3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Protein binding
molecule keywords Fibrinogen binding protein
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
4JI0M 5ITTA 3OTOM 4DV7M 4ITQA 2OPFA 2VQEM 4DR2M 3SATA 4X62M 4JI7M 4GKKM 1Z59A 3J80S 4DR7M 4X65M 2ZM6M 4NRWA 3GO8A 1L2DA 2UXBM 1IBMM 3GQ4A 4G4OA 3J7AS 4DR6M 5ITQA 1N32M 1FJGM 4NXMM 2F4VM 4DV1M 1XNRM 1L2BA 3U6DA 4B3TM 3U6LA 1K82A 4B3MM 4OX9M 2UXDM 3A45A 4DR4M 4PD2A 1IBKM 3TWMA 3JR4A 3GPXA 2Q2EB 3SAUA 3T1YM 1K3XA 1MX0A 2UUAM 1TDHA 5ITUA 4DUZM 1R2ZA 2F5QA 4LFCM 5ITXA 3GQ3A 1EE8A 5LMNM 4DV2M 1PJIA 4X66M 4JI5M 4JI4M 1Q3CA 1N36M 5IT9S 2OQ4A 4DR3M 2UUCM 3JAMS 5ITXE 1R2YA 2E5LM 3A46A 4G4QA 4DR5M 4GKJM 3DOAA 1PM5A 4X64M 3U6CA 1PJJA 1TDZA 1J5EM 5ITYA 4LFAM 4DV3M 3VK7A 2UU9M 3U6OA 3T1HM 1Z5AA 3GPUA 4K0KM 1NNJA 2F5SA 3SAVA 2HKJA 1K3WA 4JI1M 4DV5M 1XMOM 4LF6M 1Q39A 1Q3BA 4JI6M 4JYAM 3TWKA 3TWLA 4NXNM 3VK8A 3SASA 5H3XA 2UUBM 4G4NA 4G4RA 1HNWM 3W0FA 2EA0A 1HNZM 4LF4M 4MB7A 4CISA 2XZFA 4DV4M 4KHPM 4DV6M 1Z5BA 1IBLM 4JI8M 4LF9M 4LF7M 5A2QS 3GQ5A 4B3SM 5BR8M 4JV5M 2UXCM 4NRVA 4PDGA 4B3RM 3GP1A 3SARA 3J81S 1N34M 5LMUM 2F5PA 1HNXM 4AQYM 1XMQM 2XZUA 4JI3M 4PDIA 1XNQM 2F5NA 1L1TA 1N33M 4LF8M 3GPPA 3U6SA 4DR1M 5ITRA 3U6PA 5FLXS 3SBJA 3A42A 1HR0M 1L1ZA 1L2CA 4PCZA 4DV0M 1MU5A 3JR5A 1KFVA 3GPYA 2F5OA 4JI2M 4LF5M 2VQFM 1XC8A 3U6MA 1I94M 4YHHM 4YY3M 1Z5CA 3U6QA 3SAWA 3U6EA 5IWAM 4LFBM 2HHHM 2ZBKB 4DUYM 3C58A
chains in the Genus database with same CATH superfamily
4HLQA 3TL4X 4LZJA 1QUTA 2W82A 2ZTCA 1W5SA 4GKKM 3VFDA 3SHGB 7CATA 3SMSA 4FWDA 4LJ9A 4DR7M 3RGSA 2DAIA 2JUJA 4TUWA 3UGJA 1G4AE 2KRUA 1IBMM 3GQ4A 2OO9A 1VDLA 2BWBA 3THGA 3LVVA 3NWLA 3GLHB 3HJQA 5KQ8A 3VKGA 3ZQJA 4XGIA 3TE6A 3W0LB 3L25A 1VQ1A 2EKKA 5FSWA 3L2AA 1LTMA 4MGHA 3U6LA 1WHCA 4B3MM 3M7GA 4FCVA 3A45A 4Z6YA 3LVWA 2G8LA 1TGUA 1MJGM 2CWBA 3HJSA 1V92A 2DWZB 2MH8A 4IBGA 4IBJA 4XK8F 4PT5A 2Q2EB 3JR4A 3GLFE 3TWMA 3K1JA 3DA1A 2CV2A 1QAQA 1R2ZA 4WP2A 5EP1A 3GQ3A 1EE8A 5LMNM 3D8BA 4RKUF 3FRHA 1XHBA 2K9DA 4X66M 2QENA 4JI5M 1Q3CA 2CE7A 4S12A 8CATA 2UUCM 2R18A 3JAMS 1R2YA 2EO2A 4QNMA 3AKZA 2YNMD 3DOAA 4II7A 1QUSA 1PM5A 5EP4A 3SYKA 1IXSA 1EFUB 4IBIA 1VEKA 1VEGA 3T15A 3DFZA 1JR3D 1IY2A 2KEBA 1PJJA 3FYCA 1TDZA 5ITYA 1J5EM 1T3TA 1QZEA 2RRUA 4FVMA 3SMPA 3U6OA 2JNHA 2DZLA 3FUTA 4W5WA 3T1HM 3GPUA 3HHWA 2F5SA 4G3OA 2CV1A 2DKLA 2ZTDA 2FOIC 2JWSA 2RKOA 4CJ6A 1K3WA 2R45A 1QANA 1Z6TA 1S3SA 3PNYA 5FTJA 3VK8A 3TWLA 2EKFA 1XB2B 1IN7A 2KW0A 4NXNM 2UUBM 4G4NA 4LRSA 2AHMA 2XSZA 2DZOB 3AL0C 1XXHB 2EA0A 3K9OA 1HNZM 2KNVA 2O25A 4JN6A 1PGYA 1R5LA 2XFSA 3HGIA 1AUAA 1IXRC 2KNAA 2LVPC 2X49A 3FD9A 3KDSE 4RF0A 3I4YA 2XZFA 4AI6A 1R7RA 1KYIA 4Q7JA 4R3DA 2QHOB 4JI8M 5A2QS 4JV5M 3IECA 1WIVA 2QSFX 1IY0A 2LHCA 3M6AA 4IBEA 1V34A 5EQTA 4IBBA 4PDGA 1D0KA 3B7NA 3CF0A 3BXWA 3SARA 2B3TA 3U61A 4OU7A 1GLNA 3W67A 4QOSA 2F5PA 4GHAA 2LH0A 3KOYE 4JI3M 1YE9A 1GL6A 3FYDA 2Z4SA 2DVWB 1IFYA 1AIPC 1XNQM 2C96A 4NSRA 4M0WA 2EUCA 1G59A 4HL4A 2DWLA 1OKSA 2DWNA 1BVSA 4M9ZA 4WW0A 2KZUA 2CHVA 3L26A 4PCZA 1KFVA 4LF5M 3HJ8A 4JI2M 2DNAA 1GO5A 4IBCA 2KZSA 2R46A 2Y20A 2XGNA 2YFQA 2XLJA 2VQFM 1XC8A 1DV0A 4YY3M 3U6QA 3U6EA 3IHPA 4LFBM 4P17A 3T6PA 4L4UA 2L09A 3FKEA 4DUYM 4GC9A 3OTOM 3FE3A 1G3IA 3LCUA 2NQ8C 2VQEM 3HHXA 1Y8GA 4DR2M 1GJTA 2K6BA 3EIHA 3FTEA 2DAMA 1GVNA 3SHFA 3FRIA 2OOAA 2L4FA 1TR8A 2OOBA 1YSYA 3B89A 1JR3A 1EIJA 4NRWA 2GQFA 2BNKA 3IG5A 4L8RC 2LVOC 3GLIA 1PRBA 1IN8A 1N75A 5JI3E 4CHTB 4R71A 5ITQA 1HT1E 5IZ7D 4NL4H 4M9SA 5C18A 1FJGM 2VF8A 3F92A 4GC5A 4D82A 1XNRM 2ZAMA 5DFLA 5FTNA 3K9PA 3MMPA 4LZZA 2WZJA 3U6DA 4B3TM 2HL7A 2JXNA 2DHYA 5FTLA 1NNUC 2FS1A 4PD2A 1GJSA 3R8FA 3KP0E 3B74A 3SAUA 4GITA 4KT0F 1Q02A 4HEOA 1PJQA 2QCUA 2UUAM 4LFCM 2F5QA 2LWXA 5EXPA 2R4EA 4AKHA 3HHYA 1I4WA 4AZFA 1SXJA 4IBFA 3KSJA 5EXSA 4JI4M 4MGYE 1N36M 2R0IA 2V6ZM 4QNRA 3BSUA 2FH0A 2BWEA 3PVSA 2LHGA 3GLGE 3GLGA 1RU3A 2CP8A 4GKJM 3GLFA 2KA6B 4L15A 3WHLA 1SXJE 4M9XA 2R44A 4QHSA 2LTUA 4NSOB 3HU3A 2ERCA 1PJTA 3E4RA 2DAEA 3GRYA 4DV3M 3C3EA 3ZCBB 2I7PA 2XH9A 3KVWA 3GRUA 4BBAA 1Z5AA 3GLIE 1DO2A 1TTEA 2VIIA 1XWIA 1NNJA 5KPTA 4QOZC 1OTRA 3FUWA 3Q8GA 2HKJA 1QYRA 4I81A 3NBXX 2Z4RA 4LF6M 3RGPA 1Q39A 1Q3BA 4IIWA 4JI6M 2GNOA 3HX3A 3J27B 2KHHA 3J7BA 3EIEA 4MH0E 3TWKA 3SASA 4XBOA 2R65A 1IXZA 2LVAA 3KW6A 3PXGA 2D7HA 1NHGC 3HY5A 4LF4M 5EP3A 2CEAA 2WSFF 4MB7A 3T38A 4CISA 4CIZA 4KHPM 1OFIA 3AFHA 3FTDA 1ZV1A 1Z5BA 1HJPA 2MR9A 1IBLM 2APLA 3E46A 2UXCM 1NHWC 3UK6A 2CFOA 1MN3A 1E9RA 3DZDA 2MROB 4B3RM 1X37A 1ZAEA 3M0EA 4LG2A 2J7NA 3HZJA 4GIPA 3VDUA 1HQYE 1HNXM 3LQRA 2CHGA 3C3DA 5H37D 1GL7A 3U60A 2D7EA 3K8ZA 3KS4A 2H5XA 4MGIE 3QWLA 1L1TA 2DAGA 2F5NA 4LF8M 3GPPA 4AKIA 3H4JA 4DR1M 5ITRA 1PJSA 1XXHE 3HU1A 1NV8A 5FLXS 3SBJA 2QNJA 3A42A 4LJ6A 2WSEF 4IJEA 1L2CA 4F2LA 1MU5A 2KRKA 2G5GX 1NY5A 2DENA 2JA2A 4L78A 2CRUA 3GPYA 2F5OA 3U6MA 1I94M 1GABA 2I7NA 5FTKA 3SAWA 3KXEC 4BB9A 2HHHM 3KOWE 4FW9A 1R6BX 1N34M 4WURA 1SXJC 2L2DA 1OFHA 4KO8A 4DV7M 1J09A 1T6OA 2XEPA 3SATA 4FWHA 4X62M 1SXJB 2EJSA 3U5ZA 4NC6A 1QHKA 3FUUA 3J80S 3HU2A 3HWSA 4UN2B 3U61B 3MJ5A 2ZM6M 1D0LA 4AKGA 2G3QA 3CGWA 3MHVC 4LJ8A 4GEWA 2CUZA 4G4OA 4CGYB 3J7AS 3AOGA 4AW4A 2C9OA 5KQDA 2FFJA 2WSCF 2DHRA 4DV1M 2QZ4A 1F4IA 2V1CA 1K82A 4OX9M 2UXDM 3LW5F 1QAOA 4MM3B 1QVRA 4BLCA 1E9SA 2LVNC 1IBKM 3BL4A 1TF0B 3I4VA 3GPXA 1G41A 2C9CA 1K3XA 2R6FA 3HKPA 1MX0A 5KO3A 1TDHA 2C5RA 3L27A 1WJ7A 2HCBA 5ITXA 1VG5A 4NOOB 4DV2M 1PJIA 1ZQ9A 3E21A 4P16A 1N77A 3L29A 5IT9S 2E5LM 3TQSA 2XFTA 4G4QA 4DR5M 2X8AA 4Y28F 3B7ZA 2HWJA 4AG5A 1OIZA 3I51A 4KLNA 2Y21A 2M5ZA 2DI0A 1G8PA 1HT2E 5C1BA 1VDDA 3FTCA 2UU9M 1CUKA 1VEJA 2QBYB 4I4LA 4OVZA 4B7HA 1KSFX 2DXIA 3KS8A 4JI1M 1SXJD 4DV5M 1JR3E 4FCWA 4RNAA 1N78A 3W68A 4B7FA 4JYAM 4EIWA 1NJGA 4LGYA 4G4RA 3I01M 3B9PA 3V76A 3W0FA 1IN4A 2O5RA 4LCBA 3C9PA 4M0DA 2L7IA 4I5SA 1SG9A 3GRRA 3QAUA 4JXJA 4DV6M 1W5TA 3KFUG 3E9SA 3ZC7B 1V33A 2A5YB 2MGWA 4IJFA 4LF9M 2L6OA 3WHKA 1TH2A 5L8RF 4B3SM 1YLAA 4L16A 5FTMA 3GP1A 2ZAOA 3BBZA 2JY6B 3J81S 3VLFB 5LMUM 2LNHC 1QQWA 2N35A 4I8OA 1YUBA 2XZUA 3CF2A 1XMQM 3ZH9B 3VKHA 1WGLA 4PDIA 2C99A 5DNYA 3GLHA 3R9XB 3GRVA 1DGFA 1NV9A 1DO0A 5BPVA 3LCVB 3U6SA 4G6ZA 4GHLA 5EJCA 3U6PA 2KNZA 2DAKA 1LV7A 3AJIB 2BJWA 3KSXA 3GLHE 4FD2A 4LJ7A 1C1KA 1NY6A 1OQYA 1L8QA 3BOSA 4A3VB 1NO1A 4RF1A 1UFZA 2VDBB 4YHHM 3PMQA 1Z5CA 4D80A 5KPZA 1NJFA 4FWGA 1A5TA 2J5YA 1XMOM 1OJLA 4B7GA 4JI0M 5ITTA 3KOXE 4ITQA 2OPFA 2ZANA 3SYLA 1JB0F 1GKIA 3KOZE 4JI7M 1Z59A 1OAIA 2CHQA 2H1RA 3NBIA 3MK6A 2VF7A 4X65M 1WXQA 3U60B 2O01F 2X4AA 4LY6A 3GO8A 2K0BX 1IXSB 1L2DA 3FTFA 1JQJC 2UXBM 2JY7A 3PNVA 3I04M 2J7OA 4GRIA 5E26A 2DWMA 2V1UA 4DR6M 3K2LA 2JZ0A 5EXXA 1N32M 2F4VM 1D2NA 4REZA 4FCTA 2Z7JA 3B7QA 5F3WA 1D0MA 4NXMM 1L2BA 3D8LA 3LMMA 3LQQA 5E6JA 4DR4M 5DYIA 2FE8A 3HHZA 2Z3XA 3T1YM 1QDTA 1R4GA 3FUVA 2KDLA 2RGOA 5ITUA 2M60A 1DGHA 1FNNA 3AOEC 3FUXA 1WGNA 2BJVA 5EXTA 4D81A 4DUZM 3H4MA 1IM2A 1DGBA 1C7YA 4MGKE 2OQ4A 3SFZA 3GLIB 4DR3M 5ITXE 3A46A 1E32A 1DGGA 2XF3A 2L4EA 2RGHA 4LJ5A 4X64M 1WR1B 2JP7A 2LXEA 2MJ5B 1J7KA 3UMMA 1P3QQ 3U6CA 3GITA 3CF6E 1E94E 3CTWB 4LJAA 1ORYB 1QAMA 4OW0A 4IBDA 4LFAM 3UZUA 3U5ZB 2P5TA 3VDPA 4F1IA 3VK7A 1QDRA 1HQCA 2FNAA 4K0KM 2D7GA 2HAKA 3QYEA 3SAVA 3GLGB 2QQ8A 4R7GA 1UM8A 4DBGB 2LBCA 2DZNB 3A98B 3K92A 5EP2A 5IREB 5H3XA 3AOEA 4Z8XA 4QHTA 4AG6A 3ILKA 1HNWM 2Y0TA 5JI2E 4IBKA 5DYGA 4GMQA 3Q8XA 2L7HA 2Y0QA 2JY5A 4DV4M 1DGHB 2JZ1A 3J2PB 1TH4A 2C98A 2Z8YM 3SC3A 1IN5A 2LVQD 4LF7M 1G71A 3GQ5A 2JY8A 5BR8M 3PFIA 5GKNA 4NRVA 1TH3A 4MGZE 4ZPXA 1OAOC 1XXHA 1OIPA 1T43A 4AQYM 3RFWA 1NVMA 4LJ4A 4KODA 2QP9X 1QZMA 2CV0A 1N33M 4B08A 5KPRA 2KXEA 1ZMUA 4LRTA 3L28A 3QYBA 4L6V6 2YQZA 4GH9A 2K47A 2QPAA 1HR0M 1L1ZA 2QBYA 1ZMVA 3JR5A 4DV0M 2R62A 3RE8A 2R4JA 1IQPA 1H6UA 3TPZA 3AV0A 3IG8A 3KP1E 4ANRA 4OVZB 4LGMA 1IY1A 3UJNA 3GLFB 5IWAM 1IN6A 1NSFA 2ZBKB 2XSZD 3C58A 1ZMWA 2YR0A
chains in the Genus database with same CATH topology
4HLQA 3TL4X 4LZJA 2W82A 1W5SA 4GKKM 3VFDA 3SHGB 7CATA 3SMSA 4FWDA 4LJ9A 4DR7M 3RGSA 4TUWA 3UGJA 1G4AE 2KRUA 1IBMM 3GQ4A 3THGA 3LVVA 3NWLA 3GLHB 3HJQA 5KQ8A 3VKGA 4XGIA 3TE6A 3W0LB 3L25A 5FSWA 3L2AA 4MGHA 3U6LA 4B3MM 3M7GA 4FCVA 3A45A 4Z6YA 3LVWA 2G8LA 1TGUA 3HJSA 4IBGA 1G59A 2DWZB 4IBJA 3TWMA 3JR4A 4PT5A 2Q2EB 3K1JA 3DA1A 2CV2A 1QAQA 1R2ZA 5EP1A 3GQ3A 1EE8A 5LMNM 3D8BA 1XHBA 4X66M 2QENA 4JI5M 1Q3CA 2CE7A 4S12A 8CATA 2UUCM 2R18A 3JAMS 1R2YA 2EO2A 4QNMA 3AKZA 2YNMD 3DOAA 4II7A 1PM5A 5EP4A 3SYKA 3T15A 4IBIA 3DFZA 1JR3D 1IY2A 2KEBA 1PJJA 3FYCA 1TDZA 5ITYA 1J5EM 1T3TA 4FVMA 3SMPA 3U6OA 3FUTA 4W5WA 3T1HM 3GPUA 3HHWA 2F5SA 2CV1A 1K3WA 2FOIC 2RKOA 2R45A 1QANA 1Z6TA 1S3SA 3PNYA 5FTJA 3VK8A 3TWLA 4NXNM 2KW0A 1IN7A 2UUBM 4G4NA 4LRSA 2AHMA 2XSZA 2DZOB 3AL0C 1XXHB 2EA0A 1HNZM 4JN6A 3HGIA 2XFSA 1IXRC 3KDSE 4RF0A 2X49A 3FD9A 2XZFA 4AI6A 3I4YA 1R7RA 1KYIA 4R3DA 4JI8M 5A2QS 4JV5M 1IY0A 3M6AA 4IBEA 5EQTA 4PDGA 4IBBA 3SARA 3CF0A 3U61A 4OU7A 1GLNA 2F5PA 4QOSA 4GHAA 2LH0A 3KOYE 4JI3M 1YE9A 1GL6A 3FYDA 2Z4SA 2DVWB 1XNQM 2C96A 4NSRA 4M0WA 2EUCA 4HL4A 2DWLA 2DWNA 4M9ZA 4WW0A 2KZUA 2CHVA 3L26A 4PCZA 1KFVA 4LF5M 3HJ8A 4JI2M 4IBCA 2KZSA 2R46A 2Y20A 2XGNA 2YFQA 2XLJA 2VQFM 1XC8A 4YY3M 3U6QA 3U6EA 4LFBM 4L4UA 2L09A 3FKEA 4DUYM 4GC9A 3OTOM 1G3IA 2NQ8C 2VQEM 3HHXA 4DR2M 3FTEA 3EIHA 1GVNA 3SHFA 1YSYA 1JR3A 4NRWA 2BNKA 3IG5A 4L8RC 3GLIA 1IN8A 1N75A 5JI3E 4CHTB 5ITQA 1HT1E 5IZ7D 4NL4H 4M9SA 5C18A 1FJGM 4GC5A 4D82A 1XNRM 2ZAMA 5FTNA 3U6DA 4LZZA 4B3TM 2HL7A 5FTLA 1NNUC 4PD2A 3R8FA 3KP0E 3SAUA 4GITA 2QCUA 2UUAM 4LFCM 2F5QA 2LWXA 5EXPA 2R4EA 4AKHA 3HHYA 1I4WA 4AZFA 1SXJA 4IBFA 3KSJA 5EXSA 4JI4M 4MGYE 1N36M 2V6ZM 4QNRA 3PVSA 3GLGA 4GKJM 3GLFA 2KA6B 4L15A 3WHLA 1SXJE 4M9XA 4QHSA 4NSOB 3HU3A 2ERCA 3E4RA 3GRYA 4DV3M 3ZCBB 2I7PA 2XH9A 3KVWA 3GRUA 4BBAA 1Z5AA 1DO2A 1NNJA 2VIIA 1XWIA 4QOZC 5KPTA 3FUWA 2HKJA 1QYRA 4I81A 2Z4RA 4LF6M 3RGPA 1Q39A 1Q3BA 4IIWA 4JI6M 3TWKA 3J27B 4MH0E 3J7BA 3EIEA 3SASA 4XBOA 2R65A 1IXZA 3KW6A 3PXGA 2D7HA 1NHGC 4LF4M 5EP3A 2CEAA 4MB7A 3T38A 4CISA 4KHPM 1OFIA 3AFHA 3FTDA 1Z5BA 1IBLM 2UXCM 1NHWC 3UK6A 2CFOA 3DZDA 1E9RA 4B3RM 1X37A 1ZAEA 3M0EA 4LG2A 2J7NA 4GIPA 3VDUA 1HQYE 1HNXM 3LQRA 2CHGA 5H37D 1GL7A 3U60A 2D7EA 3K8ZA 3KS4A 4MGIE 1L1TA 3QWLA 2F5NA 4LF8M 3GPPA 4DR1M 5ITRA 3HU1A 5FLXS 3SBJA 4AKIA 3A42A 4LJ6A 4IJEA 1L2CA 1MU5A 2G5GX 1NY5A 2JA2A 2KRKA 4L78A 3GPYA 2F5OA 3U6MA 1I94M 2I7NA 5FTKA 3SAWA 3KXEC 4BB9A 2HHHM 3KOWE 4FW9A 1R6BX 1N34M 4WURA 1SXJC 4KO8A 1OFHA 4DV7M 1J09A 2XEPA 3SATA 4FWHA 4X62M 1SXJB 3U5ZA 3FUUA 3J80S 3HU2A 3HWSA 3U61B 3MJ5A 2ZM6M 4AKGA 3MHVC 4LJ8A 2CUZA 4G4OA 4CGYB 3J7AS 3AOGA 4AW4A 2C9OA 5KQDA 2FFJA 2DHRA 4DV1M 2QZ4A 2V1CA 1K82A 4OX9M 2UXDM 1QAOA 4MM3B 1QVRA 4BLCA 1E9SA 1IBKM 3I4VA 3GPXA 1G41A 2C9CA 1K3XA 3HKPA 2C5RA 1MX0A 5KO3A 1TDHA 3L27A 2HCBA 5ITXA 4NOOB 4DV2M 1PJIA 1ZQ9A 4P16A 1N77A 3L29A 5IT9S 2E5LM 3TQSA 2XFTA 4G4QA 4DR5M 2X8AA 4AG5A 3I51A 4KLNA 2Y21A 2M5ZA 1G8PA 1HT2E 5C1BA 1VDDA 3FTCA 2UU9M 2QBYB 4I4LA 4OVZA 4B7HA 1KSFX 2DXIA 3KS8A 4JI1M 1SXJD 4DV5M 4FCWA 4RNAA 1N78A 4B7FA 4JYAM 4EIWA 1NJGA 4LGYA 4G4RA 3B9PA 3W0FA 1IN4A 2O5RA 4LCBA 4M0DA 2L7IA 4I5SA 3GRRA 3QAUA 4JXJA 4DV6M 1W5TA 3KFUG 3E9SA 3ZC7B 2A5YB 4IJFA 4LF9M 2L6OA 3WHKA 1TH2A 4B3SM 5FTMA 4L16A 3GP1A 2ZAOA 3J81S 3VLFB 5LMUM 2LNHC 1QQWA 4I8OA 1YUBA 2XZUA 3CF2A 1XMQM 3ZH9B 3VKHA 4PDIA 2C99A 5DNYA 3GLHA 3R9XB 3GRVA 1DGFA 1DO0A 5BPVA 3U6SA 4G6ZA 4GHLA 5EJCA 3U6PA 1LV7A 3AJIB 2BJWA 3KSXA 4FD2A 4LJ7A 1C1KA 1NY6A 1L8QA 3BOSA 4A3VB 4RF1A 4YHHM 1Z5CA 4D80A 5KPZA 1NJFA 4FWGA 1XMOM 1OJLA 4B7GA 4JI0M 5ITTA 3KOXE 4ITQA 2OPFA 2ZANA 3SYLA 1GKIA 3KOZE 4JI7M 1Z59A 2CHQA 2H1RA 3NBIA 3MK6A 4X65M 1WXQA 3U60B 2X4AA 4LY6A 3GO8A 1IXSB 1L2DA 3FTFA 1JQJC 2UXBM 3PNVA 2J7OA 4GRIA 5E26A 2DWMA 2V1UA 4DR6M 3K2LA 5EXXA 1N32M 2F4VM 1D2NA 4REZA 4FCTA 2Z7JA 4NXMM 5F3WA 1L2BA 3D8LA 3LMMA 3LQQA 5E6JA 4DR4M 5DYIA 2FE8A 3HHZA 2Z3XA 3T1YM 3FUVA 2RGOA 5ITUA 2M60A 1DGHA 1FNNA 3AOEC 3FUXA 2BJVA 5EXTA 4D81A 4DUZM 3H4MA 1IM2A 1DGBA 4MGKE 2OQ4A 3SFZA 3GLIB 4DR3M 5ITXE 3A46A 1E32A 1DGGA 2XF3A 4LJ5A 2RGHA 4X64M 2LXEA 1J7KA 3UMMA 3U6CA 3CF6E 1E94E 3CTWB 4LJAA 1ORYB 1QAMA 4OW0A 4IBDA 4LFAM 3UZUA 3U5ZB 2P5TA 3VDPA 3VK7A 1HQCA 2FNAA 4K0KM 2D7GA 3SAVA 3GLGB 4R7GA 1UM8A 2DZNB 3A98B 3K92A 5EP2A 5IREB 5H3XA 3AOEA 4Z8XA 4QHTA 4AG6A 3ILKA 1HNWM 2Y0TA 5JI2E 4IBKA 5DYGA 4GMQA 3Q8XA 2L7HA 2Y0QA 4DV4M 1DGHB 3J2PB 1TH4A 2C98A 3SC3A 1IN5A 4LF7M 3GQ5A 5BR8M 5GKNA 4NRVA 1TH3A 4MGZE 4ZPXA 1XXHA 4AQYM 3RFWA 1NVMA 4LJ4A 4KODA 2QP9X 1QZMA 2CV0A 1N33M 4B08A 5KPRA 2KXEA 4LRTA 3L28A 2YQZA 4GH9A 2K47A 2QPAA 1HR0M 1L1ZA 2QBYA 4DV0M 3JR5A 2R62A 3RE8A 2R4JA 1IQPA 1H6UA 3TPZA 3AV0A 3IG8A 3KP1E 3UJNA 4OVZB 4LGMA 1IY1A 3GLFB 5IWAM 1IN6A 1NSFA 2ZBKB 2XSZD 3C58A 3PFIA 2YR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 M;  5ITT A;  3OTO M;  4DV7 M;  4ITQ A;  2OPF A;  2VQE M;  4DR2 M;  3SAT A;  4X62 M;  4JI7 M;  4GKK M;  1Z59 A;  3J80 S;  4DR7 M;  4X65 M;  2ZM6 M;  4NRW A;  3GO8 A;  1L2D A;  2UXB M;  1IBM M;  3GQ4 A;  4G4O A;  3J7A S;  4DR6 M;  5ITQ A;  1N32 M;  1FJG M;  4NXM M;  2F4V M;  4DV1 M;  1XNR M;  1L2B A;  3U6D A;  4B3T M;  3U6L A;  1K82 A;  4B3M M;  4OX9 M;  2UXD M;  3A45 A;  4DR4 M;  4PD2 A;  1IBK M;  3TWM A;  3JR4 A;  3GPX A;  2Q2E B;  3SAU A;  3T1Y M;  1K3X A;  1MX0 A;  2UUA M;  1TDH A;  5ITU A;  4DUZ M;  1R2Z A;  2F5Q A;  4LFC M;  5ITX A;  3GQ3 A;  1EE8 A;  5LMN M;  4DV2 M;  1PJI A;  4X66 M;  4JI5 M;  4JI4 M;  1Q3C A;  1N36 M;  5IT9 S;  2OQ4 A;  4DR3 M;  2UUC M;  3JAM S;  5ITX E;  1R2Y A;  2E5L M;  3A46 A;  4G4Q A;  4DR5 M;  4GKJ M;  3DOA A;  1PM5 A;  4X64 M;  3U6C A;  1PJJ A;  1TDZ A;  1J5E M;  5ITY A;  4LFA M;  4DV3 M;  3VK7 A;  2UU9 M;  3U6O A;  3T1H M;  1Z5A A;  3GPU A;  4K0K M;  1NNJ A;  2F5S A;  3SAV A;  2HKJ A;  1K3W A;  4JI1 M;  4DV5 M;  1XMO M;  4LF6 M;  1Q39 A;  1Q3B A;  4JI6 M;  4JYA M;  3TWK A;  3TWL A;  4NXN M;  3VK8 A;  3SAS A;  5H3X A;  2UUB M;  4G4N A;  4G4R A;  1HNW M;  3W0F A;  2EA0 A;  1HNZ M;  4LF4 M;  4MB7 A;  4CIS A;  2XZF A;  4DV4 M;  4KHP M;  4DV6 M;  1Z5B A;  1IBL M;  4JI8 M;  4LF9 M;  4LF7 M;  5A2Q S;  3GQ5 A;  4B3S M;  5BR8 M;  4JV5 M;  2UXC M;  4NRV A;  4PDG A;  4B3R M;  3GP1 A;  3SAR A;  3J81 S;  1N34 M;  5LMU M;  2F5P A;  1HNX M;  4AQY M;  1XMQ M;  2XZU A;  4JI3 M;  4PDI A;  1XNQ M;  2F5N A;  1L1T A;  1N33 M;  4LF8 M;  3GPP A;  3U6S A;  4DR1 M;  5ITR A;  3U6P A;  5FLX S;  3SBJ A;  3A42 A;  1HR0 M;  1L1Z A;  1L2C A;  4PCZ A;  4DV0 M;  1MU5 A;  3JR5 A;  1KFV A;  3GPY A;  2F5O A;  4JI2 M;  4LF5 M;  2VQF M;  1XC8 A;  3U6M A;  1I94 M;  4YHH M;  4YY3 M;  1Z5C A;  3U6Q A;  3SAW A;  3U6E A;  5IWA M;  4LFB M;  2HHH M;  2ZBK B;  4DUY M;  3C58 A; 
#chains in the Genus database with same CATH topology
 4HLQ A;  3TL4 X;  4LZJ A;  1QUT A;  2W82 A;  2ZTC A;  1W5S A;  4GKK M;  3VFD A;  3SHG B;  7CAT A;  3SMS A;  4FWD A;  4LJ9 A;  4DR7 M;  3RGS A;  2DAI A;  2JUJ A;  4TUW A;  3UGJ A;  1G4A E;  2KRU A;  1IBM M;  3GQ4 A;  2OO9 A;  1VDL A;  2BWB A;  3THG A;  3LVV A;  3NWL A;  3GLH B;  3HJQ A;  5KQ8 A;  3VKG A;  3ZQJ A;  4XGI A;  3TE6 A;  3W0L B;  3L25 A;  1VQ1 A;  2EKK A;  5FSW A;  3L2A A;  1LTM A;  4MGH A;  3U6L A;  1WHC A;  4B3M M;  3M7G A;  4FCV A;  3A45 A;  4Z6Y A;  3LVW A;  2G8L A;  1TGU A;  1MJG M;  2CWB A;  3HJS A;  1V92 A;  2DWZ B;  2MH8 A;  4IBG A;  4IBJ A;  4XK8 F;  4PT5 A;  2Q2E B;  3JR4 A;  3GLF E;  3TWM A;  3K1J A;  3DA1 A;  2CV2 A;  1QAQ A;  1R2Z A;  4WP2 A;  5EP1 A;  3GQ3 A;  1EE8 A;  5LMN M;  3D8B A;  4RKU F;  3FRH A;  1XHB A;  2K9D A;  4X66 M;  2QEN A;  4JI5 M;  1Q3C A;  2CE7 A;  4S12 A;  8CAT A;  2UUC M;  2R18 A;  3JAM S;  1R2Y A;  2EO2 A;  4QNM A;  3AKZ A;  2YNM D;  3DOA A;  4II7 A;  1QUS A;  1PM5 A;  5EP4 A;  3SYK A;  1IXS A;  1EFU B;  4IBI A;  1VEK A;  1VEG A;  3T15 A;  3DFZ A;  1JR3 D;  1IY2 A;  2KEB A;  1PJJ A;  3FYC A;  1TDZ A;  5ITY A;  1J5E M;  1T3T A;  1QZE A;  2RRU A;  4FVM A;  3SMP A;  3U6O A;  2JNH A;  2DZL A;  3FUT A;  4W5W A;  3T1H M;  3GPU A;  3HHW A;  2F5S A;  4G3O A;  2CV1 A;  2DKL A;  2ZTD A;  2FOI C;  2JWS A;  2RKO A;  4CJ6 A;  1K3W A;  2R45 A;  1QAN A;  1Z6T A;  1S3S A;  3PNY A;  5FTJ A;  3VK8 A;  3TWL A;  2EKF A;  1XB2 B;  1IN7 A;  2KW0 A;  4NXN M;  2UUB M;  4G4N A;  4LRS A;  2AHM A;  2XSZ A;  2DZO B;  3AL0 C;  1XXH B;  2EA0 A;  3K9O A;  1HNZ M;  2KNV A;  2O25 A;  4JN6 A;  1PGY A;  1R5L A;  2XFS A;  3HGI A;  1AUA A;  1IXR C;  2KNA A;  2LVP C;  2X49 A;  3FD9 A;  3KDS E;  4RF0 A;  3I4Y A;  2XZF A;  4AI6 A;  1R7R A;  1KYI A;  4Q7J A;  4R3D A;  2QHO B;  4JI8 M;  5A2Q S;  4JV5 M;  3IEC A;  1WIV A;  2QSF X;  1IY0 A;  2LHC A;  3M6A A;  4IBE A;  1V34 A;  5EQT A;  4IBB A;  4PDG A;  1D0K A;  3B7N A;  3CF0 A;  3BXW A;  3SAR A;  2B3T A;  3U61 A;  4OU7 A;  1GLN A;  3W67 A;  4QOS A;  2F5P A;  4GHA A;  2LH0 A;  3KOY E;  4JI3 M;  1YE9 A;  1GL6 A;  3FYD A;  2Z4S A;  2DVW B;  1IFY A;  1AIP C;  1XNQ M;  2C96 A;  4NSR A;  4M0W A;  2EUC A;  1G59 A;  4HL4 A;  2DWL A;  1OKS A;  2DWN A;  1BVS A;  4M9Z A;  4WW0 A;  2KZU A;  2CHV A;  3L26 A;  4PCZ A;  1KFV A;  4LF5 M;  3HJ8 A;  4JI2 M;  2DNA A;  1GO5 A;  4IBC A;  2KZS A;  2R46 A;  2Y20 A;  2XGN A;  2YFQ A;  2XLJ A;  2VQF M;  1XC8 A;  1DV0 A;  4YY3 M;  3U6Q A;  3U6E A;  3IHP A;  4LFB M;  4P17 A;  3T6P A;  4L4U A;  2L09 A;  3FKE A;  4DUY M;  4GC9 A;  3OTO M;  3FE3 A;  1G3I A;  3LCU A;  2NQ8 C;  2VQE M;  3HHX A;  1Y8G A;  4DR2 M;  1GJT A;  2K6B A;  3EIH A;  3FTE A;  2DAM A;  1GVN A;  3SHF A;  3FRI A;  2OOA A;  2L4F A;  1TR8 A;  2OOB A;  1YSY A;  3B89 A;  1JR3 A;  1EIJ A;  4NRW A;  2GQF A;  2BNK A;  3IG5 A;  4L8R C;  2LVO C;  3GLI A;  1PRB A;  1IN8 A;  1N75 A;  5JI3 E;  4CHT B;  4R71 A;  5ITQ A;  1HT1 E;  5IZ7 D;  4NL4 H;  4M9S A;  5C18 A;  1FJG M;  2VF8 A;  3F92 A;  4GC5 A;  4D82 A;  1XNR M;  2ZAM A;  5DFL A;  5FTN A;  3K9P A;  3MMP A;  4LZZ A;  2WZJ A;  3U6D A;  4B3T M;  2HL7 A;  2JXN A;  2DHY A;  5FTL A;  1NNU C;  2FS1 A;  4PD2 A;  1GJS A;  3R8F A;  3KP0 E;  3B74 A;  3SAU A;  4GIT A;  4KT0 F;  1Q02 A;  4HEO A;  1PJQ A;  2QCU A;  2UUA M;  4LFC M;  2F5Q A;  2LWX A;  5EXP A;  2R4E A;  4AKH A;  3HHY A;  1I4W A;  4AZF A;  1SXJ A;  4IBF A;  3KSJ A;  5EXS A;  4JI4 M;  4MGY E;  1N36 M;  2R0I A;  2V6Z M;  4QNR A;  3BSU A;  2FH0 A;  2BWE A;  3PVS A;  2LHG A;  3GLG E;  3GLG A;  1RU3 A;  2CP8 A;  4GKJ M;  3GLF A;  2KA6 B;  4L15 A;  3WHL A;  1SXJ E;  4M9X A;  2R44 A;  4QHS A;  2LTU A;  4NSO B;  3HU3 A;  2ERC A;  1PJT A;  3E4R A;  2DAE A;  3GRY A;  4DV3 M;  3C3E A;  3ZCB B;  2I7P A;  2XH9 A;  3KVW A;  3GRU A;  4BBA A;  1Z5A A;  3GLI E;  1DO2 A;  1TTE A;  2VII A;  1XWI A;  1NNJ A;  5KPT A;  4QOZ C;  1OTR A;  3FUW A;  3Q8G A;  2HKJ A;  1QYR A;  4I81 A;  3NBX X;  2Z4R A;  4LF6 M;  3RGP A;  1Q39 A;  1Q3B A;  4IIW A;  4JI6 M;  2GNO A;  3HX3 A;  3J27 B;  2KHH A;  3J7B A;  3EIE A;  4MH0 E;  3TWK A;  3SAS A;  4XBO A;  2R65 A;  1IXZ A;  2LVA A;  3KW6 A;  3PXG A;  2D7H A;  1NHG C;  3HY5 A;  4LF4 M;  5EP3 A;  2CEA A;  2WSF F;  4MB7 A;  3T38 A;  4CIS A;  4CIZ A;  4KHP M;  1OFI A;  3AFH A;  3FTD A;  1ZV1 A;  1Z5B A;  1HJP A;  2MR9 A;  1IBL M;  2APL A;  3E46 A;  2UXC M;  1NHW C;  3UK6 A;  2CFO A;  1MN3 A;  1E9R A;  3DZD A;  2MRO B;  4B3R M;  1X37 A;  1ZAE A;  3M0E A;  4LG2 A;  2J7N A;  3HZJ A;  4GIP A;  3VDU A;  1HQY E;  1HNX M;  3LQR A;  2CHG A;  3C3D A;  5H37 D;  1GL7 A;  3U60 A;  2D7E A;  3K8Z A;  3KS4 A;  2H5X A;  4MGI E;  3QWL A;  1L1T A;  2DAG A;  2F5N A;  4LF8 M;  3GPP A;  4AKI A;  3H4J A;  4DR1 M;  5ITR A;  1PJS A;  1XXH E;  3HU1 A;  1NV8 A;  5FLX S;  3SBJ A;  2QNJ A;  3A42 A;  4LJ6 A;  2WSE F;  4IJE A;  1L2C A;  4F2L A;  1MU5 A;  2KRK A;  2G5G X;  1NY5 A;  2DEN A;  2JA2 A;  4L78 A;  2CRU A;  3GPY A;  2F5O A;  3U6M A;  1I94 M;  1GAB A;  2I7N A;  5FTK A;  3SAW A;  3KXE C;  4BB9 A;  2HHH M;  3KOW E;  4FW9 A;  1R6B X;  1N34 M;  4WUR A;  1SXJ C;  2L2D A;  1OFH A;  4KO8 A;  4DV7 M;  1J09 A;  1T6O A;  2XEP A;  3SAT A;  4FWH A;  4X62 M;  1SXJ B;  2EJS A;  3U5Z A;  4NC6 A;  1QHK A;  3FUU A;  3J80 S;  3HU2 A;  3HWS A;  4UN2 B;  3U61 B;  3MJ5 A;  2ZM6 M;  1D0L A;  4AKG A;  2G3Q A;  3CGW A;  3MHV C;  4LJ8 A;  4GEW A;  2CUZ A;  4G4O A;  4CGY B;  3J7A S;  3AOG A;  4AW4 A;  2C9O A;  5KQD A;  2FFJ A;  2WSC F;  2DHR A;  4DV1 M;  2QZ4 A;  1F4I A;  2V1C A;  1K82 A;  4OX9 M;  2UXD M;  3LW5 F;  1QAO A;  4MM3 B;  1QVR A;  4BLC A;  1E9S A;  2LVN C;  1IBK M;  3BL4 A;  1TF0 B;  3I4V A;  3GPX A;  1G41 A;  2C9C A;  1K3X A;  2R6F A;  3HKP A;  1MX0 A;  5KO3 A;  1TDH A;  2C5R A;  3L27 A;  1WJ7 A;  2HCB A;  5ITX A;  1VG5 A;  4NOO B;  4DV2 M;  1PJI A;  1ZQ9 A;  3E21 A;  4P16 A;  1N77 A;  3L29 A;  5IT9 S;  2E5L M;  3TQS A;  2XFT A;  4G4Q A;  4DR5 M;  2X8A A;  4Y28 F;  3B7Z A;  2HWJ A;  4AG5 A;  1OIZ A;  3I51 A;  4KLN A;  2Y21 A;  2M5Z A;  2DI0 A;  1G8P A;  1HT2 E;  5C1B A;  1VDD A;  3FTC A;  2UU9 M;  1CUK A;  1VEJ A;  2QBY B;  4I4L A;  4OVZ A;  4B7H A;  1KSF X;  2DXI A;  3KS8 A;  4JI1 M;  1SXJ D;  4DV5 M;  1JR3 E;  4FCW A;  4RNA A;  1N78 A;  3W68 A;  4B7F A;  4JYA M;  4EIW A;  1NJG A;  4LGY A;  4G4R A;  3I01 M;  3B9P A;  3V76 A;  3W0F A;  1IN4 A;  2O5R A;  4LCB A;  3C9P A;  4M0D A;  2L7I A;  4I5S A;  1SG9 A;  3GRR A;  3QAU A;  4JXJ A;  4DV6 M;  1W5T A;  3KFU G;  3E9S A;  3ZC7 B;  1V33 A;  2A5Y B;  2MGW A;  4IJF A;  4LF9 M;  2L6O A;  3WHK A;  1TH2 A;  5L8R F;  4B3S M;  1YLA A;  4L16 A;  5FTM A;  3GP1 A;  2ZAO A;  3BBZ A;  2JY6 B;  3J81 S;  3VLF B;  5LMU M;  2LNH C;  1QQW A;  2N35 A;  4I8O A;  1YUB A;  2XZU A;  3CF2 A;  1XMQ M;  3ZH9 B;  3VKH A;  1WGL A;  4PDI A;  2C99 A;  5DNY A;  3GLH A;  3R9X B;  3GRV A;  1DGF A;  1NV9 A;  1DO0 A;  5BPV A;  3LCV B;  3U6S A;  4G6Z A;  4GHL A;  5EJC A;  3U6P A;  2KNZ A;  2DAK A;  1LV7 A;  3AJI B;  2BJW A;  3KSX A;  3GLH E;  4FD2 A;  4LJ7 A;  1C1K A;  1NY6 A;  1OQY A;  1L8Q A;  3BOS A;  4A3V B;  1NO1 A;  4RF1 A;  1UFZ A;  2VDB B;  4YHH M;  3PMQ A;  1Z5C A;  4D80 A;  5KPZ A;  1NJF A;  4FWG A;  1A5T A;  2J5Y A;  1XMO M;  1OJL A;  4B7G A;  4JI0 M;  5ITT A;  3KOX E;  4ITQ A;  2OPF A;  2ZAN A;  3SYL A;  1JB0 F;  1GKI A;  3KOZ E;  4JI7 M;  1Z59 A;  1OAI A;  2CHQ A;  2H1R A;  3NBI A;  3MK6 A;  2VF7 A;  4X65 M;  1WXQ A;  3U60 B;  2O01 F;  2X4A A;  4LY6 A;  3GO8 A;  2K0B X;  1IXS B;  1L2D A;  3FTF A;  1JQJ C;  2UXB M;  2JY7 A;  3PNV A;  3I04 M;  2J7O A;  4GRI A;  5E26 A;  2DWM A;  2V1U A;  4DR6 M;  3K2L A;  2JZ0 A;  5EXX A;  1N32 M;  2F4V M;  1D2N A;  4REZ A;  4FCT A;  2Z7J A;  3B7Q A;  5F3W A;  1D0M A;  4NXM M;  1L2B A;  3D8L A;  3LMM A;  3LQQ A;  5E6J A;  4DR4 M;  5DYI A;  2FE8 A;  3HHZ A;  2Z3X A;  3T1Y M;  1QDT A;  1R4G A;  3FUV A;  2KDL A;  2RGO A;  5ITU A;  2M60 A;  1DGH A;  1FNN A;  3AOE C;  3FUX A;  1WGN A;  2BJV A;  5EXT A;  4D81 A;  4DUZ M;  3H4M A;  1IM2 A;  1DGB A;  1C7Y A;  4MGK E;  2OQ4 A;  3SFZ A;  3GLI B;  4DR3 M;  5ITX E;  3A46 A;  1E32 A;  1DGG A;  2XF3 A;  2L4E A;  2RGH A;  4LJ5 A;  4X64 M;  1WR1 B;  2JP7 A;  2LXE A;  2MJ5 B;  1J7K A;  3UMM A;  1P3Q Q;  3U6C A;  3GIT A;  3CF6 E;  1E94 E;  3CTW B;  4LJA A;  1ORY B;  1QAM A;  4OW0 A;  4IBD A;  4LFA M;  3UZU A;  3U5Z B;  2P5T A;  3VDP A;  4F1I A;  3VK7 A;  1QDR A;  1HQC A;  2FNA A;  4K0K M;  2D7G A;  2HAK A;  3QYE A;  3SAV A;  3GLG B;  2QQ8 A;  4R7G A;  1UM8 A;  4DBG B;  2LBC A;  2DZN B;  3A98 B;  3K92 A;  5EP2 A;  5IRE B;  5H3X A;  3AOE A;  4Z8X A;  4QHT A;  4AG6 A;  3ILK A;  1HNW M;  2Y0T A;  5JI2 E;  4IBK A;  5DYG A;  4GMQ A;  3Q8X A;  2L7H A;  2Y0Q A;  2JY5 A;  4DV4 M;  1DGH B;  2JZ1 A;  3J2P B;  1TH4 A;  2C98 A;  2Z8Y M;  3SC3 A;  1IN5 A;  2LVQ D;  4LF7 M;  1G71 A;  3GQ5 A;  2JY8 A;  5BR8 M;  3PFI A;  5GKN A;  4NRV A;  1TH3 A;  4MGZ E;  4ZPX A;  1OAO C;  1XXH A;  1OIP A;  1T43 A;  4AQY M;  3RFW A;  1NVM A;  4LJ4 A;  4KOD A;  2QP9 X;  1QZM A;  2CV0 A;  1N33 M;  4B08 A;  5KPR A;  2KXE A;  1ZMU A;  4LRT A;  3L28 A;  3QYB A;  4L6V 6;  2YQZ A;  4GH9 A;  2K47 A;  2QPA A;  1HR0 M;  1L1Z A;  2QBY A;  1ZMV A;  3JR5 A;  4DV0 M;  2R62 A;  3RE8 A;  2R4J A;  1IQP A;  1H6U A;  3TPZ A;  3AV0 A;  3IG8 A;  3KP1 E;  4ANR A;  4OVZ B;  4LGM A;  1IY1 A;  3UJN A;  3GLF B;  5IWA M;  1IN6 A;  1NSF A;  2ZBK B;  2XSZ D;  3C58 A;  1ZMW A;  2YR0 A; 
#chains in the Genus database with same CATH homology
 4HLQ A;  3TL4 X;  4LZJ A;  2W82 A;  1W5S A;  4GKK M;  3VFD A;  3SHG B;  7CAT A;  3SMS A;  4FWD A;  4LJ9 A;  4DR7 M;  3RGS A;  4TUW A;  3UGJ A;  1G4A E;  2KRU A;  1IBM M;  3GQ4 A;  3THG A;  3LVV A;  3NWL A;  3GLH B;  3HJQ A;  5KQ8 A;  3VKG A;  4XGI A;  3TE6 A;  3W0L B;  3L25 A;  5FSW A;  3L2A A;  4MGH A;  3U6L A;  4B3M M;  3M7G A;  4FCV A;  3A45 A;  4Z6Y A;  3LVW A;  2G8L A;  1TGU A;  3HJS A;  4IBG A;  1G59 A;  2DWZ B;  4IBJ A;  3TWM A;  3JR4 A;  4PT5 A;  2Q2E B;  3K1J A;  3DA1 A;  2CV2 A;  1QAQ A;  1R2Z A;  5EP1 A;  3GQ3 A;  1EE8 A;  5LMN M;  3D8B A;  1XHB A;  4X66 M;  2QEN A;  4JI5 M;  1Q3C A;  2CE7 A;  4S12 A;  8CAT A;  2UUC M;  2R18 A;  3JAM S;  1R2Y A;  2EO2 A;  4QNM A;  3AKZ A;  2YNM D;  3DOA A;  4II7 A;  1PM5 A;  5EP4 A;  3SYK A;  3T15 A;  4IBI A;  3DFZ A;  1JR3 D;  1IY2 A;  2KEB A;  1PJJ A;  3FYC A;  1TDZ A;  5ITY A;  1J5E M;  1T3T A;  4FVM A;  3SMP A;  3U6O A;  3FUT A;  4W5W A;  3T1H M;  3GPU A;  3HHW A;  2F5S A;  2CV1 A;  1K3W A;  2FOI C;  2RKO A;  2R45 A;  1QAN A;  1Z6T A;  1S3S A;  3PNY A;  5FTJ A;  3VK8 A;  3TWL A;  4NXN M;  2KW0 A;  1IN7 A;  2UUB M;  4G4N A;  4LRS A;  2AHM A;  2XSZ A;  2DZO B;  3AL0 C;  1XXH B;  2EA0 A;  1HNZ M;  4JN6 A;  3HGI A;  2XFS A;  1IXR C;  3KDS E;  4RF0 A;  2X49 A;  3FD9 A;  2XZF A;  4AI6 A;  3I4Y A;  1R7R A;  1KYI A;  4R3D A;  4JI8 M;  5A2Q S;  4JV5 M;  1IY0 A;  3M6A A;  4IBE A;  5EQT A;  4PDG A;  4IBB A;  3SAR A;  3CF0 A;  3U61 A;  4OU7 A;  1GLN A;  2F5P A;  4QOS A;  4GHA A;  2LH0 A;  3KOY E;  4JI3 M;  1YE9 A;  1GL6 A;  3FYD A;  2Z4S A;  2DVW B;  1XNQ M;  2C96 A;  4NSR A;  4M0W A;  2EUC A;  4HL4 A;  2DWL A;  2DWN A;  4M9Z A;  4WW0 A;  2KZU A;  2CHV A;  3L26 A;  4PCZ A;  1KFV A;  4LF5 M;  3HJ8 A;  4JI2 M;  4IBC A;  2KZS A;  2R46 A;  2Y20 A;  2XGN A;  2YFQ A;  2XLJ A;  2VQF M;  1XC8 A;  4YY3 M;  3U6Q A;  3U6E A;  4LFB M;  4L4U A;  2L09 A;  3FKE A;  4DUY M;  4GC9 A;  3OTO M;  1G3I A;  2NQ8 C;  2VQE M;  3HHX A;  4DR2 M;  3FTE A;  3EIH A;  1GVN A;  3SHF A;  1YSY A;  1JR3 A;  4NRW A;  2BNK A;  3IG5 A;  4L8R C;  3GLI A;  1IN8 A;  1N75 A;  5JI3 E;  4CHT B;  5ITQ A;  1HT1 E;  5IZ7 D;  4NL4 H;  4M9S A;  5C18 A;  1FJG M;  4GC5 A;  4D82 A;  1XNR M;  2ZAM A;  5FTN A;  3U6D A;  4LZZ A;  4B3T M;  2HL7 A;  5FTL A;  1NNU C;  4PD2 A;  3R8F A;  3KP0 E;  3SAU A;  4GIT A;  2QCU A;  2UUA M;  4LFC M;  2F5Q A;  2LWX A;  5EXP A;  2R4E A;  4AKH A;  3HHY A;  1I4W A;  4AZF A;  1SXJ A;  4IBF A;  3KSJ A;  5EXS A;  4JI4 M;  4MGY E;  1N36 M;  2V6Z M;  4QNR A;  3PVS A;  3GLG A;  4GKJ M;  3GLF A;  2KA6 B;  4L15 A;  3WHL A;  1SXJ E;  4M9X A;  4QHS A;  4NSO B;  3HU3 A;  2ERC A;  3E4R A;  3GRY A;  4DV3 M;  3ZCB B;  2I7P A;  2XH9 A;  3KVW A;  3GRU A;  4BBA A;  1Z5A A;  1DO2 A;  1NNJ A;  2VII A;  1XWI A;  4QOZ C;  5KPT A;  3FUW A;  2HKJ A;  1QYR A;  4I81 A;  2Z4R A;  4LF6 M;  3RGP A;  1Q39 A;  1Q3B A;  4IIW A;  4JI6 M;  3TWK A;  3J27 B;  4MH0 E;  3J7B A;  3EIE A;  3SAS A;  4XBO A;  2R65 A;  1IXZ A;  3KW6 A;  3PXG A;  2D7H A;  1NHG C;  4LF4 M;  5EP3 A;  2CEA A;  4MB7 A;  3T38 A;  4CIS A;  4KHP M;  1OFI A;  3AFH A;  3FTD A;  1Z5B A;  1IBL M;  2UXC M;  1NHW C;  3UK6 A;  2CFO A;  3DZD A;  1E9R A;  4B3R M;  1X37 A;  1ZAE A;  3M0E A;  4LG2 A;  2J7N A;  4GIP A;  3VDU A;  1HQY E;  1HNX M;  3LQR A;  2CHG A;  5H37 D;  1GL7 A;  3U60 A;  2D7E A;  3K8Z A;  3KS4 A;  4MGI E;  1L1T A;  3QWL A;  2F5N A;  4LF8 M;  3GPP A;  4DR1 M;  5ITR A;  3HU1 A;  5FLX S;  3SBJ A;  4AKI A;  3A42 A;  4LJ6 A;  4IJE A;  1L2C A;  1MU5 A;  2G5G X;  1NY5 A;  2JA2 A;  2KRK A;  4L78 A;  3GPY A;  2F5O A;  3U6M A;  1I94 M;  2I7N A;  5FTK A;  3SAW A;  3KXE C;  4BB9 A;  2HHH M;  3KOW E;  4FW9 A;  1R6B X;  1N34 M;  4WUR A;  1SXJ C;  4KO8 A;  1OFH A;  4DV7 M;  1J09 A;  2XEP A;  3SAT A;  4FWH A;  4X62 M;  1SXJ B;  3U5Z A;  3FUU A;  3J80 S;  3HU2 A;  3HWS A;  3U61 B;  3MJ5 A;  2ZM6 M;  4AKG A;  3MHV C;  4LJ8 A;  2CUZ A;  4G4O A;  4CGY B;  3J7A S;  3AOG A;  4AW4 A;  2C9O A;  5KQD A;  2FFJ A;  2DHR A;  4DV1 M;  2QZ4 A;  2V1C A;  1K82 A;  4OX9 M;  2UXD M;  1QAO A;  4MM3 B;  1QVR A;  4BLC A;  1E9S A;  1IBK M;  3I4V A;  3GPX A;  1G41 A;  2C9C A;  1K3X A;  3HKP A;  2C5R A;  1MX0 A;  5KO3 A;  1TDH A;  3L27 A;  2HCB A;  5ITX A;  4NOO B;  4DV2 M;  1PJI A;  1ZQ9 A;  4P16 A;  1N77 A;  3L29 A;  5IT9 S;  2E5L M;  3TQS A;  2XFT A;  4G4Q A;  4DR5 M;  2X8A A;  4AG5 A;  3I51 A;  4KLN A;  2Y21 A;  2M5Z A;  1G8P A;  1HT2 E;  5C1B A;  1VDD A;  3FTC A;  2UU9 M;  2QBY B;  4I4L A;  4OVZ A;  4B7H A;  1KSF X;  2DXI A;  3KS8 A;  4JI1 M;  1SXJ D;  4DV5 M;  4FCW A;  4RNA A;  1N78 A;  4B7F A;  4JYA M;  4EIW A;  1NJG A;  4LGY A;  4G4R A;  3B9P A;  3W0F A;  1IN4 A;  2O5R A;  4LCB A;  4M0D A;  2L7I A;  4I5S A;  3GRR A;  3QAU A;  4JXJ A;  4DV6 M;  1W5T A;  3KFU G;  3E9S A;  3ZC7 B;  2A5Y B;  4IJF A;  4LF9 M;  2L6O A;  3WHK A;  1TH2 A;  4B3S M;  5FTM A;  4L16 A;  3GP1 A;  2ZAO A;  3J81 S;  3VLF B;  5LMU M;  2LNH C;  1QQW A;  4I8O A;  1YUB A;  2XZU A;  3CF2 A;  1XMQ M;  3ZH9 B;  3VKH A;  4PDI A;  2C99 A;  5DNY A;  3GLH A;  3R9X B;  3GRV A;  1DGF A;  1DO0 A;  5BPV A;  3U6S A;  4G6Z A;  4GHL A;  5EJC A;  3U6P A;  1LV7 A;  3AJI B;  2BJW A;  3KSX A;  4FD2 A;  4LJ7 A;  1C1K A;  1NY6 A;  1L8Q A;  3BOS A;  4A3V B;  4RF1 A;  4YHH M;  1Z5C A;  4D80 A;  5KPZ A;  1NJF A;  4FWG A;  1XMO M;  1OJL A;  4B7G A;  4JI0 M;  5ITT A;  3KOX E;  4ITQ A;  2OPF A;  2ZAN A;  3SYL A;  1GKI A;  3KOZ E;  4JI7 M;  1Z59 A;  2CHQ A;  2H1R A;  3NBI A;  3MK6 A;  4X65 M;  1WXQ A;  3U60 B;  2X4A A;  4LY6 A;  3GO8 A;  1IXS B;  1L2D A;  3FTF A;  1JQJ C;  2UXB M;  3PNV A;  2J7O A;  4GRI A;  5E26 A;  2DWM A;  2V1U A;  4DR6 M;  3K2L A;  5EXX A;  1N32 M;  2F4V M;  1D2N A;  4REZ A;  4FCT A;  2Z7J A;  4NXM M;  5F3W A;  1L2B A;  3D8L A;  3LMM A;  3LQQ A;  5E6J A;  4DR4 M;  5DYI A;  2FE8 A;  3HHZ A;  2Z3X A;  3T1Y M;  3FUV A;  2RGO A;  5ITU A;  2M60 A;  1DGH A;  1FNN A;  3AOE C;  3FUX A;  2BJV A;  5EXT A;  4D81 A;  4DUZ M;  3H4M A;  1IM2 A;  1DGB A;  4MGK E;  2OQ4 A;  3SFZ A;  3GLI B;  4DR3 M;  5ITX E;  3A46 A;  1E32 A;  1DGG A;  2XF3 A;  4LJ5 A;  2RGH A;  4X64 M;  2LXE A;  1J7K A;  3UMM A;  3U6C A;  3CF6 E;  1E94 E;  3CTW B;  4LJA A;  1ORY B;  1QAM A;  4OW0 A;  4IBD A;  4LFA M;  3UZU A;  3U5Z B;  2P5T A;  3VDP A;  3VK7 A;  1HQC A;  2FNA A;  4K0K M;  2D7G A;  3SAV A;  3GLG B;  4R7G A;  1UM8 A;  2DZN B;  3A98 B;  3K92 A;  5EP2 A;  5IRE B;  5H3X A;  3AOE A;  4Z8X A;  4QHT A;  4AG6 A;  3ILK A;  1HNW M;  2Y0T A;  5JI2 E;  4IBK A;  5DYG A;  4GMQ A;  3Q8X A;  2L7H A;  2Y0Q A;  4DV4 M;  1DGH B;  3J2P B;  1TH4 A;  2C98 A;  3SC3 A;  1IN5 A;  4LF7 M;  3GQ5 A;  5BR8 M;  5GKN A;  4NRV A;  1TH3 A;  4MGZ E;  4ZPX A;  1XXH A;  4AQY M;  3RFW A;  1NVM A;  4LJ4 A;  4KOD A;  2QP9 X;  1QZM A;  2CV0 A;  1N33 M;  4B08 A;  5KPR A;  2KXE A;  4LRT A;  3L28 A;  2YQZ A;  4GH9 A;  2K47 A;  2QPA A;  1HR0 M;  1L1Z A;  2QBY A;  4DV0 M;  3JR5 A;  2R62 A;  3RE8 A;  2R4J A;  1IQP A;  1H6U A;  3TPZ A;  3AV0 A;  3IG8 A;  3KP1 E;  3UJN A;  4OVZ B;  4LGM A;  1IY1 A;  3GLF B;  5IWA M;  1IN6 A;  1NSF A;  2ZBK B;  2XSZ D;  3C58 A;  3PFI A;  2YR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...