1RYKA

Solution nmr structure protein yjbj from escherichia coli. northeast structural genomics consortium target et93; ontario centre for structural proteomics target ec0298_1_69;
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
69
structure length
69
Chain Sequence
MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNEYRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An NMR approach to structural proteomics.
pubmed doi rcsb
molecule keywords Protein yjbJ
molecule tags Structural genomics, unknown function
source organism Escherichia coli
total genus 25
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05532 CsbD CsbD-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.10 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; YjbJ 1rykA00
1RYKA 1YWWA
chains in the Genus database with same CATH superfamily
1XKTA 2PX6A 1YWWA 4Z49A 1RYKA 3TJMA
chains in the Genus database with same CATH topology
1RYKA 1YWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYK A;  1YWW A; 
#chains in the Genus database with same CATH topology
 1XKT A;  2PX6 A;  1YWW A;  4Z49 A;  1RYK A;  3TJM A; 
#chains in the Genus database with same CATH homology
 1RYK A;  1YWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...