3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen binding protein
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Protein binding
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
4JV5M 3U6EA 4NXNM 1HNXM 4DR1M 3SAWA 5ITTA 2F4VM 1HNWM 5ITXA 1L1ZA 3U6QA 2F5PA 3GPXA 4LF8M 4X64M 1Q3BA 2UXBM 4AQYM 4NRVA 3C58A 1L2BA 4B3MM 1MU5A 1Q39A 4DR3M 1R2ZA 2OPFA 1J5EM 3J80S 5LMNM 3SASA 1XMQM 1N34M 3TWLA 3A45A 4X62M 2XZUA 2UXDM 4X66M 4DR2M 4KHPM 4LF5M 4JI0M 4LFCM 4JI6M 1TDZA 3U6SA 4LF9M 2Q2EB 3A42A 4DR5M 2VQFM 3GPYA 4JI7M 2EA0A 3J7AS 3SATA 1IBKM 5LMUM 3VK7A 3OTOM 1Q3CA 1FJGM 2UUCM 1N33M 4K0KM 4PDIA 1EE8A 1Z59A 1TDHA 4DV2M 2HHHM 2UUAM 2E5LM 3GPPA 1PM5A 4OX9M 1K3XA 5ITUA 4JI2M 3J81S 2VQEM 5IWAM 5ITQA 4DV3M 4JI3M 3A46A 3TWKA 4DV4M 4DV7M 3SARA 1XMOM 3VK8A 5A2QS 1NNJA 5BR8M 4GKKM 1PJIA 4JI5M 4PCZA 2F5NA 4G4RA 4DV1M 3U6PA 2UU9M 1Z5CA 3GQ4A 2HKJA 3U6DA 4JI1M 2F5SA 3JAMS 1K82A 3T1YM 3GQ3A 3SAVA 1L2DA 4JYAM 3T1HM 2UUBM 4DR4M 3GQ5A 4G4QA 1XC8A 4GKJM 4JI4M 5H3XA 5IT9S 4DV6M 4DV5M 1Z5BA 1L2CA 4DR7M 3U6CA 4CISA 1N32M 3DOAA 4LF6M 1XNRM 4LF7M 3U6LA 4ITQA 4MB7A 3SAUA 1Z5AA 1N36M 4DUZM 3TWMA 5ITYA 3GP1A 4JI8M 3GO8A 4B3TM 4YHHM 1HNZM 3JR4A 4DR6M 1R2YA 5ITRA 4PDGA 1KFVA 1L1TA 2F5OA 1XNQM 3JR5A 4DUYM 3U6MA 2ZBKB 1IBLM 2ZM6M 1I94M 3GPUA 4G4NA 1K3WA 2UXCM 3W0FA 5ITXE 4LFBM 2OQ4A 3U6OA 1MX0A 4G4OA 4PD2A 1IBMM 4LFAM 2XZFA 4B3RM 5FLXS 4X65M 3SBJA 1HR0M 4YY3M 2F5QA 4NRWA 4B3SM 1PJJA 4LF4M 4NXMM 4DV0M
chains in the Genus database with same CATH superfamily
1R5LA 5EQTA 4LJ6A 5F3WA 3SAWA 4LJ5A 2F4VM 1HNWM 2F5PA 2KHHA 3FYCA 1NY6A 1QAMA 2KA6B 1Q3BA 3BOSA 2LVNC 2I7PA 3NBXX 4NRVA 2UXBM 3C3EA 1L2BA 1MU5A 1L8QA 1OTRA 4L6V6 5DYIA 4L4UA 2W82A 3SASA 4HLQA 2K6BA 2BWBA 4ZPXA 4M9SA 3AL0C 5L8RF 3K1JA 4FVMA 4JI0M 4LF5M 1D0MA 4JI6M 3LVVA 4LFCM 5FTKA 2R18A 3PNYA 1PJSA 2OOAA 3HU2A 1IXSB 2Y20A 3DFZA 4DR5M 1C7YA 1QAQA 1Y8GA 3VDPA 5LMUM 3TE6A 3VK7A 3W0LB 3LQQA 2X8AA 1W5SA 2ZTCA 3E9SA 3QAUA 4I5SA 4OU7A 1EE8A 4IBGA 1Z59A 4EIWA 3HKPA 3VKGA 3RE8A 3BSUA 5DYGA 1VG5A 1QDTA 2UUAM 2H1RA 4OX9M 3WHKA 3BBZA 1K3XA 2LH0A 4MM3B 1N75A 3AV0A 5C1BA 3MJ5A 2RGOA 3SC3A 3LQRA 2Z7JA 4MGYE 2MJ5B 2R62A 4DV4M 2NQ8C 3LMMA 3ZQJA 5BR8M 4IIWA 1GL7A 3IG5A 4JI5M 2R4JA 1DGGA 4QHTA 2O25A 2UU9M 1Z5CA 1KYIA 2EJSA 4L16A 1OQYA 4I8OA 4LZZA 4MGIE 4UN2B 3KW6A 3U6DA 4JI1M 2CFOA 4I81A 2CEAA 1IXRC 1DGHA 1G8PA 2R0IA 2DVWB 2WSCF 3I01M 4PT5A 2QQ8A 2QSFX 3PXGA 3ZCBB 3T1HM 3GQ5A 4GKJM 4JI4M 4QHSA 1JR3A 2CWBA 2R45A 3TQSA 4DV6M 2DAKA 3HX3A 3J27B 5IREB 4W5WA 4B7HA 3SHFA 5FTNA 3U6CA 1N32M 3CF6E 1YE9A 2XEPA 3K92A 3GLIA 2QENA 3U6LA 1WGLA 4M9ZA 1F4IA 1PRBA 4MB7A 2J7OA 1TH4A 2DI0A 4NSOB 1S3SA 3GLFA 3KFUG 2D7EA 5EXPA 3GP1A 4FWHA 3GO8A 2DAEA 1IY0A 2CV1A 2KXEA 2M60A 4JXJA 4LJAA 1R2YA 4IBIA 3NBIA 4D81A 4DUYM 1NHWC 1NJGA 1D0KA 2L09A 4RF1A 4CHTB 4REZA 3W0FA 2CP8A 4AG5A 1VQ1A 4G4NA 3K9PA 4LFBM 1ZMUA 2FH0A 2OQ4A 2YR0A 2MROB 3W68A 1MX0A 2P5TA 1TF0B 2Z8YM 4S12A 4LFAM 1PGYA 3KOZE 3VFDA 3U61A 3QYEA 3KSXA 4FCTA 1R4GA 4CIZA 3UJNA 5FLXS 2J5YA 4GH9A 1JB0F 1A5TA 1JR3D 1VDLA 2L7IA 2ZANA 3FUWA 5BPVA 4QNMA 4IBCA 4IBFA 1QDRA 2CRUA 2XFTA 3HY5A 1PJJA 4IBBA 4HEOA 2L6OA 3B89A 1LV7A 3L2AA 2MH8A 3UZUA 4DV0M 4AW4A 1G59A 1DGFA 1OIZA 2LNHC 1VEGA 3FUUA 5ITTA 4DR1M 2QNJA 4OW0A 1T43A 3KS4A 3U6QA 2JUJA 2J7NA 4A3VB 1L1ZA 1G41A 2XFSA 4IBKA 4X64M 4LF8M 1WGNA 2N35A 3SYLA 4B3MM 2ERCA 1VDDA 1R2ZA 3F92A 2VIIA 1J5EM 1OFIA 4M0WA 2C98A 2CHQA 1CUKA 1DO0A 1E9SA 3GLHB 3KXEC 4R3DA 2XZUA 2UXDM 1H6UA 3AOEA 1OFHA 1MJGM 1ZAEA 1ZMVA 4M0DA 1TDZA 4FD2A 3U6SA 1XXHB 1IN7A 4IJEA 2DWMA 2FE8A 3KS8A 2DHRA 3C9PA 3GPYA 2DZLA 2DAIA 3SATA 1IBKM 4G3OA 1HT1E 1KSFX 1E9RA 1Q3CA 2EKFA 1VEJA 3GITA 4LJ7A 1TDHA 5E6JA 2LTUA 2GQFA 2FNAA 1BVSA 2ZAMA 3GPPA 1MN3A 5ITUA 2QP9X 3EIHA 1QANA 1IXSA 3RGSA 2VQEM 3GLHE 5IWAM 4DV3M 2AHMA 3GRYA 2LXEA 4JI3M 1YLAA 1SXJE 1JQJC 3I51A 3EIEA 3FYDA 1XXHE 3BL4A 1NNJA 5DNYA 5DFLA 4GKKM 3TL4X 4PCZA 1IM2A 4P16A 3MMPA 2KNAA 2KW0A 4DV1M 1UM8A 1T6OA 1R7RA 1TGUA 2Z4RA 3HJQA 4XGIA 1GL6A 1NO1A 2R46A 1NNUC 2LVQD 3KDSE 3AOEC 4I4LA 3GRRA 3UGJA 3KP0E 3SAVA 2EKKA 2A5YB 4LRTA 2UUBM 4AKGA 2FFJA 4DR4M 1XC8A 1PJQA 1WHCA 2L4EA 1TH2A 4DBGB 4GHLA 2DZOB 3U5ZB 4DV5M 1Z5BA 2JY5A 3K2LA 2XGNA 3SMSA 2WSEF 4CISA 3B7ZA 1XNRM 3HHXA 3LCVB 3FTEA 1NV8A 1QQWA 2G3QA 3VLFB 2DAGA 3QWLA 1YSYA 1D2NA 1Z5AA 2G5GX 5KPTA 1N78A 3GLGB 4DUZM 2LVOC 3K8ZA 5ITYA 3TWMA 4JI8M 1NY5A 4FWGA 3PNVA 1HNZM 2HAKA 2R6FA 3DA1A 1L1TA 1XNQM 1EIJA 1GJSA 1VEKA 2LVPC 1IBLM 3PVSA 2C5RA 2GNOA 2I7NA 2CHVA 2Y0TA 3J2PB 5KQ8A 4PD2A 3HJSA 3FTFA 1QUSA 2LVAA 4IBDA 3SHGB 3M6AA 3SBJA 2X49A 1OJLA 2BJWA 2LHGA 2WSFF 1XB2B 2F5QA 4NRWA 1UFZA 2M5ZA 3GLGE 2KZUA 4AI6A 4LF4M 5H3XA 4NOOB 4NXMM 2O01F 5EXSA 1EFUB 1NHGC 2V1UA 3U6EA 4NXNM 1HNXM 4FCWA 5ITXA 5C18A 2RGHA 2Y0QA 4QNRA 2FOIC 2QPAA 4LGYA 2JY6B 4AQYM 3C58A 3WHLA 2O5RA 1Q39A 1X37A 2APLA 2XSZA 1G3IA 3FD9A 2C9OA 4LRSA 3T15A 2OPFA 3FE3A 3J80S 3L28A 1XMQM 3QYBA 1QAOA 2CHGA 4XK8F 4X65M 3A45A 3PFIA 3M7GA 4GEWA 2R44A 4X66M 3PMQA 4KHPM 2C96A 2LHCA 4GIPA 5H37D 1IY1A 1QZMA 2QCUA 1WR1B 2WZJA 4FCVA 2VQFM 3J7AS 4JI7M 2OOBA 3T6PA 1FJGM 2UUCM 2EUCA 3GLHA 1N33M 4AKHA 3B9PA 4K0KM 1IFYA 4BB9A 2QZ4A 8CATA 2HL7A 2L7HA 2Z3XA 4DV2M 2HHHM 1C1KA 5EP2A 3ZH9B 2CUZA 1XXHA 5FTLA 1QHKA 4KODA 4NL4H 7CATA 4JI2M 1ZMWA 4B7GA 3BXWA 3U60B 2VDBB 3KSJA 5ITQA 3TWKA 4DV7M 2K47A 2XSZD 1XMOM 2DWLA 3SARA 3TPZA 4AG6A 3HGIA 5A2QS 1ORYB 3Q8GA 3V76A 3ILKA 1SXJB 1OIPA 2ZTDA 4Z6YA 1GO5A 3LW5F 3HJ8A 4NSRA 5EP4A 3FKEA 2V6ZM 4WURA 3LCUA 2YQZA 2HKJA 2L2DA 3GLIE 3H4JA 1IN4A 1AUAA 4Z8XA 3JAMS 2RKOA 4BLCA 1GKIA 1QUTA 1L2DA 2DAMA 5EJCA 3T38A 1V34A 4D82A 3GLFE 4P17A 5GKNA 3FUTA 1QZEA 4IBJA 4G4QA 2X4AA 1HT2E 1TTEA 3E4RA 3FRHA 1E32A 1SXJD 4MGHA 4D80A 1E94E 3D8LA 2XLJA 4BBAA 1QYRA 2V1CA 1OAOC 4R7GA 4AZFA 3MK6A 4DR7M 1ZV1A 2BNKA 4LJ8A 3L27A 1ZQ9A 2JWSA 4GC5A 4Q7JA 2KEBA 1HQYE 4ITQA 1GVNA 1TH3A 4FWDA 4OVZB 1NV9A 5EP3A 1J09A 3AFHA 2RRUA 3U5ZA 2BWEA 2FS1A 4XBOA 2C99A 4YHHM 1FNNA 2QBYB 4L8RC 1NSFA 2ZAOA 4DR6M 2YNMD 4LJ4A 2JP7A 2HWJA 4GRIA 3GRVA 2MGWA 3JR5A 1I94M 5EXXA 2BJVA 1DGBA 2KZSA 4MH0E 4GHAA 2C9CA 5FTJA 1PJTA 5JI2E 3I4YA 1RU3A 2HCBA 3GLGA 3Q8XA 5FTMA 1G71A 3UMMA 3KP1E 2K0BX 3FTDA 3HWSA 3HHYA 2D7HA 3LVWA 2JY7A 3H4MA 4IBEA 4KO8A 3CTWB 4R71A 2VF8A 4YY3M 2CV2A 3L25A 4GITA 2KDLA 2EO2A 4B3SM 2Z4SA 3KOWE 3NWLA 5E26A 4AKIA 4RF0A 2QHOB 4WP2A 1YUBA 5ITRA 3KVWA 4Y28F 4JV5M 1NVMA 1GLNA 2JXNA 2KRKA 3AJIB 3VKHA 5EP1A 3U6OA 2DZNB 3GPXA 2XH9A 4LG2A 2LBCA 5KO3A 4DR3M 1P3QQ 3A98B 4LY6A 4B08A 5LMNM 3L29A 1N34M 1TR8A 3SYKA 3TWLA 1XWIA 1IQPA 3KOXE 4RKUF 4X62M 2DWZB 1I4WA 3L26A 4DR2M 4MGZE 3HU3A 1AIPC 3RGPA 1GJTA 4HL4A 2OO9A 2R4EA 2Q2EB 4LF9M 1V92A 3ZC7B 3A42A 3C3DA 4L78A 2EA0A 1N77A 3OTOM 4FW9A 2H5XA 3M0EA 3B7QA 4LJ9A 4MGKE 2DENA 4JN6A 1GABA 3IHPA 4PDIA 5KQDA 2VF7A 3HU1A 1G4AE 3FUXA 1SG9A 2E5LM 3SFZA 2JY8A 1IY2A 3FRIA 1PM5A 2K9DA 4LCBA 3THGA 5IZ7D 5JI3E 3D8BA 3J81S 1R6BX 3HHWA 3A46A 1Q02A 2LWXA 2Y21A 4KT0F 1QVRA 3VK8A 1DGHB 3FUVA 4B7FA 1PJIA 2F5NA 4G4RA 3AOGA 2B3TA 2JZ0A 2KRUA 3U6PA 2YFQA 3FTCA 3R8FA 3U60A 2KNZA 3IG8A 3KOYE 5KPRA 2DWNA 3GQ4A 1IN6A 4LZJA 1WIVA 4G6ZA 3SMPA 2JNHA 2F5SA 1IN8A 1K82A 1IXZA 3GQ3A 3T1YM 1DO2A 1SXJA 4RNAA 4M9XA 4QOZC 4JYAM 2DKLA 2G8LA 3GLIB 2DNAA 3DZDA 3J7BA 3RFWA 2CE7A 5IT9S 3B7NA 4ANRA 2KNVA 4WW0A 3GLFB 1W5TA 1J7KA 3MHVC 2MR9A 2DHYA 1L2CA 1T3TA 2R65A 1WXQA 1Z6TA 2L4FA 3I4VA 4QOSA 3UK6A 3DOAA 1XHBA 5KPZA 4LF6M 1JR3E 4LF7M 1LTMA 3CF0A 4CGYB 4NC6A 3R9XB 1HQCA 1OKSA 3SAUA 3I04M 4II7A 1N36M 3U61B 3HZJA 3HHZA 1HJPA 1DV0A 4B3TM 1IN5A 3K9OA 4TUWA 3JR4A 3B74A 2DXIA 5FSWA 1KFVA 4PDGA 2F5OA 4GC9A 3U6MA 2ZBKB 3VDUA 3W67A 2ZM6M 3GPUA 1K3WA 2UXCM 4OVZA 5ITXE 4F2LA 2XF3A 2D7GA 1NJFA 4CJ6A 4GMQA 4G4OA 1IBMM 2CV0A 2XZFA 2JZ1A 4F1IA 4B3RM 3E21A 3GRUA 1V33A 4L15A 1WJ7A 3AKZA 2QBYA 3E46A 3IECA 1HR0M 4KLNA 1SXJC 3CGWA 4IJFA 3CF2A 1OAIA 1D0LA 4LGMA 5EXTA 2JA2A
chains in the Genus database with same CATH topology
5EQTA 4LJ6A 5F3WA 3SAWA 4LJ5A 2F4VM 1HNWM 2F5PA 3FYCA 1QAMA 1NY6A 2KA6B 1Q3BA 3BOSA 2UXBM 2I7PA 4NRVA 1L2BA 1MU5A 1L8QA 5DYIA 4L4UA 2W82A 3SASA 4HLQA 4ZPXA 4M9SA 3AL0C 4LF5M 3K1JA 4FVMA 4JI0M 4LFCM 4JI6M 3LVVA 5FTKA 2R18A 3PNYA 3HU2A 1IXSB 2Y20A 3DFZA 4DR5M 1QAQA 3VDPA 5LMUM 3TE6A 3VK7A 3W0LB 3LQQA 2X8AA 1W5SA 3QAUA 3E9SA 4I5SA 4OU7A 1EE8A 4IBGA 1Z59A 4EIWA 3HKPA 3VKGA 3RE8A 5DYGA 2UUAM 2H1RA 4OX9M 3WHKA 1K3XA 2LH0A 4MM3B 1N75A 3AV0A 5C1BA 3MJ5A 2RGOA 3SC3A 3LQRA 2Z7JA 4MGYE 2R62A 4DV4M 2NQ8C 3LMMA 5BR8M 4IIWA 1GL7A 3IG5A 4JI5M 2R4JA 1DGGA 4QHTA 2UU9M 1Z5CA 1KYIA 4L16A 4I8OA 4LZZA 4MGIE 3U6DA 3KW6A 4JI1M 2CFOA 4I81A 2CEAA 1IXRC 1DGHA 1G8PA 4PT5A 2DVWB 3PXGA 3ZCBB 3T1HM 3GQ5A 4GKJM 4JI4M 4QHSA 1JR3A 2R45A 3TQSA 4DV6M 3J27B 5IREB 4W5WA 4B7HA 3SHFA 5FTNA 3U6CA 1N32M 3CF6E 1YE9A 2XEPA 3K92A 3GLIA 2QENA 3U6LA 4M9ZA 4MB7A 2J7OA 1TH4A 4NSOB 1S3SA 3GLFA 3KFUG 2D7EA 5EXPA 3GP1A 4FWHA 3GO8A 1IY0A 2CV1A 2KXEA 2M60A 4JXJA 4LJAA 1R2YA 4IBIA 3NBIA 4D81A 4DUYM 1NHWC 1NJGA 4RF1A 2L09A 4CHTB 4G4NA 4REZA 3W0FA 4AG5A 4LFBM 2OQ4A 2YR0A 3U6OA 1MX0A 2P5TA 4S12A 3VFDA 4LFAM 3KOZE 3U61A 3KSXA 4FCTA 5FLXS 3UJNA 4GH9A 4X65M 3FUWA 1JR3D 2ZANA 2L7IA 5BPVA 4QNMA 4IBCA 4IBFA 2XFTA 1PJJA 4IBBA 2L6OA 3UZUA 1LV7A 3L2AA 4DV0M 1G59A 4AW4A 1DGFA 2LNHC 3FUUA 4DR1M 5ITTA 4OW0A 1L1ZA 3KS4A 3U6QA 2J7NA 4A3VB 1G41A 2XFSA 4IBKA 4X64M 4LF8M 3SYLA 4B3MM 2ERCA 1VDDA 1R2ZA 2VIIA 1J5EM 1OFIA 4M0WA 2C98A 2CHQA 1DO0A 1E9SA 3GLHB 3KXEC 4R3DA 2XZUA 2UXDM 1H6UA 3AOEA 1OFHA 1ZAEA 4M0DA 1TDZA 4FD2A 3U6SA 1XXHB 1IN7A 4IJEA 2DWMA 2FE8A 3KS8A 2DHRA 3GPYA 3SATA 1IBKM 1HT1E 1KSFX 1E9RA 1Q3CA 4LJ7A 1TDHA 5E6JA 2FNAA 2ZAMA 3GPPA 5ITUA 2QP9X 3EIHA 1QANA 3RGSA 2VQEM 5IWAM 4DV3M 2AHMA 3GRYA 2LXEA 4JI3M 1SXJE 1JQJC 3I51A 3EIEA 3FYDA 1NNJA 5DNYA 4GKKM 3TL4X 4PCZA 1IM2A 4P16A 4DV1M 2KW0A 1UM8A 1R7RA 1TGUA 2Z4RA 3HJQA 4XGIA 1GL6A 2R46A 1NNUC 3KDSE 3AOEC 4I4LA 3GRRA 3UGJA 3KP0E 3SAVA 2A5YB 4LRTA 2UUBM 4AKGA 2FFJA 4DR4M 1XC8A 4GHLA 1TH2A 2DZOB 3U5ZB 4DV5M 1Z5BA 3K2LA 2XGNA 3SMSA 4CISA 1XNRM 3HHXA 3FTEA 1QQWA 3VLFB 3QWLA 1YSYA 1D2NA 1Z5AA 2G5GX 5KPTA 1N78A 3GLGB 4DUZM 3K8ZA 5ITYA 3TWMA 4JI8M 1NY5A 4FWGA 3PNVA 1HNZM 1L1TA 3DA1A 1XNQM 1IBLM 3PVSA 2C5RA 2I7NA 2CHVA 2Y0TA 3J2PB 5KQ8A 4PD2A 3HJSA 3FTFA 4IBDA 3SHGB 3M6AA 3SBJA 2X49A 1OJLA 2BJWA 2F5QA 4NRWA 2M5ZA 2KZUA 4AI6A 4LF4M 5H3XA 4NOOB 4NXMM 5EXSA 1NHGC 2V1UA 3U6EA 4NXNM 1HNXM 4FCWA 5ITXA 5C18A 2RGHA 2Y0QA 4QNRA 2FOIC 2QPAA 4LGYA 4AQYM 3C58A 3WHLA 2O5RA 1Q39A 1X37A 3T15A 2XSZA 1G3IA 3FD9A 2C9OA 4LRSA 2OPFA 3J80S 3L28A 1XMQM 1QAOA 2CHGA 3A45A 3PFIA 3M7GA 4X66M 4KHPM 2C96A 4GIPA 5H37D 1IY1A 1QZMA 2QCUA 4FCVA 2VQFM 3J7AS 4JI7M 1FJGM 2UUCM 2EUCA 3GLHA 1N33M 4AKHA 3B9PA 4K0KM 4BB9A 2QZ4A 8CATA 2HL7A 2L7HA 2Z3XA 4DV2M 2HHHM 1C1KA 5EP2A 3ZH9B 2CUZA 1XXHA 5FTLA 4KODA 4NL4H 7CATA 4JI2M 4B7GA 3U60B 3KSJA 5ITQA 3TWKA 4DV7M 2K47A 2XSZD 1XMOM 2DWLA 3SARA 3TPZA 4AG6A 3HGIA 5A2QS 1ORYB 3ILKA 1SXJB 4Z6YA 3HJ8A 4NSRA 5EP4A 3FKEA 2V6ZM 4WURA 2YQZA 2HKJA 1IN4A 4Z8XA 3JAMS 2RKOA 4BLCA 1GKIA 1L2DA 5EJCA 3T38A 4D82A 5GKNA 3FUTA 4IBJA 4G4QA 2X4AA 1HT2E 3E4RA 4MGHA 1E32A 1SXJD 4D80A 1E94E 3D8LA 2XLJA 4BBAA 1QYRA 2V1CA 4R7GA 4AZFA 3MK6A 4DR7M 2BNKA 4LJ8A 3L27A 1ZQ9A 4GC5A 2KEBA 1HQYE 4ITQA 1GVNA 1TH3A 4FWDA 4OVZB 5EP3A 1J09A 3AFHA 3U5ZA 4XBOA 2C99A 4YHHM 1FNNA 2QBYB 4L8RC 1NSFA 2ZAOA 4DR6M 2YNMD 4LJ4A 4GRIA 3JR5A 3GRVA 1I94M 5EXXA 2BJVA 1DGBA 2KZSA 4MH0E 4GHAA 2C9CA 5FTJA 5JI2E 3I4YA 3GLGA 2HCBA 3Q8XA 5FTMA 3UMMA 3KP1E 3FTDA 3HWSA 3HHYA 2D7HA 3LVWA 3H4MA 4IBEA 4KO8A 3CTWB 4YY3M 2CV2A 3L25A 4GITA 2EO2A 4B3SM 2Z4SA 3KOWE 3NWLA 5E26A 4AKIA 4RF0A 1YUBA 5ITRA 3KVWA 4JV5M 1NVMA 1GLNA 3AJIB 2KRKA 3VKHA 5EP1A 2DZNB 3GPXA 2XH9A 4LG2A 5KO3A 4DR3M 3A98B 4LY6A 4B08A 5LMNM 3L29A 1N34M 3SYKA 3TWLA 1XWIA 1IQPA 3KOXE 4X62M 2DWZB 1I4WA 3L26A 4DR2M 4MGZE 3HU3A 3RGPA 4HL4A 2R4EA 4LF9M 2Q2EB 3ZC7B 3A42A 4L78A 2EA0A 1N77A 3OTOM 4FW9A 3M0EA 4MGKE 4LJ9A 4JN6A 4PDIA 5KQDA 3HU1A 1G4AE 3FUXA 2E5LM 3SFZA 1PM5A 1IY2A 4LCBA 3THGA 5IZ7D 5JI3E 3D8BA 3J81S 1R6BX 3HHWA 3A46A 2LWXA 2Y21A 1QVRA 3VK8A 1DGHB 3FUVA 4B7FA 1PJIA 2F5NA 4G4RA 3AOGA 2KRUA 3U6PA 2YFQA 3FTCA 3R8FA 3U60A 3IG8A 3KOYE 5KPRA 2DWNA 3GQ4A 1IN6A 4LZJA 4G6ZA 3SMPA 2F5SA 1IN8A 1K82A 1IXZA 3GQ3A 3T1YM 1DO2A 1SXJA 4RNAA 4M9XA 4QOZC 4JYAM 2G8LA 3GLIB 3DZDA 3J7BA 3RFWA 2CE7A 5IT9S 4WW0A 3GLFB 1W5TA 1J7KA 3MHVC 1L2CA 1T3TA 2R65A 1WXQA 1Z6TA 3I4VA 4QOSA 3UK6A 3DOAA 1XHBA 5KPZA 4LF6M 4LF7M 3CF0A 4CGYB 3R9XB 1HQCA 3SAUA 4II7A 1N36M 3U61B 3HHZA 4B3TM 1IN5A 4TUWA 3JR4A 2DXIA 5FSWA 1KFVA 4PDGA 2F5OA 4GC9A 3U6MA 2ZBKB 3VDUA 2ZM6M 3GPUA 1K3WA 2UXCM 4OVZA 5ITXE 2XF3A 2D7GA 1NJFA 4GMQA 4G4OA 1IBMM 2CV0A 2XZFA 4B3RM 3GRUA 3AKZA 4L15A 2QBYA 1HR0M 4KLNA 1SXJC 4IJFA 3CF2A 4LGMA 5EXTA 2JA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 M;  3U6E A;  4NXN M;  1HNX M;  4DR1 M;  3SAW A;  5ITT A;  2F4V M;  1HNW M;  5ITX A;  1L1Z A;  3U6Q A;  2F5P A;  3GPX A;  4LF8 M;  4X64 M;  1Q3B A;  2UXB M;  4AQY M;  4NRV A;  3C58 A;  1L2B A;  4B3M M;  1MU5 A;  1Q39 A;  4DR3 M;  1R2Z A;  2OPF A;  1J5E M;  3J80 S;  5LMN M;  3SAS A;  1XMQ M;  1N34 M;  3TWL A;  3A45 A;  4X62 M;  2XZU A;  2UXD M;  4X66 M;  4DR2 M;  4KHP M;  4LF5 M;  4JI0 M;  4LFC M;  4JI6 M;  1TDZ A;  3U6S A;  4LF9 M;  2Q2E B;  3A42 A;  4DR5 M;  2VQF M;  3GPY A;  4JI7 M;  2EA0 A;  3J7A S;  3SAT A;  1IBK M;  5LMU M;  3VK7 A;  3OTO M;  1Q3C A;  1FJG M;  2UUC M;  1N33 M;  4K0K M;  4PDI A;  1EE8 A;  1Z59 A;  1TDH A;  4DV2 M;  2HHH M;  2UUA M;  2E5L M;  3GPP A;  1PM5 A;  4OX9 M;  1K3X A;  5ITU A;  4JI2 M;  3J81 S;  2VQE M;  5IWA M;  5ITQ A;  4DV3 M;  4JI3 M;  3A46 A;  3TWK A;  4DV4 M;  4DV7 M;  3SAR A;  1XMO M;  3VK8 A;  5A2Q S;  1NNJ A;  5BR8 M;  4GKK M;  1PJI A;  4JI5 M;  4PCZ A;  2F5N A;  4G4R A;  4DV1 M;  3U6P A;  2UU9 M;  1Z5C A;  3GQ4 A;  2HKJ A;  3U6D A;  4JI1 M;  2F5S A;  3JAM S;  1K82 A;  3T1Y M;  3GQ3 A;  3SAV A;  1L2D A;  4JYA M;  3T1H M;  2UUB M;  4DR4 M;  3GQ5 A;  4G4Q A;  1XC8 A;  4GKJ M;  4JI4 M;  5H3X A;  5IT9 S;  4DV6 M;  4DV5 M;  1Z5B A;  1L2C A;  4DR7 M;  3U6C A;  4CIS A;  1N32 M;  3DOA A;  4LF6 M;  1XNR M;  4LF7 M;  3U6L A;  4ITQ A;  4MB7 A;  3SAU A;  1Z5A A;  1N36 M;  4DUZ M;  3TWM A;  5ITY A;  3GP1 A;  4JI8 M;  3GO8 A;  4B3T M;  4YHH M;  1HNZ M;  3JR4 A;  4DR6 M;  1R2Y A;  5ITR A;  4PDG A;  1KFV A;  1L1T A;  2F5O A;  1XNQ M;  3JR5 A;  4DUY M;  3U6M A;  2ZBK B;  1IBL M;  2ZM6 M;  1I94 M;  3GPU A;  4G4N A;  1K3W A;  2UXC M;  3W0F A;  5ITX E;  4LFB M;  2OQ4 A;  3U6O A;  1MX0 A;  4G4O A;  4PD2 A;  1IBM M;  4LFA M;  2XZF A;  4B3R M;  5FLX S;  4X65 M;  3SBJ A;  1HR0 M;  4YY3 M;  2F5Q A;  4NRW A;  4B3S M;  1PJJ A;  4LF4 M;  4NXM M;  4DV0 M; 
#chains in the Genus database with same CATH topology
 1R5L A;  5EQT A;  4LJ6 A;  5F3W A;  3SAW A;  4LJ5 A;  2F4V M;  1HNW M;  2F5P A;  2KHH A;  3FYC A;  1NY6 A;  1QAM A;  2KA6 B;  1Q3B A;  3BOS A;  2LVN C;  2I7P A;  3NBX X;  4NRV A;  2UXB M;  3C3E A;  1L2B A;  1MU5 A;  1L8Q A;  1OTR A;  4L6V 6;  5DYI A;  4L4U A;  2W82 A;  3SAS A;  4HLQ A;  2K6B A;  2BWB A;  4ZPX A;  4M9S A;  3AL0 C;  5L8R F;  3K1J A;  4FVM A;  4JI0 M;  4LF5 M;  1D0M A;  4JI6 M;  3LVV A;  4LFC M;  5FTK A;  2R18 A;  3PNY A;  1PJS A;  2OOA A;  3HU2 A;  1IXS B;  2Y20 A;  3DFZ A;  4DR5 M;  1C7Y A;  1QAQ A;  1Y8G A;  3VDP A;  5LMU M;  3TE6 A;  3VK7 A;  3W0L B;  3LQQ A;  2X8A A;  1W5S A;  2ZTC A;  3E9S A;  3QAU A;  4I5S A;  4OU7 A;  1EE8 A;  4IBG A;  1Z59 A;  4EIW A;  3HKP A;  3VKG A;  3RE8 A;  3BSU A;  5DYG A;  1VG5 A;  1QDT A;  2UUA M;  2H1R A;  4OX9 M;  3WHK A;  3BBZ A;  1K3X A;  2LH0 A;  4MM3 B;  1N75 A;  3AV0 A;  5C1B A;  3MJ5 A;  2RGO A;  3SC3 A;  3LQR A;  2Z7J A;  4MGY E;  2MJ5 B;  2R62 A;  4DV4 M;  2NQ8 C;  3LMM A;  3ZQJ A;  5BR8 M;  4IIW A;  1GL7 A;  3IG5 A;  4JI5 M;  2R4J A;  1DGG A;  4QHT A;  2O25 A;  2UU9 M;  1Z5C A;  1KYI A;  2EJS A;  4L16 A;  1OQY A;  4I8O A;  4LZZ A;  4MGI E;  4UN2 B;  3KW6 A;  3U6D A;  4JI1 M;  2CFO A;  4I81 A;  2CEA A;  1IXR C;  1DGH A;  1G8P A;  2R0I A;  2DVW B;  2WSC F;  3I01 M;  4PT5 A;  2QQ8 A;  2QSF X;  3PXG A;  3ZCB B;  3T1H M;  3GQ5 A;  4GKJ M;  4JI4 M;  4QHS A;  1JR3 A;  2CWB A;  2R45 A;  3TQS A;  4DV6 M;  2DAK A;  3HX3 A;  3J27 B;  5IRE B;  4W5W A;  4B7H A;  3SHF A;  5FTN A;  3U6C A;  1N32 M;  3CF6 E;  1YE9 A;  2XEP A;  3K92 A;  3GLI A;  2QEN A;  3U6L A;  1WGL A;  4M9Z A;  1F4I A;  1PRB A;  4MB7 A;  2J7O A;  1TH4 A;  2DI0 A;  4NSO B;  1S3S A;  3GLF A;  3KFU G;  2D7E A;  5EXP A;  3GP1 A;  4FWH A;  3GO8 A;  2DAE A;  1IY0 A;  2CV1 A;  2KXE A;  2M60 A;  4JXJ A;  4LJA A;  1R2Y A;  4IBI A;  3NBI A;  4D81 A;  4DUY M;  1NHW C;  1NJG A;  1D0K A;  2L09 A;  4RF1 A;  4CHT B;  4REZ A;  3W0F A;  2CP8 A;  4AG5 A;  1VQ1 A;  4G4N A;  3K9P A;  4LFB M;  1ZMU A;  2FH0 A;  2OQ4 A;  2YR0 A;  2MRO B;  3W68 A;  1MX0 A;  2P5T A;  1TF0 B;  2Z8Y M;  4S12 A;  4LFA M;  1PGY A;  3KOZ E;  3VFD A;  3U61 A;  3QYE A;  3KSX A;  4FCT A;  1R4G A;  4CIZ A;  3UJN A;  5FLX S;  2J5Y A;  4GH9 A;  1JB0 F;  1A5T A;  1JR3 D;  1VDL A;  2L7I A;  2ZAN A;  3FUW A;  5BPV A;  4QNM A;  4IBC A;  4IBF A;  1QDR A;  2CRU A;  2XFT A;  3HY5 A;  1PJJ A;  4IBB A;  4HEO A;  2L6O A;  3B89 A;  1LV7 A;  3L2A A;  2MH8 A;  3UZU A;  4DV0 M;  4AW4 A;  1G59 A;  1DGF A;  1OIZ A;  2LNH C;  1VEG A;  3FUU A;  5ITT A;  4DR1 M;  2QNJ A;  4OW0 A;  1T43 A;  3KS4 A;  3U6Q A;  2JUJ A;  2J7N A;  4A3V B;  1L1Z A;  1G41 A;  2XFS A;  4IBK A;  4X64 M;  4LF8 M;  1WGN A;  2N35 A;  3SYL A;  4B3M M;  2ERC A;  1VDD A;  1R2Z A;  3F92 A;  2VII A;  1J5E M;  1OFI A;  4M0W A;  2C98 A;  2CHQ A;  1CUK A;  1DO0 A;  1E9S A;  3GLH B;  3KXE C;  4R3D A;  2XZU A;  2UXD M;  1H6U A;  3AOE A;  1OFH A;  1MJG M;  1ZAE A;  1ZMV A;  4M0D A;  1TDZ A;  4FD2 A;  3U6S A;  1XXH B;  1IN7 A;  4IJE A;  2DWM A;  2FE8 A;  3KS8 A;  2DHR A;  3C9P A;  3GPY A;  2DZL A;  2DAI A;  3SAT A;  1IBK M;  4G3O A;  1HT1 E;  1KSF X;  1E9R A;  1Q3C A;  2EKF A;  1VEJ A;  3GIT A;  4LJ7 A;  1TDH A;  5E6J A;  2LTU A;  2GQF A;  2FNA A;  1BVS A;  2ZAM A;  3GPP A;  1MN3 A;  5ITU A;  2QP9 X;  3EIH A;  1QAN A;  1IXS A;  3RGS A;  2VQE M;  3GLH E;  5IWA M;  4DV3 M;  2AHM A;  3GRY A;  2LXE A;  4JI3 M;  1YLA A;  1SXJ E;  1JQJ C;  3I51 A;  3EIE A;  3FYD A;  1XXH E;  3BL4 A;  1NNJ A;  5DNY A;  5DFL A;  4GKK M;  3TL4 X;  4PCZ A;  1IM2 A;  4P16 A;  3MMP A;  2KNA A;  2KW0 A;  4DV1 M;  1UM8 A;  1T6O A;  1R7R A;  1TGU A;  2Z4R A;  3HJQ A;  4XGI A;  1GL6 A;  1NO1 A;  2R46 A;  1NNU C;  2LVQ D;  3KDS E;  3AOE C;  4I4L A;  3GRR A;  3UGJ A;  3KP0 E;  3SAV A;  2EKK A;  2A5Y B;  4LRT A;  2UUB M;  4AKG A;  2FFJ A;  4DR4 M;  1XC8 A;  1PJQ A;  1WHC A;  2L4E A;  1TH2 A;  4DBG B;  4GHL A;  2DZO B;  3U5Z B;  4DV5 M;  1Z5B A;  2JY5 A;  3K2L A;  2XGN A;  3SMS A;  2WSE F;  4CIS A;  3B7Z A;  1XNR M;  3HHX A;  3LCV B;  3FTE A;  1NV8 A;  1QQW A;  2G3Q A;  3VLF B;  2DAG A;  3QWL A;  1YSY A;  1D2N A;  1Z5A A;  2G5G X;  5KPT A;  1N78 A;  3GLG B;  4DUZ M;  2LVO C;  3K8Z A;  5ITY A;  3TWM A;  4JI8 M;  1NY5 A;  4FWG A;  3PNV A;  1HNZ M;  2HAK A;  2R6F A;  3DA1 A;  1L1T A;  1XNQ M;  1EIJ A;  1GJS A;  1VEK A;  2LVP C;  1IBL M;  3PVS A;  2C5R A;  2GNO A;  2I7N A;  2CHV A;  2Y0T A;  3J2P B;  5KQ8 A;  4PD2 A;  3HJS A;  3FTF A;  1QUS A;  2LVA A;  4IBD A;  3SHG B;  3M6A A;  3SBJ A;  2X49 A;  1OJL A;  2BJW A;  2LHG A;  2WSF F;  1XB2 B;  2F5Q A;  4NRW A;  1UFZ A;  2M5Z A;  3GLG E;  2KZU A;  4AI6 A;  4LF4 M;  5H3X A;  4NOO B;  4NXM M;  2O01 F;  5EXS A;  1EFU B;  1NHG C;  2V1U A;  3U6E A;  4NXN M;  1HNX M;  4FCW A;  5ITX A;  5C18 A;  2RGH A;  2Y0Q A;  4QNR A;  2FOI C;  2QPA A;  4LGY A;  2JY6 B;  4AQY M;  3C58 A;  3WHL A;  2O5R A;  1Q39 A;  1X37 A;  2APL A;  2XSZ A;  1G3I A;  3FD9 A;  2C9O A;  4LRS A;  3T15 A;  2OPF A;  3FE3 A;  3J80 S;  3L28 A;  1XMQ M;  3QYB A;  1QAO A;  2CHG A;  4XK8 F;  4X65 M;  3A45 A;  3PFI A;  3M7G A;  4GEW A;  2R44 A;  4X66 M;  3PMQ A;  4KHP M;  2C96 A;  2LHC A;  4GIP A;  5H37 D;  1IY1 A;  1QZM A;  2QCU A;  1WR1 B;  2WZJ A;  4FCV A;  2VQF M;  3J7A S;  4JI7 M;  2OOB A;  3T6P A;  1FJG M;  2UUC M;  2EUC A;  3GLH A;  1N33 M;  4AKH A;  3B9P A;  4K0K M;  1IFY A;  4BB9 A;  2QZ4 A;  8CAT A;  2HL7 A;  2L7H A;  2Z3X A;  4DV2 M;  2HHH M;  1C1K A;  5EP2 A;  3ZH9 B;  2CUZ A;  1XXH A;  5FTL A;  1QHK A;  4KOD A;  4NL4 H;  7CAT A;  4JI2 M;  1ZMW A;  4B7G A;  3BXW A;  3U60 B;  2VDB B;  3KSJ A;  5ITQ A;  3TWK A;  4DV7 M;  2K47 A;  2XSZ D;  1XMO M;  2DWL A;  3SAR A;  3TPZ A;  4AG6 A;  3HGI A;  5A2Q S;  1ORY B;  3Q8G A;  3V76 A;  3ILK A;  1SXJ B;  1OIP A;  2ZTD A;  4Z6Y A;  1GO5 A;  3LW5 F;  3HJ8 A;  4NSR A;  5EP4 A;  3FKE A;  2V6Z M;  4WUR A;  3LCU A;  2YQZ A;  2HKJ A;  2L2D A;  3GLI E;  3H4J A;  1IN4 A;  1AUA A;  4Z8X A;  3JAM S;  2RKO A;  4BLC A;  1GKI A;  1QUT A;  1L2D A;  2DAM A;  5EJC A;  3T38 A;  1V34 A;  4D82 A;  3GLF E;  4P17 A;  5GKN A;  3FUT A;  1QZE A;  4IBJ A;  4G4Q A;  2X4A A;  1HT2 E;  1TTE A;  3E4R A;  3FRH A;  1E32 A;  1SXJ D;  4MGH A;  4D80 A;  1E94 E;  3D8L A;  2XLJ A;  4BBA A;  1QYR A;  2V1C A;  1OAO C;  4R7G A;  4AZF A;  3MK6 A;  4DR7 M;  1ZV1 A;  2BNK A;  4LJ8 A;  3L27 A;  1ZQ9 A;  2JWS A;  4GC5 A;  4Q7J A;  2KEB A;  1HQY E;  4ITQ A;  1GVN A;  1TH3 A;  4FWD A;  4OVZ B;  1NV9 A;  5EP3 A;  1J09 A;  3AFH A;  2RRU A;  3U5Z A;  2BWE A;  2FS1 A;  4XBO A;  2C99 A;  4YHH M;  1FNN A;  2QBY B;  4L8R C;  1NSF A;  2ZAO A;  4DR6 M;  2YNM D;  4LJ4 A;  2JP7 A;  2HWJ A;  4GRI A;  3GRV A;  2MGW A;  3JR5 A;  1I94 M;  5EXX A;  2BJV A;  1DGB A;  2KZS A;  4MH0 E;  4GHA A;  2C9C A;  5FTJ A;  1PJT A;  5JI2 E;  3I4Y A;  1RU3 A;  2HCB A;  3GLG A;  3Q8X A;  5FTM A;  1G71 A;  3UMM A;  3KP1 E;  2K0B X;  3FTD A;  3HWS A;  3HHY A;  2D7H A;  3LVW A;  2JY7 A;  3H4M A;  4IBE A;  4KO8 A;  3CTW B;  4R71 A;  2VF8 A;  4YY3 M;  2CV2 A;  3L25 A;  4GIT A;  2KDL A;  2EO2 A;  4B3S M;  2Z4S A;  3KOW E;  3NWL A;  5E26 A;  4AKI A;  4RF0 A;  2QHO B;  4WP2 A;  1YUB A;  5ITR A;  3KVW A;  4Y28 F;  4JV5 M;  1NVM A;  1GLN A;  2JXN A;  2KRK A;  3AJI B;  3VKH A;  5EP1 A;  3U6O A;  2DZN B;  3GPX A;  2XH9 A;  4LG2 A;  2LBC A;  5KO3 A;  4DR3 M;  1P3Q Q;  3A98 B;  4LY6 A;  4B08 A;  5LMN M;  3L29 A;  1N34 M;  1TR8 A;  3SYK A;  3TWL A;  1XWI A;  1IQP A;  3KOX E;  4RKU F;  4X62 M;  2DWZ B;  1I4W A;  3L26 A;  4DR2 M;  4MGZ E;  3HU3 A;  1AIP C;  3RGP A;  1GJT A;  4HL4 A;  2OO9 A;  2R4E A;  2Q2E B;  4LF9 M;  1V92 A;  3ZC7 B;  3A42 A;  3C3D A;  4L78 A;  2EA0 A;  1N77 A;  3OTO M;  4FW9 A;  2H5X A;  3M0E A;  3B7Q A;  4LJ9 A;  4MGK E;  2DEN A;  4JN6 A;  1GAB A;  3IHP A;  4PDI A;  5KQD A;  2VF7 A;  3HU1 A;  1G4A E;  3FUX A;  1SG9 A;  2E5L M;  3SFZ A;  2JY8 A;  1IY2 A;  3FRI A;  1PM5 A;  2K9D A;  4LCB A;  3THG A;  5IZ7 D;  5JI3 E;  3D8B A;  3J81 S;  1R6B X;  3HHW A;  3A46 A;  1Q02 A;  2LWX A;  2Y21 A;  4KT0 F;  1QVR A;  3VK8 A;  1DGH B;  3FUV A;  4B7F A;  1PJI A;  2F5N A;  4G4R A;  3AOG A;  2B3T A;  2JZ0 A;  2KRU A;  3U6P A;  2YFQ A;  3FTC A;  3R8F A;  3U60 A;  2KNZ A;  3IG8 A;  3KOY E;  5KPR A;  2DWN A;  3GQ4 A;  1IN6 A;  4LZJ A;  1WIV A;  4G6Z A;  3SMP A;  2JNH A;  2F5S A;  1IN8 A;  1K82 A;  1IXZ A;  3GQ3 A;  3T1Y M;  1DO2 A;  1SXJ A;  4RNA A;  4M9X A;  4QOZ C;  4JYA M;  2DKL A;  2G8L A;  3GLI B;  2DNA A;  3DZD A;  3J7B A;  3RFW A;  2CE7 A;  5IT9 S;  3B7N A;  4ANR A;  2KNV A;  4WW0 A;  3GLF B;  1W5T A;  1J7K A;  3MHV C;  2MR9 A;  2DHY A;  1L2C A;  1T3T A;  2R65 A;  1WXQ A;  1Z6T A;  2L4F A;  3I4V A;  4QOS A;  3UK6 A;  3DOA A;  1XHB A;  5KPZ A;  4LF6 M;  1JR3 E;  4LF7 M;  1LTM A;  3CF0 A;  4CGY B;  4NC6 A;  3R9X B;  1HQC A;  1OKS A;  3SAU A;  3I04 M;  4II7 A;  1N36 M;  3U61 B;  3HZJ A;  3HHZ A;  1HJP A;  1DV0 A;  4B3T M;  1IN5 A;  3K9O A;  4TUW A;  3JR4 A;  3B74 A;  2DXI A;  5FSW A;  1KFV A;  4PDG A;  2F5O A;  4GC9 A;  3U6M A;  2ZBK B;  3VDU A;  3W67 A;  2ZM6 M;  3GPU A;  1K3W A;  2UXC M;  4OVZ A;  5ITX E;  4F2L A;  2XF3 A;  2D7G A;  1NJF A;  4CJ6 A;  4GMQ A;  4G4O A;  1IBM M;  2CV0 A;  2XZF A;  2JZ1 A;  4F1I A;  4B3R M;  3E21 A;  3GRU A;  1V33 A;  4L15 A;  1WJ7 A;  3AKZ A;  2QBY A;  3E46 A;  3IEC A;  1HR0 M;  4KLN A;  1SXJ C;  3CGW A;  4IJF A;  3CF2 A;  1OAI A;  1D0L A;  4LGM A;  5EXT A;  2JA2 A; 
#chains in the Genus database with same CATH homology
 5EQT A;  4LJ6 A;  5F3W A;  3SAW A;  4LJ5 A;  2F4V M;  1HNW M;  2F5P A;  3FYC A;  1QAM A;  1NY6 A;  2KA6 B;  1Q3B A;  3BOS A;  2UXB M;  2I7P A;  4NRV A;  1L2B A;  1MU5 A;  1L8Q A;  5DYI A;  4L4U A;  2W82 A;  3SAS A;  4HLQ A;  4ZPX A;  4M9S A;  3AL0 C;  4LF5 M;  3K1J A;  4FVM A;  4JI0 M;  4LFC M;  4JI6 M;  3LVV A;  5FTK A;  2R18 A;  3PNY A;  3HU2 A;  1IXS B;  2Y20 A;  3DFZ A;  4DR5 M;  1QAQ A;  3VDP A;  5LMU M;  3TE6 A;  3VK7 A;  3W0L B;  3LQQ A;  2X8A A;  1W5S A;  3QAU A;  3E9S A;  4I5S A;  4OU7 A;  1EE8 A;  4IBG A;  1Z59 A;  4EIW A;  3HKP A;  3VKG A;  3RE8 A;  5DYG A;  2UUA M;  2H1R A;  4OX9 M;  3WHK A;  1K3X A;  2LH0 A;  4MM3 B;  1N75 A;  3AV0 A;  5C1B A;  3MJ5 A;  2RGO A;  3SC3 A;  3LQR A;  2Z7J A;  4MGY E;  2R62 A;  4DV4 M;  2NQ8 C;  3LMM A;  5BR8 M;  4IIW A;  1GL7 A;  3IG5 A;  4JI5 M;  2R4J A;  1DGG A;  4QHT A;  2UU9 M;  1Z5C A;  1KYI A;  4L16 A;  4I8O A;  4LZZ A;  4MGI E;  3U6D A;  3KW6 A;  4JI1 M;  2CFO A;  4I81 A;  2CEA A;  1IXR C;  1DGH A;  1G8P A;  4PT5 A;  2DVW B;  3PXG A;  3ZCB B;  3T1H M;  3GQ5 A;  4GKJ M;  4JI4 M;  4QHS A;  1JR3 A;  2R45 A;  3TQS A;  4DV6 M;  3J27 B;  5IRE B;  4W5W A;  4B7H A;  3SHF A;  5FTN A;  3U6C A;  1N32 M;  3CF6 E;  1YE9 A;  2XEP A;  3K92 A;  3GLI A;  2QEN A;  3U6L A;  4M9Z A;  4MB7 A;  2J7O A;  1TH4 A;  4NSO B;  1S3S A;  3GLF A;  3KFU G;  2D7E A;  5EXP A;  3GP1 A;  4FWH A;  3GO8 A;  1IY0 A;  2CV1 A;  2KXE A;  2M60 A;  4JXJ A;  4LJA A;  1R2Y A;  4IBI A;  3NBI A;  4D81 A;  4DUY M;  1NHW C;  1NJG A;  4RF1 A;  2L09 A;  4CHT B;  4G4N A;  4REZ A;  3W0F A;  4AG5 A;  4LFB M;  2OQ4 A;  2YR0 A;  3U6O A;  1MX0 A;  2P5T A;  4S12 A;  3VFD A;  4LFA M;  3KOZ E;  3U61 A;  3KSX A;  4FCT A;  5FLX S;  3UJN A;  4GH9 A;  4X65 M;  3FUW A;  1JR3 D;  2ZAN A;  2L7I A;  5BPV A;  4QNM A;  4IBC A;  4IBF A;  2XFT A;  1PJJ A;  4IBB A;  2L6O A;  3UZU A;  1LV7 A;  3L2A A;  4DV0 M;  1G59 A;  4AW4 A;  1DGF A;  2LNH C;  3FUU A;  4DR1 M;  5ITT A;  4OW0 A;  1L1Z A;  3KS4 A;  3U6Q A;  2J7N A;  4A3V B;  1G41 A;  2XFS A;  4IBK A;  4X64 M;  4LF8 M;  3SYL A;  4B3M M;  2ERC A;  1VDD A;  1R2Z A;  2VII A;  1J5E M;  1OFI A;  4M0W A;  2C98 A;  2CHQ A;  1DO0 A;  1E9S A;  3GLH B;  3KXE C;  4R3D A;  2XZU A;  2UXD M;  1H6U A;  3AOE A;  1OFH A;  1ZAE A;  4M0D A;  1TDZ A;  4FD2 A;  3U6S A;  1XXH B;  1IN7 A;  4IJE A;  2DWM A;  2FE8 A;  3KS8 A;  2DHR A;  3GPY A;  3SAT A;  1IBK M;  1HT1 E;  1KSF X;  1E9R A;  1Q3C A;  4LJ7 A;  1TDH A;  5E6J A;  2FNA A;  2ZAM A;  3GPP A;  5ITU A;  2QP9 X;  3EIH A;  1QAN A;  3RGS A;  2VQE M;  5IWA M;  4DV3 M;  2AHM A;  3GRY A;  2LXE A;  4JI3 M;  1SXJ E;  1JQJ C;  3I51 A;  3EIE A;  3FYD A;  1NNJ A;  5DNY A;  4GKK M;  3TL4 X;  4PCZ A;  1IM2 A;  4P16 A;  4DV1 M;  2KW0 A;  1UM8 A;  1R7R A;  1TGU A;  2Z4R A;  3HJQ A;  4XGI A;  1GL6 A;  2R46 A;  1NNU C;  3KDS E;  3AOE C;  4I4L A;  3GRR A;  3UGJ A;  3KP0 E;  3SAV A;  2A5Y B;  4LRT A;  2UUB M;  4AKG A;  2FFJ A;  4DR4 M;  1XC8 A;  4GHL A;  1TH2 A;  2DZO B;  3U5Z B;  4DV5 M;  1Z5B A;  3K2L A;  2XGN A;  3SMS A;  4CIS A;  1XNR M;  3HHX A;  3FTE A;  1QQW A;  3VLF B;  3QWL A;  1YSY A;  1D2N A;  1Z5A A;  2G5G X;  5KPT A;  1N78 A;  3GLG B;  4DUZ M;  3K8Z A;  5ITY A;  3TWM A;  4JI8 M;  1NY5 A;  4FWG A;  3PNV A;  1HNZ M;  1L1T A;  3DA1 A;  1XNQ M;  1IBL M;  3PVS A;  2C5R A;  2I7N A;  2CHV A;  2Y0T A;  3J2P B;  5KQ8 A;  4PD2 A;  3HJS A;  3FTF A;  4IBD A;  3SHG B;  3M6A A;  3SBJ A;  2X49 A;  1OJL A;  2BJW A;  2F5Q A;  4NRW A;  2M5Z A;  2KZU A;  4AI6 A;  4LF4 M;  5H3X A;  4NOO B;  4NXM M;  5EXS A;  1NHG C;  2V1U A;  3U6E A;  4NXN M;  1HNX M;  4FCW A;  5ITX A;  5C18 A;  2RGH A;  2Y0Q A;  4QNR A;  2FOI C;  2QPA A;  4LGY A;  4AQY M;  3C58 A;  3WHL A;  2O5R A;  1Q39 A;  1X37 A;  3T15 A;  2XSZ A;  1G3I A;  3FD9 A;  2C9O A;  4LRS A;  2OPF A;  3J80 S;  3L28 A;  1XMQ M;  1QAO A;  2CHG A;  3A45 A;  3PFI A;  3M7G A;  4X66 M;  4KHP M;  2C96 A;  4GIP A;  5H37 D;  1IY1 A;  1QZM A;  2QCU A;  4FCV A;  2VQF M;  3J7A S;  4JI7 M;  1FJG M;  2UUC M;  2EUC A;  3GLH A;  1N33 M;  4AKH A;  3B9P A;  4K0K M;  4BB9 A;  2QZ4 A;  8CAT A;  2HL7 A;  2L7H A;  2Z3X A;  4DV2 M;  2HHH M;  1C1K A;  5EP2 A;  3ZH9 B;  2CUZ A;  1XXH A;  5FTL A;  4KOD A;  4NL4 H;  7CAT A;  4JI2 M;  4B7G A;  3U60 B;  3KSJ A;  5ITQ A;  3TWK A;  4DV7 M;  2K47 A;  2XSZ D;  1XMO M;  2DWL A;  3SAR A;  3TPZ A;  4AG6 A;  3HGI A;  5A2Q S;  1ORY B;  3ILK A;  1SXJ B;  4Z6Y A;  3HJ8 A;  4NSR A;  5EP4 A;  3FKE A;  2V6Z M;  4WUR A;  2YQZ A;  2HKJ A;  1IN4 A;  4Z8X A;  3JAM S;  2RKO A;  4BLC A;  1GKI A;  1L2D A;  5EJC A;  3T38 A;  4D82 A;  5GKN A;  3FUT A;  4IBJ A;  4G4Q A;  2X4A A;  1HT2 E;  3E4R A;  4MGH A;  1E32 A;  1SXJ D;  4D80 A;  1E94 E;  3D8L A;  2XLJ A;  4BBA A;  1QYR A;  2V1C A;  4R7G A;  4AZF A;  3MK6 A;  4DR7 M;  2BNK A;  4LJ8 A;  3L27 A;  1ZQ9 A;  4GC5 A;  2KEB A;  1HQY E;  4ITQ A;  1GVN A;  1TH3 A;  4FWD A;  4OVZ B;  5EP3 A;  1J09 A;  3AFH A;  3U5Z A;  4XBO A;  2C99 A;  4YHH M;  1FNN A;  2QBY B;  4L8R C;  1NSF A;  2ZAO A;  4DR6 M;  2YNM D;  4LJ4 A;  4GRI A;  3JR5 A;  3GRV A;  1I94 M;  5EXX A;  2BJV A;  1DGB A;  2KZS A;  4MH0 E;  4GHA A;  2C9C A;  5FTJ A;  5JI2 E;  3I4Y A;  3GLG A;  2HCB A;  3Q8X A;  5FTM A;  3UMM A;  3KP1 E;  3FTD A;  3HWS A;  3HHY A;  2D7H A;  3LVW A;  3H4M A;  4IBE A;  4KO8 A;  3CTW B;  4YY3 M;  2CV2 A;  3L25 A;  4GIT A;  2EO2 A;  4B3S M;  2Z4S A;  3KOW E;  3NWL A;  5E26 A;  4AKI A;  4RF0 A;  1YUB A;  5ITR A;  3KVW A;  4JV5 M;  1NVM A;  1GLN A;  3AJI B;  2KRK A;  3VKH A;  5EP1 A;  2DZN B;  3GPX A;  2XH9 A;  4LG2 A;  5KO3 A;  4DR3 M;  3A98 B;  4LY6 A;  4B08 A;  5LMN M;  3L29 A;  1N34 M;  3SYK A;  3TWL A;  1XWI A;  1IQP A;  3KOX E;  4X62 M;  2DWZ B;  1I4W A;  3L26 A;  4DR2 M;  4MGZ E;  3HU3 A;  3RGP A;  4HL4 A;  2R4E A;  4LF9 M;  2Q2E B;  3ZC7 B;  3A42 A;  4L78 A;  2EA0 A;  1N77 A;  3OTO M;  4FW9 A;  3M0E A;  4MGK E;  4LJ9 A;  4JN6 A;  4PDI A;  5KQD A;  3HU1 A;  1G4A E;  3FUX A;  2E5L M;  3SFZ A;  1PM5 A;  1IY2 A;  4LCB A;  3THG A;  5IZ7 D;  5JI3 E;  3D8B A;  3J81 S;  1R6B X;  3HHW A;  3A46 A;  2LWX A;  2Y21 A;  1QVR A;  3VK8 A;  1DGH B;  3FUV A;  4B7F A;  1PJI A;  2F5N A;  4G4R A;  3AOG A;  2KRU A;  3U6P A;  2YFQ A;  3FTC A;  3R8F A;  3U60 A;  3IG8 A;  3KOY E;  5KPR A;  2DWN A;  3GQ4 A;  1IN6 A;  4LZJ A;  4G6Z A;  3SMP A;  2F5S A;  1IN8 A;  1K82 A;  1IXZ A;  3GQ3 A;  3T1Y M;  1DO2 A;  1SXJ A;  4RNA A;  4M9X A;  4QOZ C;  4JYA M;  2G8L A;  3GLI B;  3DZD A;  3J7B A;  3RFW A;  2CE7 A;  5IT9 S;  4WW0 A;  3GLF B;  1W5T A;  1J7K A;  3MHV C;  1L2C A;  1T3T A;  2R65 A;  1WXQ A;  1Z6T A;  3I4V A;  4QOS A;  3UK6 A;  3DOA A;  1XHB A;  5KPZ A;  4LF6 M;  4LF7 M;  3CF0 A;  4CGY B;  3R9X B;  1HQC A;  3SAU A;  4II7 A;  1N36 M;  3U61 B;  3HHZ A;  4B3T M;  1IN5 A;  4TUW A;  3JR4 A;  2DXI A;  5FSW A;  1KFV A;  4PDG A;  2F5O A;  4GC9 A;  3U6M A;  2ZBK B;  3VDU A;  2ZM6 M;  3GPU A;  1K3W A;  2UXC M;  4OVZ A;  5ITX E;  2XF3 A;  2D7G A;  1NJF A;  4GMQ A;  4G4O A;  1IBM M;  2CV0 A;  2XZF A;  4B3R M;  3GRU A;  3AKZ A;  4L15 A;  2QBY A;  1HR0 M;  4KLN A;  1SXJ C;  4IJF A;  3CF2 A;  4LGM A;  5EXT A;  2JA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...