA 1DGHB 2K47A 1DGGA 3FRHA 5FTNA 4DV4M 4LG2A 4CHTB 5ITYA 3QYBA 2JY7A 2XSZD 4GC9A 3QAUA 1R2ZA 3DFZA 1TDHA 3U60A 5EJCA 5IT9S 1OAIA 4M0DA 3TL4X 5KPZA 4Z6YA 1T3TA 3DOAA 2K9DA 4KLNA 2LTUA 3GO8A 4DR5M 2HWJA 5LMNM 3C3EA 4AG6A 2KHHA 4IBKA 1L1ZA 1HNZM 1SXJD 1N33M 3GRUA 4MH0E 2XFSA 3UMMA 1E94E 1EFUB 2V1CA 3FTCA 3VKGA 3KSXA 4LF9M 2KRUA 4REZA 3L26A 2I7PA 2L7IA 3J2PB 1JR3E 2RKOA 3HHWA 3FUVA 3MK6A 1N77A 4X66M 4CIZA 3BSUA 3GRRA 3PNVA 3AKZA 2RGOA 3U6OA 3VK8A 2KRKA 5L8RF 1QVRA 1IN5A 2B3TA 3L28A 3GLGE 1MN3A 2KZSA 3LQQA 1TH3A 3KOZE 5JI2E 4B3MM 1N78A 1IXZA 4PDGA 2DZNB 2V6ZM 2QHOB 3KS4A 4G4NA 1AIPC 4D80A 2M60A 1R2YA 4IBJA 2KDLA 3U5ZA 3IG5A 5ITTA 1NHGC 4DUZM 7CATA 2J7OA 4AKIA 3W0LB 1K3XA 2C9OA 1IY1A 2ERCA 1MJGM 3FUUA 1R6BX 3SMPA 2WSEF 1XHBA 1ZMWA 3ILKA 1SXJB 5BR8M 4LCBA 2UXCM 1JR3A 3FUXA 3GRYA 1IN7A 1Z59A 3L27A 1L2CA 3FKEA 4JI0M 2XLJA 2ZBKB 4IBGA 3CGWA 4RKUF 3U6LA 3FUTA 4W5WA 2GNOA 3V76A 3VK7A 5IREB 4XK8F 3E9SA 5FTKA 3K1JA 3LVWA 4F1IA 1DO0A 1WR1B 4DR7M 3I4YA 3U6DA 1OJLA 3SATA 2R45A 3U6PA 2WSFF 2UXDM 3E4RA 4NSRA 5DYIA 4BB9A 4NOOB 4R7GA 4CGYB 3GPXA 4DV3M 2XZFA 4B3SM 1ZMVA 3PVSA 1VEJA 1G41A 3T6PA 5IZ7D 4NXMM 4Q7JA 3KP1E 5KQDA 4KODA 2YNMD 4FWHA 3SHGB 1NSFA 4MGKE 1N36M 4WURA 3VFDA 3SYKA 1IXSA 5LMUM 1I94M 1AUAA 3L29A 1L1TA 2Y21A 4B7FA 3I51A 3U6EA 1R4GA 1IBKM 1IBLM 2F5PA 3BBZA 2FFJA 4FD2A 4ANRA 4LJ5A 1NVMA 5DYGA 3CTWB 1VQ1A 2KW0A 4JI8M 5C1BA 2OOBA 1K3WA 1SXJC 3W67A 3TWMA 1W5SA 4LF4M 3UZUA 1IN4A 3LQRA 4LF5M 1NHWC 2J7NA 4LGMA 1GL7A 3HKPA 1Z6TA 4DV1M 2QENA 3AOGA 3U6SA 3U6CA 1XC8A 2V1UA 4JI6M 1TR8A 4GITA 3BOSA 2BJVA 4NL4H 1QDTA 2CV0A 2QP9X 4LJ7A 3PXGA 1ZQ9A 2O01F 4BLCA 4K0KM 2XFTA 4AQYM 1Z5BA 4L78A 1QYRA 4DV5M 1OIZA 2RGHA 4JV5M 2CP8A 1ZV1A 4QHSA 1NNJA 1WGNA 4FWGA 3EIEA 1YSYA 3KS8A 3AV0A 1DGFA 1OQYA 2A5YB 2VF7A 2LVOC 3GITA 2C96A 1HNWM 2R4JA 5FLXS 2F5NA 3E46A 3KOWE 2R0IA 3Q8GA 3GLHE 4I4LA 3BL4A 1Q3BA 3HWSA 1D0MA 4KT0F 2RRUA 3K2LA 4L6V6 4B7GA 4DBGB 4I8OA 5EP1A 1T43A 3J7BA 3WHKA 1WHCA 3GP1A 1ORYB 3KXEC 4IJEA 1P3QQ 3HZJA 5H3XA 5FTJA 4F2LA 1F4IA 3B7NA 1G71A 2DZLA 2ZANA 1OIPA 2M5ZA 3IHPA 3J81S 2YQZA 3WHLA 1DGBA 4EIWA 4D81A 1PM5A 1FJGM 3UGJA 1OFHA 2CEAA 2KXEA 4LRSA 1NY5A 3LVVA 2DENA 4IIWA 4OW0A 4R3DA 1Z5AA 4PDIA 2UXBM 4L8RC 3A45A 2XH9A 4PD2A 2HAKA 4MGIE 3F92A 2QPAA 3FYDA 4GMQA 3ZC7B 1TDZA 1D0KA 2JA2A 3AJIB 1IQPA 3D8BA 3AL0C 2CRUA 2XEPA 3CF6E 1D2NA 1JQJC 4X64M 1KYIA 5EP4A 4GHLA 1TTEA 3B9PA 3EIHA 3GLHA 2L4FA 3GPPA 2VQEM 1IY0A 2FH0A 4P17A 4NRWA 2C99A 4LJAA 5EXSA 4QNRA 3RGPA 1Y8GA 4B08A 3LCVB 2D7HA 4OVZA 3T15A 2KZUA 4A3VB 4M9SA 2JZ1A 3B74A 3K9OA 4MGZE 3TQSA 2BWBA 1TGUA 2JY6B 5ITXE 1C1KA 1PRBA 2Z4RA 3BXWA 4IJFA 4DV0M 4LFCM 1TF0B 3I01M 3J27B 3PMQA 2JWSA 2Z7JA 4JN6A 2DWMA 1QUTA 2O25A 1NV9A 3LCUA 1VEGA 4LGYA 2DNAA 1IN8A 4JI2M 2EO2A 3GLGB 2Z8YM 4R71A 1XXHB 5FSWA 2KNVA 2QCUA 3SFZA
chains in the Genus database with same CATH topology
1J09A 3VDUA 1R7RA 2R65A 3UJNA 3KOYE 1NJFA 4HLQA 1XMOM 2DHRA 2P5TA 3AOEC 3KP0E 2NQ8C 2CHQA 4MGHA 4IBBA 2C98A 1HNXM 5KPRA 4DR6M 3FTDA 3KVWA 4JI7M 3GLFB 2ZM6M 4DR3M 3VDPA 1YUBA 1KFVA 1QZMA 3T38A 1I4WA 4L15A 3GPYA 3SASA 1DGHA 3AFHA 3L2AA 4AKHA 3GQ5A 2XGNA 3HU1A 2C5RA 3KDSE 5EXTA 3GLIB 1Q39A 5ITXA 1LV7A 2BJWA 3RE8A 1L8QA 3D8LA 3GQ4A 1IN6A 2F5SA 1KSFX 1ZAEA 2F5OA 4FCVA 2L7HA 2DWLA 4RNAA 1E9RA 4IBDA 3KW6A 1HT1E 1NNUC 4FCWA 1QANA 4FWDA 4QOSA 2G8LA 5E6JA 2ZAMA 1GLNA 3GPUA 3CF2A 2BNKA 3TWKA 3VLFB 4LJ4A 3L25A 2YFQA 4JXJA 1HQCA 1SXJE 4GH9A 4NXNM 4DV7M 3HJQA 5KPTA 5ITUA 1FNNA 3M7GA 4BBAA 3U60B 4OX9M 1X37A 2HCBA 2W82A 2R46A 2CHGA 2D7GA 3SMSA 1GL6A 1Q3CA 2LXEA 3OTOM 3FTFA 1N32M 4FVMA 2DZOB 2UUAM 1JR3D 4AZFA 2HL7A 2OQ4A 1J5EM 5A2QS 3A46A 4I5SA 3A98B 2DWNA 3K92A 4MM3B 4G4RA 1HR0M 1OFIA 2EUCA 4MB7A 3FYCA 2I7NA 4LZJA 2XSZA 3NWLA 1L2BA 1HT2E 3W0FA 5KQ8A 3SAVA 1G4AE 4NRVA 4FCTA 4M9ZA 1XXHA 5FTMA 4GKKM 2XF3A 4RF1A 1SXJA 2X8AA 4X65M 4G6ZA 4LRTA 2KEBA 4MGYE 4LF7M 4PCZA 3A42A 2DWZB 3U61B 3FUWA 1VDDA 3U5ZB 2E5LM 3JR5A 4LF6M 3H4MA 4LFBM 2LNHC 4QHTA 1NJGA 1TH4A 4XGIA 4M0WA 2AHMA 3K8ZA 5JI3E 1GKIA 2L6OA 4JI3M 4YY3M 2CV2A 5IWAM 2LWXA 2UUBM 5EP2A 3FD9A 3KSJA 4JI5M 2Y20A 3JR4A 4I81A 2R62A 5DNYA 4ITQA 4QOZC 1QAOA 4LY6A 4Z8XA 3HJSA 2XZUA 1L2DA 4LJ6A 2YR0A 2X49A 2O5RA 2EA0A 1XNQM 3R9XB 4JI4M 3DZDA 4M9XA 2Q2EB 1NY6A 3VKHA 4RF0A 3CF0A 3IG8A 1IXSB 3U6QA 5H37D 1XWIA 3KOXE 1QAMA 4B7HA 5ITRA 2LH0A 1G3IA 2Y0TA 3SBJA 2CE7A 5E26A 1IXRC 3Q8XA 3TE6A 1J7KA 2X4AA 3PFIA 1W5TA 2C9CA 3LMMA 5EXPA 4DR1M 3TPZA 3M0EA 2D7EA 4KO8A 4L4UA 1PJJA 3RFWA 2R4EA 2OPFA 2FE8A 4P16A 4DV2M 3HHXA 3U6MA 1K82A 5EP3A 3HHYA 1XNRM 1EE8A 4X62M 1MU5A 2Y0QA 2CV1A 3U61A 5FTLA 3GQ3A 2R18A 5EQTA 3J80S 3J7AS 3HJ8A 5BPVA 4LJ8A 2Z3XA 3HU2A 2HKJA 5C18A 4JI1M 2UU9M 4II7A 4FW9A 4ZPXA 4AG5A 4G4QA 4JYAM 4S12A 2CUZA 2DXIA 2F4VM 3KFUG 4IBIA 4NSOB 4OU7A 1N34M 4LF8M 4KHPM 5F3WA 1Z5CA 2F5QA 4B3RM 3MJ5A 2DVWB 1QAQA 4WW0A 3JAMS 4HL4A 2Z4SA 3AOEA 4GRIA 3ZH9B 2CHVA 3HU3A 4D82A 1IBMM 4XBOA 2KA6B 4GKJM 3PNYA 2QZ4A 3SC3A 5ITQA 1S3SA 1QQWA 4TUWA 4GIPA 1G59A 4AI6A 2H1RA 4GC5A 5KO3A 4YHHM 2HHHM 3NBIA 3RGSA 1YE9A 1G8PA 3UK6A 3SARA 4DR4M 3GLHB 2ZAOA 4DV6M 3TWLA 3R8FA 3SAWA 3THGA 4G4OA 4AW4A 1XMQM 4QNMA 4OVZB 3GLGA 2G5GX 3HGIA 2UUCM 1MX0A 2FNAA 2VQFM 4LFAM 3ZCBB 3SYLA 1DO2A 4DUYM 5EXXA 1WXQA 1IY2A 4DR2M 3SAUA 4CISA 4PT5A 3FTEA 1PJIA 5GKNA 1H6UA 1HQYE 3GLFA 3QWLA 3I4VA 3M6AA 2VIIA 2QBYB 1IM2A 1GVNA 4GHAA 1E32A 3T1HM 4LJ9A 3DA1A 3GLIA 4L16A 4IBEA 1UM8A 2FOIC 3HHZA 3SHFA 1E9SA 4B3TM 3MHVC 1N75A 3C58A 3T1YM 2QBYA 2L09A 4LZZA 4IBFA 3GRVA 2CFOA 4AKGA 8CATA 1TH2A 1DGHB 2K47A 1DGGA 5FTNA 4DV4M 4LG2A 4CHTB 5ITYA 4GC9A 2XSZD 3QAUA 1R2ZA 3DFZA 1TDHA 3U60A 5EJCA 5IT9S 4M0DA 3TL4X 5KPZA 4Z6YA 1T3TA 3DOAA 4KLNA 3GO8A 4DR5M 5LMNM 4AG6A 1N33M 1L1ZA 4IBKA 1HNZM 1SXJD 3GRUA 4MH0E 2XFSA 3UMMA 1E94E 2V1CA 3FTCA 3VKGA 3KSXA 4LF9M 2KRUA 4REZA 3L26A 2I7PA 2L7IA 3J2PB 2RKOA 3HHWA 3FUVA 3MK6A 1N77A 4X66M 3GRRA 3PNVA 3AKZA 2RGOA 3U6OA 3VK8A 2KRKA 1QVRA 1IN5A 3L28A 2KZSA 3LQQA 1TH3A 3KOZE 5JI2E 4B3MM 1N78A 1IXZA 4PDGA 2DZNB 2V6ZM 3KS4A 4G4NA 4D80A 2M60A 1R2YA 4IBJA 3U5ZA 3IG5A 5ITTA 1NHGC 4DUZM 7CATA 2J7OA 4AKIA 3W0LB 1K3XA 2C9OA 1IY1A 2ERCA 3FUUA 3SMPA 1R6BX 1XHBA 5BR8M 3ILKA 1SXJB 4LCBA 2UXCM 1JR3A 3FUXA 3GRYA 1IN7A 1Z59A 3L27A 1L2CA 3FKEA 4JI0M 2XLJA 2ZBKB 4IBGA 3U6LA 3FUTA 4W5WA 3VK7A 5IREB 3E9SA 5FTKA 3K1JA 3LVWA 1DO0A 4DR7M 3I4YA 3U6DA 1OJLA 3SATA 2R45A 3U6PA 2UXDM 3E4RA 4NSRA 5DYIA 4BB9A 4NOOB 4R7GA 4CGYB 3GPXA 4DV3M 2XZFA 4B3SM 3PVSA 4NXMM 1G41A 5IZ7D 3KP1E 5KQDA 4KODA 2YNMD 4FWHA 3SHGB 1NSFA 4MGKE 1N36M 4WURA 3VFDA 3SYKA 5LMUM 1I94M 3L29A 1L1TA 2Y21A 4B7FA 3I51A 3U6EA 1IBKM 1IBLM 2F5PA 2FFJA 4FD2A 4LJ5A 1NVMA 5DYGA 3CTWB 2KW0A 4JI8M 5C1BA 1K3WA 1SXJC 3TWMA 1W5SA 4LF4M 3UZUA 1IN4A 3LQRA 4LF5M 1NHWC 2J7NA 4LGMA 1GL7A 3HKPA 1Z6TA 4DV1M 2QENA 3AOGA 3U6SA 3U6CA 1XC8A 2V1UA 4JI6M 4GITA 3BOSA 2BJVA 4NL4H 2CV0A 2QP9X 4LJ7A 3PXGA 1ZQ9A 4BLCA 4K0KM 2XFTA 4AQYM 1Z5BA 4L78A 1QYRA 4DV5M 2RGHA 4JV5M 4QHSA 1NNJA 4FWGA 3EIEA 1YSYA 3KS8A 3AV0A 1DGFA 2A5YB 2C96A 1HNWM 2R4JA 5FLXS 2F5NA 3KOWE 4I4LA 1Q3BA 3HWSA 4B7GA 3K2LA 4I8OA 5EP1A 3J7BA 3WHKA 3GP1A 1ORYB 3KXEC 4IJEA 5H3XA 5FTJA 2ZANA 2M5ZA 3J81S 2YQZA 3WHLA 1DGBA 4EIWA 4D81A 1PM5A 1FJGM 3UGJA 1OFHA 2CEAA 2KXEA 4LRSA 1NY5A 3LVVA 4OW0A 4IIWA 4R3DA 4PDIA 1Z5AA 2UXBM 4L8RC 3A45A 2XH9A 4PD2A 4MGIE 2QPAA 3FYDA 4GMQA 3ZC7B 1TDZA 2JA2A 3AJIB 1IQPA 3D8BA 3AL0C 2XEPA 3CF6E 1D2NA 1JQJC 4X64M 1KYIA 5EP4A 4GHLA 3B9PA 3EIHA 3GLHA 3GPPA 2VQEM 1IY0A 4NRWA 2C99A 4LJAA 5EXSA 4QNRA 3RGPA 4B08A 2D7HA 4OVZA 3T15A 2KZUA 4A3VB 4M9SA 4MGZE 3TQSA 1TGUA 5ITXE 1C1KA 4IJFA 2Z4RA 4DV0M 4LFCM 3J27B 2Z7JA 4JN6A 2DWMA 4LGYA 1IN8A 4JI2M 2EO2A 3GLGB 1XXHB 5FSWA 4IBCA 2QCUA 3SFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU M;  1I94 M;  1L1T A;  2EA0 A;  1XNQ M;  1XMO M;  1IBK M;  3U6E A;  4JI4 M;  1IBL M;  2Q2E B;  2F5P A;  3T1H M;  1HNX M;  4DR6 M;  3U6Q A;  4JI8 M;  4JI7 M;  4DR3 M;  2ZM6 M;  1K3W A;  3TWM A;  1KFV A;  4LF4 M;  3GPY A;  5ITR A;  4B3T M;  3SAS A;  4LF5 M;  3SBJ A;  3GQ5 A;  3C58 A;  3T1Y M;  1Q39 A;  4DV1 M;  5ITX A;  3U6S A;  3U6C A;  4JI6 M;  1XC8 A;  3GQ4 A;  2F5S A;  4DR1 M;  5ITY A;  2F5O A;  1PJJ A;  4K0K M;  1R2Z A;  2OPF A;  1TDH A;  4AQY M;  1Z5B A;  4DV2 M;  5IT9 S;  3U6M A;  4DV5 M;  3GPU A;  1K82 A;  1XNR M;  4JV5 M;  3DOA A;  1NNJ A;  1EE8 A;  3TWK A;  3GO8 A;  4DR5 M;  4X62 M;  5LMN M;  1N33 M;  1MU5 A;  4NXN M;  1L1Z A;  4DV7 M;  1HNZ M;  5ITU A;  4OX9 M;  3GQ3 A;  4LF9 M;  1HNW M;  5FLX S;  2F5N A;  3J80 S;  1Q3C A;  3J7A S;  3OTO M;  1N32 M;  4JI1 M;  2HKJ A;  2UUA M;  2UU9 M;  1Q3B A;  2OQ4 A;  1J5E M;  4X66 M;  5A2Q S;  3A46 A;  4G4Q A;  4JYA M;  2F4V M;  3GP1 A;  3U6O A;  3VK8 A;  4G4R A;  1HR0 M;  5H3X A;  4MB7 A;  1N34 M;  1L2B A;  4LF8 M;  4KHP M;  3SAV A;  1Z5C A;  3W0F A;  2F5Q A;  4B3M M;  3J81 S;  4B3R M;  4PDG A;  1PM5 A;  3JAM S;  1FJG M;  4NRV A;  4PDI A;  4G4N A;  2UXB M;  1Z5A A;  1R2Y A;  1IBM M;  4GKJ M;  4GKK M;  5ITT A;  3A45 A;  4PD2 A;  4X65 M;  4DUZ M;  5ITQ A;  1TDZ A;  1K3X A;  4LF7 M;  4PCZ A;  3A42 A;  2E5L M;  4LF6 M;  4LFB M;  3JR5 A;  4X64 M;  5BR8 M;  4YHH M;  2HHH M;  2UXC M;  3GPP A;  2VQE M;  4NRW A;  1Z59 A;  1L2C A;  4JI0 M;  2ZBK B;  1PJI A;  3U6L A;  3SAR A;  4JI3 M;  4YY3 M;  3VK7 A;  4DR4 M;  4DV6 M;  3TWL A;  5IWA M;  3SAW A;  2UUB M;  4G4O A;  1XMQ M;  4DR7 M;  3U6D A;  5ITX E;  4LFC M;  4DV0 M;  3SAT A;  3U6P A;  2UXD M;  3GPX A;  2XZF A;  4DV3 M;  2UUC M;  1MX0 A;  3JR4 A;  4JI5 M;  4B3S M;  4ITQ A;  4NXM M;  2VQF M;  4LFA M;  4JI2 M;  4DUY M;  2XZU A;  4DR2 M;  3SAU A;  1L2D A;  4CIS A;  1N36 M;  4DV4 M; 
#chains in the Genus database with same CATH topology
 2DAI A;  2DAE A;  1J09 A;  3VDU A;  1R7R A;  2R65 A;  3UJN A;  3KOY E;  1NJF A;  1V33 A;  4HLQ A;  1XMO M;  2DHR A;  2P5T A;  3AOE C;  2L2D A;  3KP0 E;  4HEO A;  2NQ8 C;  2CHQ A;  2FS1 A;  4MGH A;  4IBB A;  2C98 A;  1HNX M;  5KPR A;  2QSF X;  4DR6 M;  3FTD A;  3KVW A;  4JI7 M;  2DAM A;  3GLF B;  2ZM6 M;  4DR3 M;  4G3O A;  3VDP A;  1YUB A;  2QNJ A;  2LBC A;  1KFV A;  1QZM A;  3T38 A;  2EKK A;  1I4W A;  4L15 A;  3GPY A;  1PJS A;  3SAS A;  1DGH A;  3AFH A;  3L2A A;  3C3D A;  4AKH A;  3GQ5 A;  2XGN A;  3HU1 A;  2C5R A;  4GEW A;  3KDS E;  5EXT A;  3GLI B;  1Q39 A;  5ITX A;  1OTR A;  1PJT A;  1LV7 A;  2BJW A;  3RE8 A;  1L8Q A;  1PJQ A;  3D8L A;  2QQ8 A;  3GQ4 A;  1IN6 A;  1GO5 A;  2F5S A;  1KSF X;  2MGW A;  1ZAE A;  3LW5 F;  4FCV A;  2F5O A;  2L7H A;  1YLA A;  2DWL A;  4RNA A;  1E9R A;  4IBD A;  3KW6 A;  1HT1 E;  1NNU C;  4FCW A;  1QAN A;  4FWD A;  4QOS A;  2G8L A;  4Y28 F;  2ZAM A;  1D0L A;  1GLN A;  3CF2 A;  2BNK A;  3TWK A;  1XXH E;  4LJ4 A;  3VLF B;  2YFQ A;  4JXJ A;  1HQC A;  3L25 A;  1SXJ E;  4GH9 A;  4NXN M;  4DV7 M;  3HJQ A;  5KPT A;  2EJS A;  5ITU A;  1FNN A;  3M7G A;  4BBA A;  3U60 B;  4OX9 M;  1X37 A;  2HCB A;  3GPU A;  2W82 A;  2R46 A;  2CHG A;  2D7G A;  3SMS A;  1GL6 A;  1GJS A;  1Q3C A;  2LXE A;  2BWE A;  3OTO M;  3FTF A;  1N32 M;  4FVM A;  2DZO B;  2UUA M;  1JR3 D;  3FE3 A;  4AZF A;  2HL7 A;  2WZJ A;  2K6B A;  2OQ4 A;  5A2Q S;  3A46 A;  1J5E M;  2JY5 A;  4I5S A;  3A98 B;  2DWN A;  1DV0 A;  3K92 A;  4MM3 B;  4G4R A;  1HR0 M;  1VG5 A;  2LVQ D;  1OFI A;  1PGY A;  2EUC A;  3IEC A;  4MB7 A;  1R5L A;  3FYC A;  2I7N A;  2VDB B;  2XSZ A;  3NWL A;  4LZJ A;  1L2B A;  1HT2 E;  3W0F A;  5KQ8 A;  3SAV A;  1HJP A;  2LVN C;  3NBX X;  1G4A E;  3K9P A;  4NRV A;  4FCT A;  4CJ6 A;  4M9Z A;  1XXH A;  3MMP A;  5FTM A;  2XF3 A;  4GKK M;  4RF1 A;  1SXJ A;  2X8A A;  4X65 M;  4G6Z A;  1WGL A;  2KEB A;  4LRT A;  4MGY E;  2LHC A;  4LF7 M;  4PCZ A;  2LVA A;  3A42 A;  2DWZ B;  3U61 B;  4IBC A;  1OKS A;  3FUW A;  1VDD A;  4NC6 A;  3U5Z B;  3JR5 A;  2E5L M;  3H4M A;  4LF6 M;  2LNH C;  4QHT A;  4LFB M;  1NJG A;  3HX3 A;  2DI0 A;  1A5T A;  1TH4 A;  4XGI A;  2G3Q A;  1Q02 A;  4M0W A;  2AHM A;  3K8Z A;  5JI3 E;  1GKI A;  2L6O A;  4JI3 M;  4YY3 M;  2CV2 A;  2DKL A;  5IWA M;  2LWX A;  2UUB M;  2MJ5 B;  2R6F A;  2EKF A;  5EP2 A;  3FD9 A;  3KSJ A;  1JB0 F;  1OAO C;  1V34 A;  4JI5 M;  2Y20 A;  3JR4 A;  4I81 A;  2R62 A;  5DNY A;  4ITQ A;  4QOZ C;  2KNZ A;  1QAO A;  2ZTC A;  4LY6 A;  1WJ7 A;  4Z8X A;  3HJS A;  4UN2 B;  2XZU A;  1L2D A;  4LJ6 A;  2YR0 A;  2X49 A;  2O5R A;  1GAB A;  2EA0 A;  1XNQ M;  1XB2 B;  2GQF A;  3R9X B;  4JI4 M;  3DZD A;  4M9X A;  2Q2E B;  1NY6 A;  3VKH A;  3QYE A;  1CUK A;  4RF0 A;  3CF0 A;  3IG8 A;  1IXS B;  1WIV A;  3U6Q A;  5H37 D;  1XWI A;  3KOX E;  1QZE A;  3B7Z A;  2VF8 A;  1QAM A;  4B7H A;  5ITR A;  2LH0 A;  1G3I A;  2Y0T A;  3SBJ A;  2LHG A;  1IFY A;  2CE7 A;  2JNH A;  5E26 A;  3FRI A;  1IXR C;  3Q8X A;  3TE6 A;  3B7Q A;  2N35 A;  1J7K A;  2X4A A;  1ZMU A;  3PFI A;  2LVP C;  1W5T A;  2C9C A;  3LMM A;  5E6J A;  5EXP A;  4DR1 M;  3TPZ A;  3M0E A;  2D7E A;  2JXN A;  4KO8 A;  4L4U A;  1PJJ A;  1EIJ A;  3RFW A;  1NO1 A;  2R4E A;  2OPF A;  2FE8 A;  4P16 A;  4DV2 M;  3HHX A;  3U6M A;  1K82 A;  5EP3 A;  3HHY A;  1XNR M;  1EE8 A;  4X62 M;  1MU5 A;  2Y0Q A;  1RU3 A;  3U61 A;  5FTL A;  3GQ3 A;  2CV1 A;  2R18 A;  2OO9 A;  5EQT A;  3J80 S;  3J7A S;  3HJ8 A;  5BPV A;  2MRO B;  4LJ8 A;  2Z3X A;  3HU2 A;  2HKJ A;  5C18 A;  4JI1 M;  2UU9 M;  4II7 A;  4FW9 A;  4ZPX A;  4AG5 A;  3HY5 A;  4G4Q A;  4JYA M;  4S12 A;  2OOA A;  2CUZ A;  2DXI A;  2F4V M;  3H4J A;  2JZ0 A;  2L4E A;  3KFU G;  1NV8 A;  4IBI A;  4NSO B;  4OU7 A;  1N34 M;  4LF8 M;  4KHP M;  5F3W A;  1Z5C A;  2F5Q A;  1T6O A;  1GJT A;  2CWB A;  4B3R M;  3MJ5 A;  2DVW B;  1QAQ A;  2APL A;  4WW0 A;  4HL4 A;  2Z4S A;  3AOE A;  4GRI A;  3JAM S;  1QDR A;  3ZH9 B;  2CHV A;  3HU3 A;  4D82 A;  1IBM M;  2DHY A;  2KA6 B;  2JP7 A;  2R44 A;  4XBO A;  4GKJ M;  3PNY A;  2QZ4 A;  3SC3 A;  5ITQ A;  2JUJ A;  1S3S A;  1QQW A;  4TUW A;  4GIP A;  3E21 A;  3GLF E;  1SG9 A;  1G59 A;  4AI6 A;  2H1R A;  2K0B X;  4GC5 A;  5KO3 A;  4YHH M;  2HHH M;  3B89 A;  3NBI A;  3GLI E;  3RGS A;  1VDL A;  1YE9 A;  1G8P A;  2JY8 A;  2WSC F;  3UK6 A;  3SAR A;  4DR4 M;  3GLH B;  2ZAO A;  4DV6 M;  3TWL A;  3R8F A;  3SAW A;  3THG A;  4G4O A;  4AW4 A;  1XMQ M;  3I04 M;  1QHK A;  2MR9 A;  4QNM A;  2J5Y A;  4OVZ B;  3GLG A;  1LTM A;  2G5G X;  3HGI A;  2UUC M;  1MX0 A;  2FNA A;  2VQF M;  4LFA M;  2DAK A;  5DFL A;  1BVS A;  3ZCB B;  3SYL A;  1DO2 A;  4DUY M;  5EXX A;  1C7Y A;  1WXQ A;  1IY2 A;  4DR2 M;  3SAU A;  1V92 A;  4PT5 A;  4CIS A;  3FTE A;  1PJI A;  5GKN A;  3W68 A;  1H6U A;  1HQY E;  2DAG A;  3GLF A;  3QWL A;  3I4V A;  1UFZ A;  2KNA A;  3ZQJ A;  3M6A A;  2VII A;  2QBY B;  1IM2 A;  1GVN A;  4GHA A;  1E32 A;  3T1H M;  4LJ9 A;  3DA1 A;  3GLI A;  2MH8 A;  4L16 A;  4IBE A;  1UM8 A;  2FOI C;  3HHZ A;  3SHF A;  1E9S A;  2ZTD A;  3C9P A;  4B3T M;  2H5X A;  3MHV C;  1N75 A;  1VEK A;  3C58 A;  3T1Y M;  2QBY A;  2L09 A;  4LZZ A;  4IBF A;  3GRV A;  2CFO A;  4WP2 A;  4AKG A;  8CAT A;  1TH2 A;  1QUS A;  1DGH B;  2K47 A;  1DGG A;  3FRH A;  5FTN A;  4DV4 M;  4LG2 A;  4CHT B;  5ITY A;  3QYB A;  2JY7 A;  2XSZ D;  4GC9 A;  3QAU A;  1R2Z A;  3DFZ A;  1TDH A;  3U60 A;  5EJC A;  5IT9 S;  1OAI A;  4M0D A;  3TL4 X;  5KPZ A;  4Z6Y A;  1T3T A;  3DOA A;  2K9D A;  4KLN A;  2LTU A;  3GO8 A;  4DR5 M;  2HWJ A;  5LMN M;  3C3E A;  4AG6 A;  2KHH A;  4IBK A;  1L1Z A;  1HNZ M;  1SXJ D;  1N33 M;  3GRU A;  4MH0 E;  2XFS A;  3UMM A;  1E94 E;  1EFU B;  2V1C A;  3FTC A;  3VKG A;  3KSX A;  4LF9 M;  2KRU A;  4REZ A;  3L26 A;  2I7P A;  2L7I A;  3J2P B;  1JR3 E;  2RKO A;  3HHW A;  3FUV A;  3MK6 A;  1N77 A;  4X66 M;  4CIZ A;  3BSU A;  3GRR A;  3PNV A;  3AKZ A;  2RGO A;  3U6O A;  3VK8 A;  2KRK A;  5L8R F;  1QVR A;  1IN5 A;  2B3T A;  3L28 A;  3GLG E;  1MN3 A;  2KZS A;  3LQQ A;  1TH3 A;  3KOZ E;  5JI2 E;  4B3M M;  1N78 A;  1IXZ A;  4PDG A;  2DZN B;  2V6Z M;  2QHO B;  3KS4 A;  4G4N A;  1AIP C;  4D80 A;  2M60 A;  1R2Y A;  4IBJ A;  2KDL A;  3U5Z A;  3IG5 A;  5ITT A;  1NHG C;  4DUZ M;  7CAT A;  2J7O A;  4AKI A;  3W0L B;  1K3X A;  2C9O A;  1IY1 A;  2ERC A;  1MJG M;  3FUU A;  1R6B X;  3SMP A;  2WSE F;  1XHB A;  1ZMW A;  3ILK A;  1SXJ B;  5BR8 M;  4LCB A;  2UXC M;  1JR3 A;  3FUX A;  3GRY A;  1IN7 A;  1Z59 A;  3L27 A;  1L2C A;  3FKE A;  4JI0 M;  2XLJ A;  2ZBK B;  4IBG A;  3CGW A;  4RKU F;  3U6L A;  3FUT A;  4W5W A;  2GNO A;  3V76 A;  3VK7 A;  5IRE B;  4XK8 F;  3E9S A;  5FTK A;  3K1J A;  3LVW A;  4F1I A;  1DO0 A;  1WR1 B;  4DR7 M;  3I4Y A;  3U6D A;  1OJL A;  3SAT A;  2R45 A;  3U6P A;  2WSF F;  2UXD M;  3E4R A;  4NSR A;  5DYI A;  4BB9 A;  4NOO B;  4R7G A;  4CGY B;  3GPX A;  4DV3 M;  2XZF A;  4B3S M;  1ZMV A;  3PVS A;  1VEJ A;  1G41 A;  3T6P A;  5IZ7 D;  4NXM M;  4Q7J A;  3KP1 E;  5KQD A;  4KOD A;  2YNM D;  4FWH A;  3SHG B;  1NSF A;  4MGK E;  1N36 M;  4WUR A;  3VFD A;  3SYK A;  1IXS A;  5LMU M;  1I94 M;  1AUA A;  3L29 A;  1L1T A;  2Y21 A;  4B7F A;  3I51 A;  3U6E A;  1R4G A;  1IBK M;  1IBL M;  2F5P A;  3BBZ A;  2FFJ A;  4FD2 A;  4ANR A;  4LJ5 A;  1NVM A;  5DYG A;  3CTW B;  1VQ1 A;  2KW0 A;  4JI8 M;  5C1B A;  2OOB A;  1K3W A;  1SXJ C;  3W67 A;  3TWM A;  1W5S A;  4LF4 M;  3UZU A;  1IN4 A;  3LQR A;  4LF5 M;  1NHW C;  2J7N A;  4LGM A;  1GL7 A;  3HKP A;  1Z6T A;  4DV1 M;  2QEN A;  3AOG A;  3U6S A;  3U6C A;  1XC8 A;  2V1U A;  4JI6 M;  1TR8 A;  4GIT A;  3BOS A;  2BJV A;  4NL4 H;  1QDT A;  2CV0 A;  2QP9 X;  4LJ7 A;  3PXG A;  1ZQ9 A;  2O01 F;  4BLC A;  4K0K M;  2XFT A;  4AQY M;  1Z5B A;  4L78 A;  1QYR A;  4DV5 M;  1OIZ A;  2RGH A;  4JV5 M;  2CP8 A;  1ZV1 A;  4QHS A;  1NNJ A;  1WGN A;  4FWG A;  3EIE A;  1YSY A;  3KS8 A;  3AV0 A;  1DGF A;  1OQY A;  2A5Y B;  2VF7 A;  2LVO C;  3GIT A;  2C96 A;  1HNW M;  2R4J A;  5FLX S;  2F5N A;  3E46 A;  3KOW E;  2R0I A;  3Q8G A;  3GLH E;  4I4L A;  3BL4 A;  1Q3B A;  3HWS A;  1D0M A;  4KT0 F;  2RRU A;  3K2L A;  4L6V 6;  4B7G A;  4DBG B;  4I8O A;  5EP1 A;  1T43 A;  3J7B A;  3WHK A;  1WHC A;  3GP1 A;  1ORY B;  3KXE C;  4IJE A;  1P3Q Q;  3HZJ A;  5H3X A;  5FTJ A;  4F2L A;  1F4I A;  3B7N A;  1G71 A;  2DZL A;  2ZAN A;  1OIP A;  2M5Z A;  3IHP A;  3J81 S;  2YQZ A;  3WHL A;  1DGB A;  4EIW A;  4D81 A;  1PM5 A;  1FJG M;  3UGJ A;  1OFH A;  2CEA A;  2KXE A;  4LRS A;  1NY5 A;  3LVV A;  2DEN A;  4IIW A;  4OW0 A;  4R3D A;  1Z5A A;  4PDI A;  2UXB M;  4L8R C;  3A45 A;  2XH9 A;  4PD2 A;  2HAK A;  4MGI E;  3F92 A;  2QPA A;  3FYD A;  4GMQ A;  3ZC7 B;  1TDZ A;  1D0K A;  2JA2 A;  3AJI B;  1IQP A;  3D8B A;  3AL0 C;  2CRU A;  2XEP A;  3CF6 E;  1D2N A;  1JQJ C;  4X64 M;  1KYI A;  5EP4 A;  4GHL A;  1TTE A;  3B9P A;  3EIH A;  3GLH A;  2L4F A;  3GPP A;  2VQE M;  1IY0 A;  2FH0 A;  4P17 A;  4NRW A;  2C99 A;  4LJA A;  5EXS A;  4QNR A;  3RGP A;  1Y8G A;  4B08 A;  3LCV B;  2D7H A;  4OVZ A;  3T15 A;  2KZU A;  4A3V B;  4M9S A;  2JZ1 A;  3B74 A;  3K9O A;  4MGZ E;  3TQS A;  2BWB A;  1TGU A;  2JY6 B;  5ITX E;  1C1K A;  1PRB A;  2Z4R A;  3BXW A;  4IJF A;  4DV0 M;  4LFC M;  1TF0 B;  3I01 M;  3J27 B;  3PMQ A;  2JWS A;  2Z7J A;  4JN6 A;  2DWM A;  1QUT A;  2O25 A;  1NV9 A;  3LCU A;  1VEG A;  4LGY A;  2DNA A;  1IN8 A;  4JI2 M;  2EO2 A;  3GLG B;  2Z8Y M;  4R71 A;  1XXH B;  5FSW A;  2KNV A;  2QCU A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 1J09 A;  3VDU A;  1R7R A;  2R65 A;  3UJN A;  3KOY E;  1NJF A;  4HLQ A;  1XMO M;  2DHR A;  2P5T A;  3AOE C;  3KP0 E;  2NQ8 C;  2CHQ A;  4MGH A;  4IBB A;  2C98 A;  1HNX M;  5KPR A;  4DR6 M;  3FTD A;  3KVW A;  4JI7 M;  3GLF B;  2ZM6 M;  4DR3 M;  3VDP A;  1YUB A;  1KFV A;  1QZM A;  3T38 A;  1I4W A;  4L15 A;  3GPY A;  3SAS A;  1DGH A;  3AFH A;  3L2A A;  4AKH A;  3GQ5 A;  2XGN A;  3HU1 A;  2C5R A;  3KDS E;  5EXT A;  3GLI B;  1Q39 A;  5ITX A;  1LV7 A;  2BJW A;  3RE8 A;  1L8Q A;  3D8L A;  3GQ4 A;  1IN6 A;  2F5S A;  1KSF X;  1ZAE A;  2F5O A;  4FCV A;  2L7H A;  2DWL A;  4RNA A;  1E9R A;  4IBD A;  3KW6 A;  1HT1 E;  1NNU C;  4FCW A;  1QAN A;  4FWD A;  4QOS A;  2G8L A;  5E6J A;  2ZAM A;  1GLN A;  3GPU A;  3CF2 A;  2BNK A;  3TWK A;  3VLF B;  4LJ4 A;  3L25 A;  2YFQ A;  4JXJ A;  1HQC A;  1SXJ E;  4GH9 A;  4NXN M;  4DV7 M;  3HJQ A;  5KPT A;  5ITU A;  1FNN A;  3M7G A;  4BBA A;  3U60 B;  4OX9 M;  1X37 A;  2HCB A;  2W82 A;  2R46 A;  2CHG A;  2D7G A;  3SMS A;  1GL6 A;  1Q3C A;  2LXE A;  3OTO M;  3FTF A;  1N32 M;  4FVM A;  2DZO B;  2UUA M;  1JR3 D;  4AZF A;  2HL7 A;  2OQ4 A;  1J5E M;  5A2Q S;  3A46 A;  4I5S A;  3A98 B;  2DWN A;  3K92 A;  4MM3 B;  4G4R A;  1HR0 M;  1OFI A;  2EUC A;  4MB7 A;  3FYC A;  2I7N A;  4LZJ A;  2XSZ A;  3NWL A;  1L2B A;  1HT2 E;  3W0F A;  5KQ8 A;  3SAV A;  1G4A E;  4NRV A;  4FCT A;  4M9Z A;  1XXH A;  5FTM A;  4GKK M;  2XF3 A;  4RF1 A;  1SXJ A;  2X8A A;  4X65 M;  4G6Z A;  4LRT A;  2KEB A;  4MGY E;  4LF7 M;  4PCZ A;  3A42 A;  2DWZ B;  3U61 B;  3FUW A;  1VDD A;  3U5Z B;  2E5L M;  3JR5 A;  4LF6 M;  3H4M A;  4LFB M;  2LNH C;  4QHT A;  1NJG A;  1TH4 A;  4XGI A;  4M0W A;  2AHM A;  3K8Z A;  5JI3 E;  1GKI A;  2L6O A;  4JI3 M;  4YY3 M;  2CV2 A;  5IWA M;  2LWX A;  2UUB M;  5EP2 A;  3FD9 A;  3KSJ A;  4JI5 M;  2Y20 A;  3JR4 A;  4I81 A;  2R62 A;  5DNY A;  4ITQ A;  4QOZ C;  1QAO A;  4LY6 A;  4Z8X A;  3HJS A;  2XZU A;  1L2D A;  4LJ6 A;  2YR0 A;  2X49 A;  2O5R A;  2EA0 A;  1XNQ M;  3R9X B;  4JI4 M;  3DZD A;  4M9X A;  2Q2E B;  1NY6 A;  3VKH A;  4RF0 A;  3CF0 A;  3IG8 A;  1IXS B;  3U6Q A;  5H37 D;  1XWI A;  3KOX E;  1QAM A;  4B7H A;  5ITR A;  2LH0 A;  1G3I A;  2Y0T A;  3SBJ A;  2CE7 A;  5E26 A;  1IXR C;  3Q8X A;  3TE6 A;  1J7K A;  2X4A A;  3PFI A;  1W5T A;  2C9C A;  3LMM A;  5EXP A;  4DR1 M;  3TPZ A;  3M0E A;  2D7E A;  4KO8 A;  4L4U A;  1PJJ A;  3RFW A;  2R4E A;  2OPF A;  2FE8 A;  4P16 A;  4DV2 M;  3HHX A;  3U6M A;  1K82 A;  5EP3 A;  3HHY A;  1XNR M;  1EE8 A;  4X62 M;  1MU5 A;  2Y0Q A;  2CV1 A;  3U61 A;  5FTL A;  3GQ3 A;  2R18 A;  5EQT A;  3J80 S;  3J7A S;  3HJ8 A;  5BPV A;  4LJ8 A;  2Z3X A;  3HU2 A;  2HKJ A;  5C18 A;  4JI1 M;  2UU9 M;  4II7 A;  4FW9 A;  4ZPX A;  4AG5 A;  4G4Q A;  4JYA M;  4S12 A;  2CUZ A;  2DXI A;  2F4V M;  3KFU G;  4IBI A;  4NSO B;  4OU7 A;  1N34 M;  4LF8 M;  4KHP M;  5F3W A;  1Z5C A;  2F5Q A;  4B3R M;  3MJ5 A;  2DVW B;  1QAQ A;  4WW0 A;  3JAM S;  4HL4 A;  2Z4S A;  3AOE A;  4GRI A;  3ZH9 B;  2CHV A;  3HU3 A;  4D82 A;  1IBM M;  4XBO A;  2KA6 B;  4GKJ M;  3PNY A;  2QZ4 A;  3SC3 A;  5ITQ A;  1S3S A;  1QQW A;  4TUW A;  4GIP A;  1G59 A;  4AI6 A;  2H1R A;  4GC5 A;  5KO3 A;  4YHH M;  2HHH M;  3NBI A;  3RGS A;  1YE9 A;  1G8P A;  3UK6 A;  3SAR A;  4DR4 M;  3GLH B;  2ZAO A;  4DV6 M;  3TWL A;  3R8F A;  3SAW A;  3THG A;  4G4O A;  4AW4 A;  1XMQ M;  4QNM A;  4OVZ B;  3GLG A;  2G5G X;  3HGI A;  2UUC M;  1MX0 A;  2FNA A;  2VQF M;  4LFA M;  3ZCB B;  3SYL A;  1DO2 A;  4DUY M;  5EXX A;  1WXQ A;  1IY2 A;  4DR2 M;  3SAU A;  4CIS A;  4PT5 A;  3FTE A;  1PJI A;  5GKN A;  1H6U A;  1HQY E;  3GLF A;  3QWL A;  3I4V A;  3M6A A;  2VII A;  2QBY B;  1IM2 A;  1GVN A;  4GHA A;  1E32 A;  3T1H M;  4LJ9 A;  3DA1 A;  3GLI A;  4L16 A;  4IBE A;  1UM8 A;  2FOI C;  3HHZ A;  3SHF A;  1E9S A;  4B3T M;  3MHV C;  1N75 A;  3C58 A;  3T1Y M;  2QBY A;  2L09 A;  4LZZ A;  4IBF A;  3GRV A;  2CFO A;  4AKG A;  8CAT A;  1TH2 A;  1DGH B;  2K47 A;  1DGG A;  5FTN A;  4DV4 M;  4LG2 A;  4CHT B;  5ITY A;  4GC9 A;  2XSZ D;  3QAU A;  1R2Z A;  3DFZ A;  1TDH A;  3U60 A;  5EJC A;  5IT9 S;  4M0D A;  3TL4 X;  5KPZ A;  4Z6Y A;  1T3T A;  3DOA A;  4KLN A;  3GO8 A;  4DR5 M;  5LMN M;  4AG6 A;  1N33 M;  1L1Z A;  4IBK A;  1HNZ M;  1SXJ D;  3GRU A;  4MH0 E;  2XFS A;  3UMM A;  1E94 E;  2V1C A;  3FTC A;  3VKG A;  3KSX A;  4LF9 M;  2KRU A;  4REZ A;  3L26 A;  2I7P A;  2L7I A;  3J2P B;  2RKO A;  3HHW A;  3FUV A;  3MK6 A;  1N77 A;  4X66 M;  3GRR A;  3PNV A;  3AKZ A;  2RGO A;  3U6O A;  3VK8 A;  2KRK A;  1QVR A;  1IN5 A;  3L28 A;  2KZS A;  3LQQ A;  1TH3 A;  3KOZ E;  5JI2 E;  4B3M M;  1N78 A;  1IXZ A;  4PDG A;  2DZN B;  2V6Z M;  3KS4 A;  4G4N A;  4D80 A;  2M60 A;  1R2Y A;  4IBJ A;  3U5Z A;  3IG5 A;  5ITT A;  1NHG C;  4DUZ M;  7CAT A;  2J7O A;  4AKI A;  3W0L B;  1K3X A;  2C9O A;  1IY1 A;  2ERC A;  3FUU A;  3SMP A;  1R6B X;  1XHB A;  5BR8 M;  3ILK A;  1SXJ B;  4LCB A;  2UXC M;  1JR3 A;  3FUX A;  3GRY A;  1IN7 A;  1Z59 A;  3L27 A;  1L2C A;  3FKE A;  4JI0 M;  2XLJ A;  2ZBK B;  4IBG A;  3U6L A;  3FUT A;  4W5W A;  3VK7 A;  5IRE B;  3E9S A;  5FTK A;  3K1J A;  3LVW A;  1DO0 A;  4DR7 M;  3I4Y A;  3U6D A;  1OJL A;  3SAT A;  2R45 A;  3U6P A;  2UXD M;  3E4R A;  4NSR A;  5DYI A;  4BB9 A;  4NOO B;  4R7G A;  4CGY B;  3GPX A;  4DV3 M;  2XZF A;  4B3S M;  3PVS A;  4NXM M;  1G41 A;  5IZ7 D;  3KP1 E;  5KQD A;  4KOD A;  2YNM D;  4FWH A;  3SHG B;  1NSF A;  4MGK E;  1N36 M;  4WUR A;  3VFD A;  3SYK A;  5LMU M;  1I94 M;  3L29 A;  1L1T A;  2Y21 A;  4B7F A;  3I51 A;  3U6E A;  1IBK M;  1IBL M;  2F5P A;  2FFJ A;  4FD2 A;  4LJ5 A;  1NVM A;  5DYG A;  3CTW B;  2KW0 A;  4JI8 M;  5C1B A;  1K3W A;  1SXJ C;  3TWM A;  1W5S A;  4LF4 M;  3UZU A;  1IN4 A;  3LQR A;  4LF5 M;  1NHW C;  2J7N A;  4LGM A;  1GL7 A;  3HKP A;  1Z6T A;  4DV1 M;  2QEN A;  3AOG A;  3U6S A;  3U6C A;  1XC8 A;  2V1U A;  4JI6 M;  4GIT A;  3BOS A;  2BJV A;  4NL4 H;  2CV0 A;  2QP9 X;  4LJ7 A;  3PXG A;  1ZQ9 A;  4BLC A;  4K0K M;  2XFT A;  4AQY M;  1Z5B A;  4L78 A;  1QYR A;  4DV5 M;  2RGH A;  4JV5 M;  4QHS A;  1NNJ A;  4FWG A;  3EIE A;  1YSY A;  3KS8 A;  3AV0 A;  1DGF A;  2A5Y B;  2C96 A;  1HNW M;  2R4J A;  5FLX S;  2F5N A;  3KOW E;  4I4L A;  1Q3B A;  3HWS A;  4B7G A;  3K2L A;  4I8O A;  5EP1 A;  3J7B A;  3WHK A;  3GP1 A;  1ORY B;  3KXE C;  4IJE A;  5H3X A;  5FTJ A;  2ZAN A;  2M5Z A;  3J81 S;  2YQZ A;  3WHL A;  1DGB A;  4EIW A;  4D81 A;  1PM5 A;  1FJG M;  3UGJ A;  1OFH A;  2CEA A;  2KXE A;  4LRS A;  1NY5 A;  3LVV A;  4OW0 A;  4IIW A;  4R3D A;  4PDI A;  1Z5A A;  2UXB M;  4L8R C;  3A45 A;  2XH9 A;  4PD2 A;  4MGI E;  2QPA A;  3FYD A;  4GMQ A;  3ZC7 B;  1TDZ A;  2JA2 A;  3AJI B;  1IQP A;  3D8B A;  3AL0 C;  2XEP A;  3CF6 E;  1D2N A;  1JQJ C;  4X64 M;  1KYI A;  5EP4 A;  4GHL A;  3B9P A;  3EIH A;  3GLH A;  3GPP A;  2VQE M;  1IY0 A;  4NRW A;  2C99 A;  4LJA A;  5EXS A;  4QNR A;  3RGP A;  4B08 A;  2D7H A;  4OVZ A;  3T15 A;  2KZU A;  4A3V B;  4M9S A;  4MGZ E;  3TQS A;  1TGU A;  5ITX E;  1C1K A;  4IJF A;  2Z4R A;  4DV0 M;  4LFC M;  3J27 B;  2Z7J A;  4JN6 A;  2DWM A;  4LGY A;  1IN8 A;  4JI2 M;  2EO2 A;  3GLG B;  1XXH B;  5FSW A;  4IBC A;  2QCU A;  3SFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...