3DOAA

The crystal structure of the fibrinogen binding protein from staphylococcus aureus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
266
Chain Sequence
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Protein binding
molecule keywords Fibrinogen binding protein
total genus 75
structure length 266
sequence length 279
ec nomenclature
pdb deposition date 2008-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3doaA02
2.30.310.10 Mainly Beta Roll ibrinogen binding protein from staphylococcus aureus fold ibrinogen binding protein from staphylococcus aureus domain 3doaA01
3.40.970.40 Alpha Beta 3-Layer(aba) Sandwich Ribonuclease HI; Chain A fibrinogen binding protein from staphylococcus aureus domain like 3doaA03
5BR8M 1KFVA 4G4QA 5FLXS 3TWKA 1I94M 4GKKM 1XMQM 4LF7M 1K3XA 4DR6M 4X62M 2VQEM 4DV1M 4LF4M 1IBKM 3U6CA 4PD2A 3U6MA 2HHHM 3SAUA 4JI2M 4LF8M 3SAWA 1L2CA 2F5NA 1Z5BA 5IWAM 1XC8A 4JI0M 1MU5A 4PDIA 4DV5M 3U6QA 2XZFA 2XZUA 4B3TM 4CISA 4LFCM 5ITQA 4X65M 3C58A 1XNRM 4JI4M 4YY3M 4DV7M 4JI8M 2UXDM 3U6SA 3OTOM 4JI7M 4DV2M 3J80S 3A42A 3JR4A 4NXMM 2OQ4A 1N36M 3A46A 4DR1M 1PM5A 4NRVA 3U6DA 3GPXA 5IT9S 3GQ5A 1L2BA 1L2DA 3TWLA 1Z5CA 5ITYA 3U6EA 4DR7M 4OX9M 4ITQA 3SAVA 4K0KM 1TDZA 1TDHA 3J81S 4NXNM 4DV6M 1HR0M 1L1ZA 4DR3M 3SBJA 3GQ4A 4PCZA 3JR5A 2F5SA 3GQ3A 3A45A 3J7AS 1L1TA 3JAMS 1XMOM 1N33M 5LMUM 4MB7A 5ITTA 2UUAM 4JI1M 3VK8A 1NNJA 3T1YM 2VQFM 5A2QS 1PJJA 4B3MM 5H3XA 3T1HM 4GKJM 2HKJA 1K3WA 4NRWA 2UXCM 4DV3M 1IBMM 1PJIA 1N32M 4JV5M 3GPPA 3U6PA 4LF6M 2UUBM 3SASA 1HNZM 4LF5M 4KHPM 4JI3M 5ITXA 2F4VM 2Q2EB 4YHHM 2EA0A 4LF9M 2E5LM 2F5PA 1Z59A 4X64M 4DUZM 4DV0M 5LMNM 4DR2M 1IBLM 4JI6M 4DR4M 2UXBM 4X66M 3GPYA 2UU9M 3DOAA 1J5EM 2ZM6M 4JI5M 3U6LA 1K82A 5ITUA 1Q39A 1R2YA 2F5QA 4G4NA 4DUYM 1Q3CA 1EE8A 1Q3BA 3VK7A 3U6OA 2OPFA 4B3RM 1Z5AA 4AQYM 3TWMA 4B3SM 4G4OA 5ITRA 1N34M 4LFBM 3GO8A 4PDGA 1FJGM 3GP1A 4DV4M 3SATA 1XNQM 1HNXM 1MX0A 3GPUA 2F5OA 4LFAM 3SARA 1HNWM 2ZBKB 4JYAM 4DR5M 1R2ZA 4G4RA 5ITXE 2UUCM 3W0FA
chains in the Genus database with same CATH superfamily
4M9XA 1J09A 1OIPA 5EP2A 1IN4A 2DAMA 3B89A 1K3XA 4DR6M 4LRTA 1YUBA 2JZ0A 5EP1A 3U6CA 1HQYE 1IBKM 3VFDA 2B3TA 1E94E 2ZANA 1G59A 4QOSA 1GJSA 1GJTA 3TL4X 4JI0M 4PDIA 3KOYE 4DV5M 2QNJA 4B3TM 4LJ7A 4HL4A 4WP2A 2R46A 1QZEA 4P16A 4B08A 2LBCA 2QBYB 4JI8M 1TR8A 2O01F 2R45A 5EP3A 3DFZA 1NNUC 3CTWB 4LRSA 3OTOM 4JI7M 4IBEA 3I01M 4QHTA 2FE8A 4JN6A 2L6OA 3A46A 2K0BX 3W0FA 2K9DA 2KDLA 2WSFF 1EFUB 3HX3A 3B7ZA 4NRVA 3UJNA 1PJQA 3GPXA 2XEPA 4A3VB 1Z5CA 5GKNA 2XLJA 3GLHA 3SAVA 2LVNC 2KNAA 3MHVC 3RGSA 2CV2A 2EJSA 3LVVA 3I4YA 4NXNM 3FYDA 5E26A 1KYIA 2JXNA 4IBCA 4DR3M 1QVRA 3CF2A 3ZQJA 2CEAA 1WHCA 3JR5A 2F5SA 3C3EA 2DAKA 1QHKA 1VEKA 2LVOC 1X37A 3FTEA 2H1RA 3AFHA 3NBIA 2V1CA 3V76A 5KQDA 3J7BA 1XMOM 1L1TA 2QPAA 1OAOC 4I4LA 1DGFA 3B7QA 3PMQA 1GLNA 1IY1A 2Z4RA 3W0LB 2OOBA 1SXJC 3J2PB 3ZCBB 4B7FA 2VQFM 1NNJA 1JB0F 1NY6A 1DO2A 4NOOB 4NSOB 4B3MM 3L26A 1QYRA 1VG5A 4GKJM 2UXCM 1BVSA 1KSFX 3VDPA 3GLGB 2K47A 1IBMM 3U61A 1N32M 2YNMD 5EXSA 2LXEA 4JV5M 1WR1B 4LF6M 2CUZA 4IBKA 4GMQA 3SYLA 1WGLA 2MR9A 5FTJA 3IHPA 3GLGE 2A5YB 4F2LA 3SMPA 4R71A 3VKHA 2LWXA 2QHOB 4GIPA 3K1JA 5IZ7D 2JUJA 4XGIA 3FUVA 4LF9M 3FTFA 1S3SA 4KT0F 2Z3XA 1R5LA 1WGNA 4DV0M 4DR2M 2DI0A 1IBLM 4DR4M 2DHRA 3FYCA 2UXBM 3GPYA 4BLCA 2KW0A 1PRBA 3HJSA 1G8PA 1J5EM 3T38A 2EUCA 3PNYA 4LJ9A 3U5ZA 4JXJA 2JWSA 4G4NA 2QCUA 4DUYM 2KZUA 1D0KA 1XXHB 1DGBA 2J5YA 4I5SA 4IBDA 1Q3BA 1TTEA 4AQYM 1OAIA 1TH2A 1N34M 3GRRA 3EIEA 4L78A 2NQ8C 4PDGA 2JA2A 4DV4M 4UN2B 3R8FA 3K9PA 2DWNA 1IXZA 3U61B 1MX0A 1HNXM 1NVMA 2FNAA 4LFAM 3GLHE 1R4GA 2F5OA 1HNWM 2ZBKB 1LTMA 1NV9A 4JYAM 1R2ZA 4G4RA 4OW0A 5KPRA 2WSEF 4M0DA 1C7YA 3PVSA 4FW9A 3TWKA 4GKKM 1XMQM 2KHHA 2M5ZA 1PJTA 2KZSA 2DNAA 3UK6A 3GLIB 4PD2A 3U6MA 2HHHM 1ZV1A 3R9XB 4AI6A 3HGIA 3SAWA 2BWBA 2G3QA 3GRVA 3GITA 1JR3A 2KEBA 2M60A 1MU5A 4MGYE 5IWAM 2XZFA 1D0LA 5C1BA 2XZUA 1C1KA 3K92A 2XSZD 2VIIA 3M0EA 5ITQA 3KDSE 4M9ZA 2VF8A 4D82A 3GLIA 3IG8A 2CV0A 1CUKA 3U6SA 4L4UA 1XWIA 3PXGA 3FUUA 3GLGA 4LJ4A 1NJGA 5KPTA 4MGKE 2KXEA 1N36M 3GRUA 2XFTA 4FWGA 1G41A 2CFOA 2LVPC 4GHLA 2JY8A 1NSFA 5IT9S 3GQ5A 1UM8A 2AHMA 1VEGA 2Y21A 4LJ5A 5FTKA 5C18A 5ITYA 3U6EA 2FS1A 1GKIA 2YR0A 3HZJA 1TDHA 2LVAA 4DV6M 2OO9A 2RKOA 2DENA 4GEWA 4QNRA 3L25A 2R18A 4PT5A 3ZC7B 3SBJA 4LJ6A 4CIZA 1ZMWA 2XGNA 2HL7A 4GRIA 2BNKA 2ZTDA 2DKLA 4OU7A 4MGHA 5EXTA 4D81A 2EO2A 1IQPA 1IFYA 7CATA 5H3XA 1XB2B 1YE9A 3KP0E 3FKEA 5KQ8A 1DO0A 1PJSA 3W68A 1QANA 4EIWA 3SC3A 2WSCF 4HLQA 5KPZA 1K3WA 3HHWA 1WJ7A 4B7GA 2VF7A 2W82A 2EKKA 1FNNA 2I7NA 3MK6A 1T43A 4IBFA 2UUBM 4R7GA 3SASA 3AOEA 1V92A 2CRUA 3L28A 5DFLA 3AJIB 2DWLA 3HU3A 5L8RF 2R62A 1OKSA 1NV8A 4OVZB 5KO3A 2EA0A 4G6ZA 1VDDA 1IXSB 4BB9A 3WHLA 2F5PA 3CF0A 2CHVA 3BBZA 4S12A 4DUZM 3KW6A 3L2AA 5LMNM 1JR3D 2R0IA 2KNZA 3DOAA 1SXJB 4IBBA 3TPZA 1Z6TA 4JI5M 3AOGA 3QWLA 3U6LA 2G8LA 4NC6A 2LTUA 5ITUA 1GABA 1QDTA 2Y20A 1J7KA 1DV0A 1QZMA 4WURA 3THGA 2L7HA 1Q3CA 2R44A 1SXJE 3U6OA 1Z5AA 2LHCA 1IY2A 1VDLA 1N75A 1VQ1A 3PNVA 3SMSA 3TWMA 4MGIE 2C9CA 3HY5A 4L8RC 2DAIA 4LFBM 4L15A 2XH9A 4REZA 2I7PA 4M9SA 3DA1A 2MROB 1ORYB 3KOWE 3KFUG 1G4AE 2R4EA 3GPUA 1QUSA 3LQRA 3KSXA 1WXQA 4AG6A 1IM2A 3FRHA 1KFVA 2QENA 3FUXA 3I4VA 5FLXS 1I94M 4XBOA 3SFZA 3KOXE 1ZMVA 4Y28F 1I4WA 4X62M 2JY6B 5DYIA 4LF4M 4LZZA 3SAUA 4JI2M 4LF8M 3C3DA 2F5NA 3AKZA 1Z5BA 2EKFA 1XC8A 2KRUA 4CISA 3E9SA 4LFCM 1TF0B 3C58A 1Y8GA 1F4IA 1XNRM 1ZAEA 4YY3M 4DV7M 3K9OA 4JI4M 3KSJA 2UXDM 3T6PA 3E4RA 5E6JA 3SHFA 4RNAA 1XHBA 3EIHA 3A42A 4MGZE 4NL4H 3J80S 5BPVA 3JR4A 2H5XA 2OQ4A 3A98B 5FTMA 3B9PA 2DWZB 2DZLA 2R6FA 4XK8F 1L2BA 1XXHA 3RFWA 1L2DA 3KXEC 3TWLA 2DWMA 4DR7M 3BSUA 4ITQA 4FWDA 1GO5A 3HHZA 4WW0A 3HHXA 2C5RA 1YLAA 2BJWA 1L1ZA 3LMMA 4ZPXA 1YSYA 3I04M 5H37D 1DGHB 3DZDA 5FSWA 3UMMA 4IBJA 3GQ4A 4LG2A 3K8ZA 1UFZA 2Y0TA 3HU2A 1QAMA 3W67A 3U5ZB 2DZNB 2FFJA 3GLFE 5LMUM 1NO1A 2LH0A 4MB7A 5ITTA 4GC5A 4RF0A 2UUAM 1OFHA 4IJFA 3AV0A 5EJCA 4GHAA 3FUWA 4JI1M 3VK8A 2C98A 3T1YM 2CP8A 3F92A 1PJJA 3NBXX 2X8AA 3UZUA 3GLFB 2Y0QA 3T1HM 3M7GA 3IECA 2ZTCA 2HKJA 4OVZA 1NHWC 1QAOA 4DV3M 2R4JA 4M0WA 1PJIA 2CE7A 1E9RA 2YFQA 3C9PA 4P17A 3U6PA 3BXWA 3KS4A 1Q02A 1IY0A 4BBAA 3LVWA 3SHGB 2KNVA 1GL6A 4QHSA 1HT2E 3GRYA 5FTNA 4LF5M 3BL4A 4JI3M 2LNHC 3E21A 5F3WA 1OTRA 2F4VM 2QSFX 2Q2EB 1JR3E 4YHHM 1NHGC 2CV1A 3NWLA 2QZ4A 1V34A 3TE6A 1ZMUA 2E5LM 2P5TA 2YQZA 2RRUA 1OQYA 1QDRA 4X64M 2MH8A 3GLIE 2BWEA 2K6BA 4AKGA 4JI6M 1DGHA 1W5SA 1NJFA 4LJAA 2C96A 1L8QA 3Q8GA 5DNYA 2MGWA 4LZJA 3RE8A 2ZM6M 2G5GX 3HU1A 3QAUA 1K82A 2CHQA 4G3OA 1Q39A 2F5QA 4KODA 4LJ8A 2X49A 4II7A 1R6BX 2DXIA 1PGYA 2X4AA 1EE8A 2JZ1A 4I8OA 4B3RM 4GITA 1A5TA 2C9OA 4B3SM 3LCVB 1H6UA 4G4OA 1IXRC 4NXMM 5ITRA 1P3QQ 2JP7A 4MM3B 3GO8A 1FJGM 2D7HA 3SATA 1XNQM 4AZFA 3FRIA 2OOAA 4R3DA 4B7HA 1EIJA 4CJ6A 3SARA 4DBGB 4DR5M 4CHTB 5EXXA 3HHYA 1AUAA 1E32A 2Z8YM 5EQTA 5BR8M 2O5RA 2DAGA 4G4QA 2JY5A 1AIPC 2FOIC 1OFIA 3B7NA 1WIVA 4LF7M 1HJPA 3UGJA 1D0MA 2VQEM 4DV1M 2L2DA 4L16A 4KO8A 1L2CA 3GLFA 3U6QA 2QP9X 3LW5F 1NY5A 1QQWA 3B74A 4Q7JA 4W5WA 4KLNA 2Z7JA 2HWJA 4X65M 4FWHA 3HJ8A 1MJGM 1XXHE 3MJ5A 4ANRA 3E46A 1N77A 3KS8A 4IBGA 1RU3A 4DV2M 1IN6A 1W5TA 2ERCA 2R65A 4DR1M 4LGMA 2DAEA 3H4JA 1PM5A 3CF6E 2JY7A 3HJQA 3U6DA 4HEOA 1N78A 1G71A 4RF1A 4LY6A 1T6OA 4NSRA 3WHKA 1SXJD 4OX9M 2CHGA 4FCWA 4LCBA 4K0KM 3VKGA 1TDZA 4FCTA 4AW4A 3J81S 3LCUA 5EP4A 3U60A 1HR0M 4IIWA 2RGHA 1IN7A 4Z6YA 4PCZA 3M6AA 2CWBA 1D2NA 3GQ3A 1R7RA 1LV7A 3A45A 2D7EA 2XFSA 2D7GA 3KOZE 3U60B 2QQ8A 3J7AS 2HAKA 2FH0A 3JAMS 3AL0C 4TUWA 2MJ5B 1OJLA 3FUTA 1N33M 4GC9A 3GLHB 2V6ZM 3FTCA 3IG5A 3T15A 2QBYA 3D8LA 3MMPA 3QYEA 3ZH9B 3SYKA 5EXPA 3D8BA 5A2QS 4IBIA 1V33A 2ZAMA 1IXSA 1IN8A 3CGWA 5IREB 5DYGA 2J7NA 1SG9A 2BJVA 2C99A 3TQSA 4NRWA 4Z8XA 4AG5A 3RGPA 2N35A 3GPPA 4AKIA 1T3TA 4D80A 1HQCA 4FD2A 2L4FA 2L4EA 2GQFA 2XF3A 3L29A 1GL7A 1HNZM 3Q8XA 1E9SA 2HCBA 1DGGA 2L09A 4QNMA 1QUTA 2ZAOA 4KHPM 5FTLA 5ITXA 3L27A 2WZJA 3H4MA 3BOSA 5JI2E 4L6V6 3AOEC 1G3IA 4RKUF 3FTDA 1Z59A 4CGYB 2APLA 3HWSA 3PFIA 3VDUA 2L7IA 1TH4A 4X66M 2UU9M 3FE3A 3J27B 1JQJC 3LQQA 4FVMA 8CATA 3QYBA 4MH0E 3K2LA 2DVWB 3KVWA 2J7OA 4FCVA 2V1UA 2VDBB 1TGUA 4GH9A 1R2YA 3HKPA 1HT1E 3FD9A 4AKHA 3I51A 1IN5A 4LGYA 1VEJA 3VK7A 2DHYA 2JNHA 1MN3A 1QAQA 2OPFA 1ZQ9A 3VLFB 4F1IA 2DZOB 2GNOA 3ILKA 4I81A 3GP1A 2Z4SA 2LVQD 2O25A 1GVNA 1OIZA 1TH3A 2KRKA 1SXJA 2LHGA 2RGOA 4QOZC 2XSZA 4IJEA 5JI3E 5ITXE 2UUCM 2KA6B 3KP1E
chains in the Genus database with same CATH topology
4M9XA 1J09A 5EP2A 1IN4A 1K3XA 4DR6M 4LRTA 1YUBA 5EP1A 1IBKM 3U6CA 1HQYE 3VFDA 1E94E 2ZANA 1G59A 4QOSA 3TL4X 4JI0M 4PDIA 3KOYE 4DV5M 4B3TM 4LJ7A 4HL4A 2R46A 4P16A 4B08A 2QBYB 4JI8M 2R45A 5EP3A 3DFZA 1NNUC 3CTWB 4LRSA 3OTOM 4JI7M 4IBEA 4QHTA 2FE8A 4JN6A 2L6OA 3A46A 3W0FA 3UJNA 4NRVA 3GPXA 2XEPA 4A3VB 1Z5CA 5GKNA 2XLJA 3GLHA 3SAVA 3MHVC 3RGSA 2CV2A 3LVVA 3I4YA 4NXNM 3FYDA 5E26A 1KYIA 4IBCA 4DR3M 1QVRA 3CF2A 2CEAA 3JR5A 2F5SA 1X37A 3FTEA 2H1RA 3AFHA 3NBIA 2V1CA 5KQDA 1XMOM 3J7BA 1L1TA 2QPAA 4I4LA 1DGFA 1GLNA 1IY1A 2Z4RA 3W0LB 3J2PB 1SXJC 4B7FA 3ZCBB 2VQFM 1NNJA 4B3MM 1NY6A 4NOOB 1DO2A 4NSOB 3L26A 1QYRA 4GKJM 2UXCM 3VDPA 1KSFX 3GLGB 2K47A 1IBMM 3U61A 1N32M 2YNMD 5EXSA 2LXEA 4JV5M 4LF6M 2CUZA 4IBKA 4GMQA 3SYLA 5FTJA 2A5YB 3SMPA 3VKHA 2LWXA 4GIPA 3K1JA 5IZ7D 4XGIA 3FUVA 4LF9M 3FTFA 1S3SA 2Z3XA 4DV0M 4DR2M 1IBLM 4DR4M 2UXBM 2DHRA 3FYCA 3GPYA 4BLCA 2KW0A 3HJSA 1J5EM 1G8PA 3T38A 2EUCA 3PNYA 4LJ9A 3U5ZA 4JXJA 4G4NA 2QCUA 4DUYM 2KZUA 1XXHB 1DGBA 4IBDA 4I5SA 1Q3BA 4AQYM 1TH2A 1N34M 3GRRA 3EIEA 4L78A 2NQ8C 4PDGA 2JA2A 4DV4M 3R8FA 2DWNA 1IXZA 3U61B 1MX0A 1HNXM 1NVMA 2FNAA 4LFAM 2F5OA 1HNWM 2ZBKB 4JYAM 1R2ZA 4G4RA 4OW0A 5KPRA 4M0DA 3PVSA 4FW9A 3TWKA 4GKKM 1XMQM 2M5ZA 2KZSA 3UK6A 3GLIB 4AI6A 4PD2A 3U6MA 2HHHM 3R9XB 3HGIA 3SAWA 3GRVA 1JR3A 2KEBA 2M60A 1MU5A 4MGYE 5IWAM 2XZFA 5C1BA 2XZUA 1C1KA 3K92A 2XSZD 2VIIA 3M0EA 5ITQA 3KDSE 4M9ZA 4D82A 3GLIA 3IG8A 2CV0A 3U6SA 4L4UA 1XWIA 3PXGA 3FUUA 3GLGA 4LJ4A 1NJGA 5KPTA 4MGKE 2KXEA 1N36M 3GRUA 2XFTA 4FWGA 1G41A 2CFOA 4GHLA 1NSFA 5IT9S 3GQ5A 1UM8A 2AHMA 2Y21A 4LJ5A 5FTKA 5C18A 5ITYA 3U6EA 1GKIA 2YR0A 1TDHA 4DV6M 2RKOA 4QNRA 3L25A 2R18A 4PT5A 3ZC7B 3SBJA 4LJ6A 2XGNA 2HL7A 4GRIA 2BNKA 4OU7A 4MGHA 5EXTA 4D81A 2EO2A 1IQPA 7CATA 5H3XA 1YE9A 3KP0E 3FKEA 5KQ8A 1DO0A 4EIWA 1QANA 3SC3A 4HLQA 5KPZA 1K3WA 3HHWA 4B7GA 2W82A 1FNNA 2I7NA 3MK6A 4IBFA 2UUBM 4R7GA 3SASA 3AOEA 3L28A 3AJIB 2DWLA 3HU3A 2R62A 2EA0A 4OVZB 5KO3A 4G6ZA 1VDDA 1IXSB 4BB9A 3WHLA 2F5PA 3CF0A 2CHVA 4S12A 4DUZM 3KW6A 3L2AA 5LMNM 1JR3D 3DOAA 1SXJB 4IBBA 3TPZA 1Z6TA 4JI5M 3QWLA 3AOGA 3U6LA 2G8LA 5ITUA 2Y20A 1J7KA 1QZMA 4WURA 3THGA 2L7HA 1Q3CA 1SXJE 3U6OA 1Z5AA 1IY2A 1N75A 3TWMA 3PNVA 3SMSA 4MGIE 2C9CA 4L8RC 4LFBM 4L15A 2XH9A 4REZA 2I7PA 4M9SA 3DA1A 1ORYB 3KOWE 3KFUG 1G4AE 2R4EA 3GPUA 3LQRA 3KSXA 1WXQA 4AG6A 1IM2A 1KFVA 2QENA 3FUXA 3I4VA 5FLXS 1I94M 4XBOA 3SFZA 3KOXE 4X62M 4LF4M 1I4WA 5DYIA 4LZZA 3SAUA 4JI2M 4LF8M 2F5NA 3AKZA 1Z5BA 1XC8A 2KRUA 4CISA 3E9SA 4LFCM 3C58A 1XNRM 1ZAEA 4YY3M 4DV7M 4JI4M 3KSJA 2UXDM 3E4RA 5E6JA 3SHFA 4RNAA 3EIHA 1XHBA 3A42A 4MGZE 4NL4H 3J80S 5BPVA 3JR4A 2OQ4A 4NXMM 3A98B 5FTMA 3B9PA 2DWZB 1L2BA 1L2DA 1XXHA 3RFWA 3KXEC 3TWLA 2DWMA 4DR7M 4ITQA 4FWDA 3HHZA 4WW0A 3HHXA 2C5RA 2BJWA 1L1ZA 3LMMA 4ZPXA 1YSYA 5H37D 1DGHB 3DZDA 5FSWA 3UMMA 4IBJA 3GQ4A 4LG2A 3K8ZA 2Y0TA 3HU2A 1QAMA 3U5ZB 2DZNB 2FFJA 5LMUM 2LH0A 4MB7A 5ITTA 2UUAM 4GC5A 4RF0A 1OFHA 4IJFA 3AV0A 5EJCA 4GHAA 3FUWA 4JI1M 3VK8A 2C98A 3T1YM 1PJJA 2X8AA 3UZUA 3GLFB 2Y0QA 3T1HM 3M7GA 2HKJA 4OVZA 1NHWC 1QAOA 4DV3M 2R4JA 4M0WA 1PJIA 2CE7A 1E9RA 2YFQA 3U6PA 3KS4A 1IY0A 4BBAA 3LVWA 3SHGB 1GL6A 4QHSA 1HT2E 3GRYA 5FTNA 4LF5M 4JI3M 2LNHC 5F3WA 2F4VM 2Q2EB 4YHHM 1NHGC 2CV1A 3NWLA 2QZ4A 3TE6A 2E5LM 2P5TA 2YQZA 4X64M 4AKGA 4JI6M 1DGHA 1W5SA 1NJFA 4LJAA 2C96A 1L8QA 5DNYA 4LZJA 3RE8A 2ZM6M 2G5GX 3HU1A 3QAUA 1K82A 2CHQA 1Q39A 2F5QA 4KODA 4LJ8A 2X49A 4II7A 1R6BX 2DXIA 2X4AA 1EE8A 4I8OA 4B3RM 4GITA 2C9OA 4B3SM 1H6UA 4G4OA 1IXRC 5ITRA 4MM3B 3GO8A 1FJGM 2D7HA 3SATA 1XNQM 4AZFA 4R3DA 4B7HA 3SARA 4DR5M 4CHTB 5EXXA 3HHYA 1E32A 5EQTA 5BR8M 2O5RA 4G4QA 2FOIC 1OFIA 4LF7M 3UGJA 2VQEM 4DV1M 4L16A 4KO8A 1L2CA 3GLFA 3U6QA 2QP9X 1NY5A 1QQWA 4W5WA 4KLNA 2Z7JA 4X65M 4FWHA 3HJ8A 3MJ5A 1N77A 3KS8A 4IBGA 4DV2M 1IN6A 1W5TA 2ERCA 2R65A 4DR1M 4LGMA 1PM5A 3CF6E 3HJQA 3U6DA 1N78A 4RF1A 4LY6A 4NSRA 3WHKA 1SXJD 4OX9M 2CHGA 4FCWA 4LCBA 4K0KM 3VKGA 1TDZA 4FCTA 4AW4A 3J81S 5EP4A 3U60A 1HR0M 4IIWA 2RGHA 1IN7A 4Z6YA 4PCZA 3M6AA 1D2NA 3GQ3A 3KOZE 1R7RA 1LV7A 3A45A 2D7EA 2XFSA 2D7GA 3U60B 3J7AS 3JAMS 3AL0C 4TUWA 1N33M 1OJLA 3FUTA 4GC9A 3GLHB 2V6ZM 3FTCA 3IG5A 3T15A 2QBYA 3D8LA 3ZH9B 3SYKA 5EXPA 3D8BA 5A2QS 4IBIA 2ZAMA 5IREB 1IN8A 5DYGA 2J7NA 2BJVA 2C99A 3TQSA 4NRWA 4Z8XA 4AG5A 3RGPA 3GPPA 4AKIA 1T3TA 4D80A 1HQCA 4FD2A 2XF3A 3L29A 1GL7A 1HNZM 3Q8XA 1E9SA 2HCBA 1DGGA 2L09A 4QNMA 4KHPM 2ZAOA 5FTLA 5ITXA 3L27A 3H4MA 3BOSA 5JI2E 3AOEC 1G3IA 3FTDA 1Z59A 4CGYB 3HWSA 3PFIA 3VDUA 2L7IA 1TH4A 4X66M 2UU9M 3J27B 4FVMA 1JQJC 3LQQA 8CATA 4MH0E 3K2LA 2DVWB 3KVWA 2J7OA 4FCVA 2V1UA 1TGUA 4GH9A 1R2YA 3HKPA 1HT1E 3FD9A 4AKHA 3I51A 1IN5A 4LGYA 3VK7A 2OPFA 1QAQA 1ZQ9A 3VLFB 2DZOB 3ILKA 4I81A 3GP1A 2Z4SA 1GVNA 1TH3A 2KRKA 1SXJA 2RGOA 4QOZC 2XSZA 4IJEA 5JI3E 5ITXE 2UUCM 2KA6B 3KP1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 M;  1KFV A;  4G4Q A;  5FLX S;  3TWK A;  1I94 M;  4GKK M;  1XMQ M;  4LF7 M;  1K3X A;  4DR6 M;  4X62 M;  2VQE M;  4DV1 M;  4LF4 M;  1IBK M;  3U6C A;  4PD2 A;  3U6M A;  2HHH M;  3SAU A;  4JI2 M;  4LF8 M;  3SAW A;  1L2C A;  2F5N A;  1Z5B A;  5IWA M;  1XC8 A;  4JI0 M;  1MU5 A;  4PDI A;  4DV5 M;  3U6Q A;  2XZF A;  2XZU A;  4B3T M;  4CIS A;  4LFC M;  5ITQ A;  4X65 M;  3C58 A;  1XNR M;  4JI4 M;  4YY3 M;  4DV7 M;  4JI8 M;  2UXD M;  3U6S A;  3OTO M;  4JI7 M;  4DV2 M;  3J80 S;  3A42 A;  3JR4 A;  4NXM M;  2OQ4 A;  1N36 M;  3A46 A;  4DR1 M;  1PM5 A;  4NRV A;  3U6D A;  3GPX A;  5IT9 S;  3GQ5 A;  1L2B A;  1L2D A;  3TWL A;  1Z5C A;  5ITY A;  3U6E A;  4DR7 M;  4OX9 M;  4ITQ A;  3SAV A;  4K0K M;  1TDZ A;  1TDH A;  3J81 S;  4NXN M;  4DV6 M;  1HR0 M;  1L1Z A;  4DR3 M;  3SBJ A;  3GQ4 A;  4PCZ A;  3JR5 A;  2F5S A;  3GQ3 A;  3A45 A;  3J7A S;  1L1T A;  3JAM S;  1XMO M;  1N33 M;  5LMU M;  4MB7 A;  5ITT A;  2UUA M;  4JI1 M;  3VK8 A;  1NNJ A;  3T1Y M;  2VQF M;  5A2Q S;  1PJJ A;  4B3M M;  5H3X A;  3T1H M;  4GKJ M;  2HKJ A;  1K3W A;  4NRW A;  2UXC M;  4DV3 M;  1IBM M;  1PJI A;  1N32 M;  4JV5 M;  3GPP A;  3U6P A;  4LF6 M;  2UUB M;  3SAS A;  1HNZ M;  4LF5 M;  4KHP M;  4JI3 M;  5ITX A;  2F4V M;  2Q2E B;  4YHH M;  2EA0 A;  4LF9 M;  2E5L M;  2F5P A;  1Z59 A;  4X64 M;  4DUZ M;  4DV0 M;  5LMN M;  4DR2 M;  1IBL M;  4JI6 M;  4DR4 M;  2UXB M;  4X66 M;  3GPY A;  2UU9 M;  3DOA A;  1J5E M;  2ZM6 M;  4JI5 M;  3U6L A;  1K82 A;  5ITU A;  1Q39 A;  1R2Y A;  2F5Q A;  4G4N A;  4DUY M;  1Q3C A;  1EE8 A;  1Q3B A;  3VK7 A;  3U6O A;  2OPF A;  4B3R M;  1Z5A A;  4AQY M;  3TWM A;  4B3S M;  4G4O A;  5ITR A;  1N34 M;  4LFB M;  3GO8 A;  4PDG A;  1FJG M;  3GP1 A;  4DV4 M;  3SAT A;  1XNQ M;  1HNX M;  1MX0 A;  3GPU A;  2F5O A;  4LFA M;  3SAR A;  1HNW M;  2ZBK B;  4JYA M;  4DR5 M;  1R2Z A;  4G4R A;  5ITX E;  2UUC M;  3W0F A; 
#chains in the Genus database with same CATH topology
 4M9X A;  1J09 A;  1OIP A;  5EP2 A;  1IN4 A;  2DAM A;  3B89 A;  1K3X A;  4DR6 M;  4LRT A;  1YUB A;  2JZ0 A;  5EP1 A;  3U6C A;  1HQY E;  1IBK M;  3VFD A;  2B3T A;  1E94 E;  2ZAN A;  1G59 A;  4QOS A;  1GJS A;  1GJT A;  3TL4 X;  4JI0 M;  4PDI A;  3KOY E;  4DV5 M;  2QNJ A;  4B3T M;  4LJ7 A;  4HL4 A;  4WP2 A;  2R46 A;  1QZE A;  4P16 A;  4B08 A;  2LBC A;  2QBY B;  4JI8 M;  1TR8 A;  2O01 F;  2R45 A;  5EP3 A;  3DFZ A;  1NNU C;  3CTW B;  4LRS A;  3OTO M;  4JI7 M;  4IBE A;  3I01 M;  4QHT A;  2FE8 A;  4JN6 A;  2L6O A;  3A46 A;  2K0B X;  3W0F A;  2K9D A;  2KDL A;  2WSF F;  1EFU B;  3HX3 A;  3B7Z A;  4NRV A;  3UJN A;  1PJQ A;  3GPX A;  2XEP A;  4A3V B;  1Z5C A;  5GKN A;  2XLJ A;  3GLH A;  3SAV A;  2LVN C;  2KNA A;  3MHV C;  3RGS A;  2CV2 A;  2EJS A;  3LVV A;  3I4Y A;  4NXN M;  3FYD A;  5E26 A;  1KYI A;  2JXN A;  4IBC A;  4DR3 M;  1QVR A;  3CF2 A;  3ZQJ A;  2CEA A;  1WHC A;  3JR5 A;  2F5S A;  3C3E A;  2DAK A;  1QHK A;  1VEK A;  2LVO C;  1X37 A;  3FTE A;  2H1R A;  3AFH A;  3NBI A;  2V1C A;  3V76 A;  5KQD A;  3J7B A;  1XMO M;  1L1T A;  2QPA A;  1OAO C;  4I4L A;  1DGF A;  3B7Q A;  3PMQ A;  1GLN A;  1IY1 A;  2Z4R A;  3W0L B;  2OOB A;  1SXJ C;  3J2P B;  3ZCB B;  4B7F A;  2VQF M;  1NNJ A;  1JB0 F;  1NY6 A;  1DO2 A;  4NOO B;  4NSO B;  4B3M M;  3L26 A;  1QYR A;  1VG5 A;  4GKJ M;  2UXC M;  1BVS A;  1KSF X;  3VDP A;  3GLG B;  2K47 A;  1IBM M;  3U61 A;  1N32 M;  2YNM D;  5EXS A;  2LXE A;  4JV5 M;  1WR1 B;  4LF6 M;  2CUZ A;  4IBK A;  4GMQ A;  3SYL A;  1WGL A;  2MR9 A;  5FTJ A;  3IHP A;  3GLG E;  2A5Y B;  4F2L A;  3SMP A;  4R71 A;  3VKH A;  2LWX A;  2QHO B;  4GIP A;  3K1J A;  5IZ7 D;  2JUJ A;  4XGI A;  3FUV A;  4LF9 M;  3FTF A;  1S3S A;  4KT0 F;  2Z3X A;  1R5L A;  1WGN A;  4DV0 M;  4DR2 M;  2DI0 A;  1IBL M;  4DR4 M;  2DHR A;  3FYC A;  2UXB M;  3GPY A;  4BLC A;  2KW0 A;  1PRB A;  3HJS A;  1G8P A;  1J5E M;  3T38 A;  2EUC A;  3PNY A;  4LJ9 A;  3U5Z A;  4JXJ A;  2JWS A;  4G4N A;  2QCU A;  4DUY M;  2KZU A;  1D0K A;  1XXH B;  1DGB A;  2J5Y A;  4I5S A;  4IBD A;  1Q3B A;  1TTE A;  4AQY M;  1OAI A;  1TH2 A;  1N34 M;  3GRR A;  3EIE A;  4L78 A;  2NQ8 C;  4PDG A;  2JA2 A;  4DV4 M;  4UN2 B;  3R8F A;  3K9P A;  2DWN A;  1IXZ A;  3U61 B;  1MX0 A;  1HNX M;  1NVM A;  2FNA A;  4LFA M;  3GLH E;  1R4G A;  2F5O A;  1HNW M;  2ZBK B;  1LTM A;  1NV9 A;  4JYA M;  1R2Z A;  4G4R A;  4OW0 A;  5KPR A;  2WSE F;  4M0D A;  1C7Y A;  3PVS A;  4FW9 A;  3TWK A;  4GKK M;  1XMQ M;  2KHH A;  2M5Z A;  1PJT A;  2KZS A;  2DNA A;  3UK6 A;  3GLI B;  4PD2 A;  3U6M A;  2HHH M;  1ZV1 A;  3R9X B;  4AI6 A;  3HGI A;  3SAW A;  2BWB A;  2G3Q A;  3GRV A;  3GIT A;  1JR3 A;  2KEB A;  2M60 A;  1MU5 A;  4MGY E;  5IWA M;  2XZF A;  1D0L A;  5C1B A;  2XZU A;  1C1K A;  3K92 A;  2XSZ D;  2VII A;  3M0E A;  5ITQ A;  3KDS E;  4M9Z A;  2VF8 A;  4D82 A;  3GLI A;  3IG8 A;  2CV0 A;  1CUK A;  3U6S A;  4L4U A;  1XWI A;  3PXG A;  3FUU A;  3GLG A;  4LJ4 A;  1NJG A;  5KPT A;  4MGK E;  2KXE A;  1N36 M;  3GRU A;  2XFT A;  4FWG A;  1G41 A;  2CFO A;  2LVP C;  4GHL A;  2JY8 A;  1NSF A;  5IT9 S;  3GQ5 A;  1UM8 A;  2AHM A;  1VEG A;  2Y21 A;  4LJ5 A;  5FTK A;  5C18 A;  5ITY A;  3U6E A;  2FS1 A;  1GKI A;  2YR0 A;  3HZJ A;  1TDH A;  2LVA A;  4DV6 M;  2OO9 A;  2RKO A;  2DEN A;  4GEW A;  4QNR A;  3L25 A;  2R18 A;  4PT5 A;  3ZC7 B;  3SBJ A;  4LJ6 A;  4CIZ A;  1ZMW A;  2XGN A;  2HL7 A;  4GRI A;  2BNK A;  2ZTD A;  2DKL A;  4OU7 A;  4MGH A;  5EXT A;  4D81 A;  2EO2 A;  1IQP A;  1IFY A;  7CAT A;  5H3X A;  1XB2 B;  1YE9 A;  3KP0 E;  3FKE A;  5KQ8 A;  1DO0 A;  1PJS A;  3W68 A;  1QAN A;  4EIW A;  3SC3 A;  2WSC F;  4HLQ A;  5KPZ A;  1K3W A;  3HHW A;  1WJ7 A;  4B7G A;  2VF7 A;  2W82 A;  2EKK A;  1FNN A;  2I7N A;  3MK6 A;  1T43 A;  4IBF A;  2UUB M;  4R7G A;  3SAS A;  3AOE A;  1V92 A;  2CRU A;  3L28 A;  5DFL A;  3AJI B;  2DWL A;  3HU3 A;  5L8R F;  2R62 A;  1OKS A;  1NV8 A;  4OVZ B;  5KO3 A;  2EA0 A;  4G6Z A;  1VDD A;  1IXS B;  4BB9 A;  3WHL A;  2F5P A;  3CF0 A;  2CHV A;  3BBZ A;  4S12 A;  4DUZ M;  3KW6 A;  3L2A A;  5LMN M;  1JR3 D;  2R0I A;  2KNZ A;  3DOA A;  1SXJ B;  4IBB A;  3TPZ A;  1Z6T A;  4JI5 M;  3AOG A;  3QWL A;  3U6L A;  2G8L A;  4NC6 A;  2LTU A;  5ITU A;  1GAB A;  1QDT A;  2Y20 A;  1J7K A;  1DV0 A;  1QZM A;  4WUR A;  3THG A;  2L7H A;  1Q3C A;  2R44 A;  1SXJ E;  3U6O A;  1Z5A A;  2LHC A;  1IY2 A;  1VDL A;  1N75 A;  1VQ1 A;  3PNV A;  3SMS A;  3TWM A;  4MGI E;  2C9C A;  3HY5 A;  4L8R C;  2DAI A;  4LFB M;  4L15 A;  2XH9 A;  4REZ A;  2I7P A;  4M9S A;  3DA1 A;  2MRO B;  1ORY B;  3KOW E;  3KFU G;  1G4A E;  2R4E A;  3GPU A;  1QUS A;  3LQR A;  3KSX A;  1WXQ A;  4AG6 A;  1IM2 A;  3FRH A;  1KFV A;  2QEN A;  3FUX A;  3I4V A;  5FLX S;  1I94 M;  4XBO A;  3SFZ A;  3KOX E;  1ZMV A;  4Y28 F;  1I4W A;  4X62 M;  2JY6 B;  5DYI A;  4LF4 M;  4LZZ A;  3SAU A;  4JI2 M;  4LF8 M;  3C3D A;  2F5N A;  3AKZ A;  1Z5B A;  2EKF A;  1XC8 A;  2KRU A;  4CIS A;  3E9S A;  4LFC M;  1TF0 B;  3C58 A;  1Y8G A;  1F4I A;  1XNR M;  1ZAE A;  4YY3 M;  4DV7 M;  3K9O A;  4JI4 M;  3KSJ A;  2UXD M;  3T6P A;  3E4R A;  5E6J A;  3SHF A;  4RNA A;  1XHB A;  3EIH A;  3A42 A;  4MGZ E;  4NL4 H;  3J80 S;  5BPV A;  3JR4 A;  2H5X A;  2OQ4 A;  3A98 B;  5FTM A;  3B9P A;  2DWZ B;  2DZL A;  2R6F A;  4XK8 F;  1L2B A;  1XXH A;  3RFW A;  1L2D A;  3KXE C;  3TWL A;  2DWM A;  4DR7 M;  3BSU A;  4ITQ A;  4FWD A;  1GO5 A;  3HHZ A;  4WW0 A;  3HHX A;  2C5R A;  1YLA A;  2BJW A;  1L1Z A;  3LMM A;  4ZPX A;  1YSY A;  3I04 M;  5H37 D;  1DGH B;  3DZD A;  5FSW A;  3UMM A;  4IBJ A;  3GQ4 A;  4LG2 A;  3K8Z A;  1UFZ A;  2Y0T A;  3HU2 A;  1QAM A;  3W67 A;  3U5Z B;  2DZN B;  2FFJ A;  3GLF E;  5LMU M;  1NO1 A;  2LH0 A;  4MB7 A;  5ITT A;  4GC5 A;  4RF0 A;  2UUA M;  1OFH A;  4IJF A;  3AV0 A;  5EJC A;  4GHA A;  3FUW A;  4JI1 M;  3VK8 A;  2C98 A;  3T1Y M;  2CP8 A;  3F92 A;  1PJJ A;  3NBX X;  2X8A A;  3UZU A;  3GLF B;  2Y0Q A;  3T1H M;  3M7G A;  3IEC A;  2ZTC A;  2HKJ A;  4OVZ A;  1NHW C;  1QAO A;  4DV3 M;  2R4J A;  4M0W A;  1PJI A;  2CE7 A;  1E9R A;  2YFQ A;  3C9P A;  4P17 A;  3U6P A;  3BXW A;  3KS4 A;  1Q02 A;  1IY0 A;  4BBA A;  3LVW A;  3SHG B;  2KNV A;  1GL6 A;  4QHS A;  1HT2 E;  3GRY A;  5FTN A;  4LF5 M;  3BL4 A;  4JI3 M;  2LNH C;  3E21 A;  5F3W A;  1OTR A;  2F4V M;  2QSF X;  2Q2E B;  1JR3 E;  4YHH M;  1NHG C;  2CV1 A;  3NWL A;  2QZ4 A;  1V34 A;  3TE6 A;  1ZMU A;  2E5L M;  2P5T A;  2YQZ A;  2RRU A;  1OQY A;  1QDR A;  4X64 M;  2MH8 A;  3GLI E;  2BWE A;  2K6B A;  4AKG A;  4JI6 M;  1DGH A;  1W5S A;  1NJF A;  4LJA A;  2C96 A;  1L8Q A;  3Q8G A;  5DNY A;  2MGW A;  4LZJ A;  3RE8 A;  2ZM6 M;  2G5G X;  3HU1 A;  3QAU A;  1K82 A;  2CHQ A;  4G3O A;  1Q39 A;  2F5Q A;  4KOD A;  4LJ8 A;  2X49 A;  4II7 A;  1R6B X;  2DXI A;  1PGY A;  2X4A A;  1EE8 A;  2JZ1 A;  4I8O A;  4B3R M;  4GIT A;  1A5T A;  2C9O A;  4B3S M;  3LCV B;  1H6U A;  4G4O A;  1IXR C;  4NXM M;  5ITR A;  1P3Q Q;  2JP7 A;  4MM3 B;  3GO8 A;  1FJG M;  2D7H A;  3SAT A;  1XNQ M;  4AZF A;  3FRI A;  2OOA A;  4R3D A;  4B7H A;  1EIJ A;  4CJ6 A;  3SAR A;  4DBG B;  4DR5 M;  4CHT B;  5EXX A;  3HHY A;  1AUA A;  1E32 A;  2Z8Y M;  5EQT A;  5BR8 M;  2O5R A;  2DAG A;  4G4Q A;  2JY5 A;  1AIP C;  2FOI C;  1OFI A;  3B7N A;  1WIV A;  4LF7 M;  1HJP A;  3UGJ A;  1D0M A;  2VQE M;  4DV1 M;  2L2D A;  4L16 A;  4KO8 A;  1L2C A;  3GLF A;  3U6Q A;  2QP9 X;  3LW5 F;  1NY5 A;  1QQW A;  3B74 A;  4Q7J A;  4W5W A;  4KLN A;  2Z7J A;  2HWJ A;  4X65 M;  4FWH A;  3HJ8 A;  1MJG M;  1XXH E;  3MJ5 A;  4ANR A;  3E46 A;  1N77 A;  3KS8 A;  4IBG A;  1RU3 A;  4DV2 M;  1IN6 A;  1W5T A;  2ERC A;  2R65 A;  4DR1 M;  4LGM A;  2DAE A;  3H4J A;  1PM5 A;  3CF6 E;  2JY7 A;  3HJQ A;  3U6D A;  4HEO A;  1N78 A;  1G71 A;  4RF1 A;  4LY6 A;  1T6O A;  4NSR A;  3WHK A;  1SXJ D;  4OX9 M;  2CHG A;  4FCW A;  4LCB A;  4K0K M;  3VKG A;  1TDZ A;  4FCT A;  4AW4 A;  3J81 S;  3LCU A;  5EP4 A;  3U60 A;  1HR0 M;  4IIW A;  2RGH A;  1IN7 A;  4Z6Y A;  4PCZ A;  3M6A A;  2CWB A;  1D2N A;  3GQ3 A;  1R7R A;  1LV7 A;  3A45 A;  2D7E A;  2XFS A;  2D7G A;  3KOZ E;  3U60 B;  2QQ8 A;  3J7A S;  2HAK A;  2FH0 A;  3JAM S;  3AL0 C;  4TUW A;  2MJ5 B;  1OJL A;  3FUT A;  1N33 M;  4GC9 A;  3GLH B;  2V6Z M;  3FTC A;  3IG5 A;  3T15 A;  2QBY A;  3D8L A;  3MMP A;  3QYE A;  3ZH9 B;  3SYK A;  5EXP A;  3D8B A;  5A2Q S;  4IBI A;  1V33 A;  2ZAM A;  1IXS A;  1IN8 A;  3CGW A;  5IRE B;  5DYG A;  2J7N A;  1SG9 A;  2BJV A;  2C99 A;  3TQS A;  4NRW A;  4Z8X A;  4AG5 A;  3RGP A;  2N35 A;  3GPP A;  4AKI A;  1T3T A;  4D80 A;  1HQC A;  4FD2 A;  2L4F A;  2L4E A;  2GQF A;  2XF3 A;  3L29 A;  1GL7 A;  1HNZ M;  3Q8X A;  1E9S A;  2HCB A;  1DGG A;  2L09 A;  4QNM A;  1QUT A;  2ZAO A;  4KHP M;  5FTL A;  5ITX A;  3L27 A;  2WZJ A;  3H4M A;  3BOS A;  5JI2 E;  4L6V 6;  3AOE C;  1G3I A;  4RKU F;  3FTD A;  1Z59 A;  4CGY B;  2APL A;  3HWS A;  3PFI A;  3VDU A;  2L7I A;  1TH4 A;  4X66 M;  2UU9 M;  3FE3 A;  3J27 B;  1JQJ C;  3LQQ A;  4FVM A;  8CAT A;  3QYB A;  4MH0 E;  3K2L A;  2DVW B;  3KVW A;  2J7O A;  4FCV A;  2V1U A;  2VDB B;  1TGU A;  4GH9 A;  1R2Y A;  3HKP A;  1HT1 E;  3FD9 A;  4AKH A;  3I51 A;  1IN5 A;  4LGY A;  1VEJ A;  3VK7 A;  2DHY A;  2JNH A;  1MN3 A;  1QAQ A;  2OPF A;  1ZQ9 A;  3VLF B;  4F1I A;  2DZO B;  2GNO A;  3ILK A;  4I81 A;  3GP1 A;  2Z4S A;  2LVQ D;  2O25 A;  1GVN A;  1OIZ A;  1TH3 A;  2KRK A;  1SXJ A;  2LHG A;  2RGO A;  4QOZ C;  2XSZ A;  4IJE A;  5JI3 E;  5ITX E;  2UUC M;  2KA6 B;  3KP1 E; 
#chains in the Genus database with same CATH homology
 4M9X A;  1J09 A;  5EP2 A;  1IN4 A;  1K3X A;  4DR6 M;  4LRT A;  1YUB A;  5EP1 A;  1IBK M;  3U6C A;  1HQY E;  3VFD A;  1E94 E;  2ZAN A;  1G59 A;  4QOS A;  3TL4 X;  4JI0 M;  4PDI A;  3KOY E;  4DV5 M;  4B3T M;  4LJ7 A;  4HL4 A;  2R46 A;  4P16 A;  4B08 A;  2QBY B;  4JI8 M;  2R45 A;  5EP3 A;  3DFZ A;  1NNU C;  3CTW B;  4LRS A;  3OTO M;  4JI7 M;  4IBE A;  4QHT A;  2FE8 A;  4JN6 A;  2L6O A;  3A46 A;  3W0F A;  3UJN A;  4NRV A;  3GPX A;  2XEP A;  4A3V B;  1Z5C A;  5GKN A;  2XLJ A;  3GLH A;  3SAV A;  3MHV C;  3RGS A;  2CV2 A;  3LVV A;  3I4Y A;  4NXN M;  3FYD A;  5E26 A;  1KYI A;  4IBC A;  4DR3 M;  1QVR A;  3CF2 A;  2CEA A;  3JR5 A;  2F5S A;  1X37 A;  3FTE A;  2H1R A;  3AFH A;  3NBI A;  2V1C A;  5KQD A;  1XMO M;  3J7B A;  1L1T A;  2QPA A;  4I4L A;  1DGF A;  1GLN A;  1IY1 A;  2Z4R A;  3W0L B;  3J2P B;  1SXJ C;  4B7F A;  3ZCB B;  2VQF M;  1NNJ A;  4B3M M;  1NY6 A;  4NOO B;  1DO2 A;  4NSO B;  3L26 A;  1QYR A;  4GKJ M;  2UXC M;  3VDP A;  1KSF X;  3GLG B;  2K47 A;  1IBM M;  3U61 A;  1N32 M;  2YNM D;  5EXS A;  2LXE A;  4JV5 M;  4LF6 M;  2CUZ A;  4IBK A;  4GMQ A;  3SYL A;  5FTJ A;  2A5Y B;  3SMP A;  3VKH A;  2LWX A;  4GIP A;  3K1J A;  5IZ7 D;  4XGI A;  3FUV A;  4LF9 M;  3FTF A;  1S3S A;  2Z3X A;  4DV0 M;  4DR2 M;  1IBL M;  4DR4 M;  2UXB M;  2DHR A;  3FYC A;  3GPY A;  4BLC A;  2KW0 A;  3HJS A;  1J5E M;  1G8P A;  3T38 A;  2EUC A;  3PNY A;  4LJ9 A;  3U5Z A;  4JXJ A;  4G4N A;  2QCU A;  4DUY M;  2KZU A;  1XXH B;  1DGB A;  4IBD A;  4I5S A;  1Q3B A;  4AQY M;  1TH2 A;  1N34 M;  3GRR A;  3EIE A;  4L78 A;  2NQ8 C;  4PDG A;  2JA2 A;  4DV4 M;  3R8F A;  2DWN A;  1IXZ A;  3U61 B;  1MX0 A;  1HNX M;  1NVM A;  2FNA A;  4LFA M;  2F5O A;  1HNW M;  2ZBK B;  4JYA M;  1R2Z A;  4G4R A;  4OW0 A;  5KPR A;  4M0D A;  3PVS A;  4FW9 A;  3TWK A;  4GKK M;  1XMQ M;  2M5Z A;  2KZS A;  3UK6 A;  3GLI B;  4AI6 A;  4PD2 A;  3U6M A;  2HHH M;  3R9X B;  3HGI A;  3SAW A;  3GRV A;  1JR3 A;  2KEB A;  2M60 A;  1MU5 A;  4MGY E;  5IWA M;  2XZF A;  5C1B A;  2XZU A;  1C1K A;  3K92 A;  2XSZ D;  2VII A;  3M0E A;  5ITQ A;  3KDS E;  4M9Z A;  4D82 A;  3GLI A;  3IG8 A;  2CV0 A;  3U6S A;  4L4U A;  1XWI A;  3PXG A;  3FUU A;  3GLG A;  4LJ4 A;  1NJG A;  5KPT A;  4MGK E;  2KXE A;  1N36 M;  3GRU A;  2XFT A;  4FWG A;  1G41 A;  2CFO A;  4GHL A;  1NSF A;  5IT9 S;  3GQ5 A;  1UM8 A;  2AHM A;  2Y21 A;  4LJ5 A;  5FTK A;  5C18 A;  5ITY A;  3U6E A;  1GKI A;  2YR0 A;  1TDH A;  4DV6 M;  2RKO A;  4QNR A;  3L25 A;  2R18 A;  4PT5 A;  3ZC7 B;  3SBJ A;  4LJ6 A;  2XGN A;  2HL7 A;  4GRI A;  2BNK A;  4OU7 A;  4MGH A;  5EXT A;  4D81 A;  2EO2 A;  1IQP A;  7CAT A;  5H3X A;  1YE9 A;  3KP0 E;  3FKE A;  5KQ8 A;  1DO0 A;  4EIW A;  1QAN A;  3SC3 A;  4HLQ A;  5KPZ A;  1K3W A;  3HHW A;  4B7G A;  2W82 A;  1FNN A;  2I7N A;  3MK6 A;  4IBF A;  2UUB M;  4R7G A;  3SAS A;  3AOE A;  3L28 A;  3AJI B;  2DWL A;  3HU3 A;  2R62 A;  2EA0 A;  4OVZ B;  5KO3 A;  4G6Z A;  1VDD A;  1IXS B;  4BB9 A;  3WHL A;  2F5P A;  3CF0 A;  2CHV A;  4S12 A;  4DUZ M;  3KW6 A;  3L2A A;  5LMN M;  1JR3 D;  3DOA A;  1SXJ B;  4IBB A;  3TPZ A;  1Z6T A;  4JI5 M;  3QWL A;  3AOG A;  3U6L A;  2G8L A;  5ITU A;  2Y20 A;  1J7K A;  1QZM A;  4WUR A;  3THG A;  2L7H A;  1Q3C A;  1SXJ E;  3U6O A;  1Z5A A;  1IY2 A;  1N75 A;  3TWM A;  3PNV A;  3SMS A;  4MGI E;  2C9C A;  4L8R C;  4LFB M;  4L15 A;  2XH9 A;  4REZ A;  2I7P A;  4M9S A;  3DA1 A;  1ORY B;  3KOW E;  3KFU G;  1G4A E;  2R4E A;  3GPU A;  3LQR A;  3KSX A;  1WXQ A;  4AG6 A;  1IM2 A;  1KFV A;  2QEN A;  3FUX A;  3I4V A;  5FLX S;  1I94 M;  4XBO A;  3SFZ A;  3KOX E;  4X62 M;  4LF4 M;  1I4W A;  5DYI A;  4LZZ A;  3SAU A;  4JI2 M;  4LF8 M;  2F5N A;  3AKZ A;  1Z5B A;  1XC8 A;  2KRU A;  4CIS A;  3E9S A;  4LFC M;  3C58 A;  1XNR M;  1ZAE A;  4YY3 M;  4DV7 M;  4JI4 M;  3KSJ A;  2UXD M;  3E4R A;  5E6J A;  3SHF A;  4RNA A;  3EIH A;  1XHB A;  3A42 A;  4MGZ E;  4NL4 H;  3J80 S;  5BPV A;  3JR4 A;  2OQ4 A;  4NXM M;  3A98 B;  5FTM A;  3B9P A;  2DWZ B;  1L2B A;  1L2D A;  1XXH A;  3RFW A;  3KXE C;  3TWL A;  2DWM A;  4DR7 M;  4ITQ A;  4FWD A;  3HHZ A;  4WW0 A;  3HHX A;  2C5R A;  2BJW A;  1L1Z A;  3LMM A;  4ZPX A;  1YSY A;  5H37 D;  1DGH B;  3DZD A;  5FSW A;  3UMM A;  4IBJ A;  3GQ4 A;  4LG2 A;  3K8Z A;  2Y0T A;  3HU2 A;  1QAM A;  3U5Z B;  2DZN B;  2FFJ A;  5LMU M;  2LH0 A;  4MB7 A;  5ITT A;  2UUA M;  4GC5 A;  4RF0 A;  1OFH A;  4IJF A;  3AV0 A;  5EJC A;  4GHA A;  3FUW A;  4JI1 M;  3VK8 A;  2C98 A;  3T1Y M;  1PJJ A;  2X8A A;  3UZU A;  3GLF B;  2Y0Q A;  3T1H M;  3M7G A;  2HKJ A;  4OVZ A;  1NHW C;  1QAO A;  4DV3 M;  2R4J A;  4M0W A;  1PJI A;  2CE7 A;  1E9R A;  2YFQ A;  3U6P A;  3KS4 A;  1IY0 A;  4BBA A;  3LVW A;  3SHG B;  1GL6 A;  4QHS A;  1HT2 E;  3GRY A;  5FTN A;  4LF5 M;  4JI3 M;  2LNH C;  5F3W A;  2F4V M;  2Q2E B;  4YHH M;  1NHG C;  2CV1 A;  3NWL A;  2QZ4 A;  3TE6 A;  2E5L M;  2P5T A;  2YQZ A;  4X64 M;  4AKG A;  4JI6 M;  1DGH A;  1W5S A;  1NJF A;  4LJA A;  2C96 A;  1L8Q A;  5DNY A;  4LZJ A;  3RE8 A;  2ZM6 M;  2G5G X;  3HU1 A;  3QAU A;  1K82 A;  2CHQ A;  1Q39 A;  2F5Q A;  4KOD A;  4LJ8 A;  2X49 A;  4II7 A;  1R6B X;  2DXI A;  2X4A A;  1EE8 A;  4I8O A;  4B3R M;  4GIT A;  2C9O A;  4B3S M;  1H6U A;  4G4O A;  1IXR C;  5ITR A;  4MM3 B;  3GO8 A;  1FJG M;  2D7H A;  3SAT A;  1XNQ M;  4AZF A;  4R3D A;  4B7H A;  3SAR A;  4DR5 M;  4CHT B;  5EXX A;  3HHY A;  1E32 A;  5EQT A;  5BR8 M;  2O5R A;  4G4Q A;  2FOI C;  1OFI A;  4LF7 M;  3UGJ A;  2VQE M;  4DV1 M;  4L16 A;  4KO8 A;  1L2C A;  3GLF A;  3U6Q A;  2QP9 X;  1NY5 A;  1QQW A;  4W5W A;  4KLN A;  2Z7J A;  4X65 M;  4FWH A;  3HJ8 A;  3MJ5 A;  1N77 A;  3KS8 A;  4IBG A;  4DV2 M;  1IN6 A;  1W5T A;  2ERC A;  2R65 A;  4DR1 M;  4LGM A;  1PM5 A;  3CF6 E;  3HJQ A;  3U6D A;  1N78 A;  4RF1 A;  4LY6 A;  4NSR A;  3WHK A;  1SXJ D;  4OX9 M;  2CHG A;  4FCW A;  4LCB A;  4K0K M;  3VKG A;  1TDZ A;  4FCT A;  4AW4 A;  3J81 S;  5EP4 A;  3U60 A;  1HR0 M;  4IIW A;  2RGH A;  1IN7 A;  4Z6Y A;  4PCZ A;  3M6A A;  1D2N A;  3GQ3 A;  3KOZ E;  1R7R A;  1LV7 A;  3A45 A;  2D7E A;  2XFS A;  2D7G A;  3U60 B;  3J7A S;  3JAM S;  3AL0 C;  4TUW A;  1N33 M;  1OJL A;  3FUT A;  4GC9 A;  3GLH B;  2V6Z M;  3FTC A;  3IG5 A;  3T15 A;  2QBY A;  3D8L A;  3ZH9 B;  3SYK A;  5EXP A;  3D8B A;  5A2Q S;  4IBI A;  2ZAM A;  5IRE B;  1IN8 A;  5DYG A;  2J7N A;  2BJV A;  2C99 A;  3TQS A;  4NRW A;  4Z8X A;  4AG5 A;  3RGP A;  3GPP A;  4AKI A;  1T3T A;  4D80 A;  1HQC A;  4FD2 A;  2XF3 A;  3L29 A;  1GL7 A;  1HNZ M;  3Q8X A;  1E9S A;  2HCB A;  1DGG A;  2L09 A;  4QNM A;  4KHP M;  2ZAO A;  5FTL A;  5ITX A;  3L27 A;  3H4M A;  3BOS A;  5JI2 E;  3AOE C;  1G3I A;  3FTD A;  1Z59 A;  4CGY B;  3HWS A;  3PFI A;  3VDU A;  2L7I A;  1TH4 A;  4X66 M;  2UU9 M;  3J27 B;  4FVM A;  1JQJ C;  3LQQ A;  8CAT A;  4MH0 E;  3K2L A;  2DVW B;  3KVW A;  2J7O A;  4FCV A;  2V1U A;  1TGU A;  4GH9 A;  1R2Y A;  3HKP A;  1HT1 E;  3FD9 A;  4AKH A;  3I51 A;  1IN5 A;  4LGY A;  3VK7 A;  2OPF A;  1QAQ A;  1ZQ9 A;  3VLF B;  2DZO B;  3ILK A;  4I81 A;  3GP1 A;  2Z4S A;  1GVN A;  1TH3 A;  2KRK A;  1SXJ A;  2RGO A;  4QOZ C;  2XSZ A;  4IJE A;  5JI3 E;  5ITX E;  2UUC M;  2KA6 B;  3KP1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...