2PX6A

Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
253
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQPTHNSLFLFDGSPTYAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Thioesterase domain
total genus 86
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 2px6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2px6A01
4DSAA 4OYLA 4S0XA 5KWIA 3H1BA 4OB8A 4A16A 4V2IA 4G4JA 4DNQA 2YXPX 2Z5GA 1UOPA 2PKYX 2WG2A 3PFBA 1FFCA 2AXEA 3AFIA 2ZYRA 5JIBA 2HFKA 2QTBA 1WOMA 2ECFA 4GHWA 4BYMA 5EHXA 5HQ3B 1VE7A 4H18A 5EHZA 1QZ3A 3BXPA 5T4EA 1W76A 2B4KA 2XMCA 5JAPA 2WG1A 3QMWA 5CBKA 5AM2A 1TQHA 4L0CA 2RGUA 2HFJA 2XUDA 1EHYA 4DLNA 5ALOA 1SOMA 1EVEA 3M83A 4BB0A 2XB6A 1EDBA 1BROA 3LIIA 2VJAA 4TVKA 4OU4A 4P92A 2C58A 2DHEA 1UXOA 1GKLA 3WL8A 1HLGA 2FX5A 1CV2A 3WK7A 3PUHA 5CXUA 1K5PA 4LXIA 1GT6A 5IVHA 2VATA 1ODTC 3SK0A 5AIBA 4H7FA 4X94A 1XZFA 1DT5A 3C6ZA 5C8XA 3WA7A 3Q8WA 3LCRA 2BKLA 1DX4A 5EIHA 2YYSA 1EDDA 3MUNA 4BDSA 4BAZA 5CW2A 3G0IA 1VOTA 4Q3LA 4J0CA 5JZ9A 1CPYA 4KYVA 5HQ3A 5FV4A 1W4LA 3DLTA 1CUYA 4CG2A 3CCBA 5ALQA 1R4ZA 5AH0A 2WHPA 1Q0RA 5LZ2A 2QOEA 5JAUA 5DTJA 1GZ7A 1E66A 3QMMA 2XLBA 4IH9A 4UPDA 3FSGA 4Y2QA 1S8OA 1Q83A 2HU8A 3K6KA 1QGED 1YSCA 4QA9A 1XQVA 2QRUA 1O6GA 3F67A 3HRHA 4UFOA 4C89A 2PUHA 1SCKA 3FCXA 3M81A 1DT3A 1WM1A 3EQ7A 2WILA 5YASA 1F8UA 5ALKA 5AK5A 1EB9A 2ONCA 3DKKA 1OCEA 2V96A 3STUA 2BUAA 2HA6A 5D3ZA 4W9RA 2DQYA 4UBIA 3UUEA 3H17A 1QO7A 2AJLI 4UFPA 4X93A 1CUZA 4C4XA 3H2IA 1DQZA 5AI5A 2WUDA 1MO2A 4GLBA 4K5QA 5K3CA 4BTVA 2IITA 1C7JA 5HF9A 1ZD5A 4DIUA 1ZIYA 4LXHA 5ALEA 2Y6VA 4BE4A 5T4HA 4KRXA 4X00A 1LPAB 1K63A 2WSLA 1VZ3A 3GZJA 5JADA 1KEZA 3RLIA 5CRIA 2BAGA 2EDCA 3AJAA 1CQWA 4FLFA 1TCBA 2OAEA 1RWQA 1E8NA 4G8DA 3STWA 3R3WA 1VZ2A 2PSDA 2YH2A 2XI4A 4UHHA 2DR0A 4MWTA 5K5EA 1BN6A 1XZEA 2WU3A 4G9GA 3FYUA 3G7NA 4BCBA 2VQ6A 4UBMA 5JZBA 5AOAA 2WHQA 4RPCA 3R0VA 2WFZA 1XFDA 3I6MA 5CT5A 4OUKX 5FDFA 2NW6A 1Y7HA 3QZUA 1ACJA 3WWEA 2LIPA 3QH4A 3G9ZA 3IA2A 1E89A 3I2JA 1U65A 2DQZA 3ICWA 4MQMA 3VJKA 4GECA 1BCSA 1CFJA 2ZJ7A 1VXRA 4HRYA 3O4HA 2XMRA 1K8QA 4B9AA 4EY4A 4U2GA 4P08A 1H23A 5AJHA 3O0DA 5T4BA 2CZQA 4AQDA 5HKBA 4M0MA 1DX6A 4H7KA 2Y6UA 1F0NA 3YASA 4JNCA 3RK4A 3AZOA 4KAJA 4B7ZA 4FNGA 1G4HA 1E3QA 3PDCA 3M82A 4P93A 4X90A 3JW8A 5AP9A 3L1HA 1WPRA 5ALJA 3SC2A 3HZOA 1VJ5A 5DTIA 4C4YA 3MGAA 2Y2UA 5IVDA 5HK9A 4N8EA 2XUOA 1UKCA 3W04A 4DMKA 1XLWA 4X6YA 3K9BA 5A2GA 5F4ZA 4QDZA 3WZMA 1IZ8A 1AZWA 1QIMA 5AKXA 1H2ZA 3IBTA 1CVLA 1EK1A 2O2HA 2PU5A 3FWHA 1MTZA 3R3XA 4BATA 3L1JA 3O4JA 5HFNA 2E3JA 1AURA 1XZIA 4ZV9A 4AZ0A 3Q0TA 4F21A 2JBWA 3ESBA 1UK6A 3GFFA 1ACLA 3ILSA 4L72A 4EUSA 3AZPA 4UHDA 2XQFA 3P2MA 5KBYA 2C4HA 2HHAA 4PQEA 1DTEA 3DOHA 4DMFA 4FNMA 1JU3A 1ZI6A 1BS9A 1BU8A 1ISPA 4WDRA 2HL6A 4ZRDA 1B6GA 1QOZA 2XDWA 2XMBA 4Y2UA 4ARAA 1J06A 4AMZA 3C8HA 5AKLA 1EX9A 4XWGA 5LZ5A 5AM5A 4OSEA 2VT6A 1QIEA 1X70A 2PL5A 1ORVA 1BRTA 3C45A 3KDAA 2FJPA 5E2IA 4KAAA 2C5GA 1MJ5A 5BWCA 3DKRA 1T2NA 3O95A 2XUGA 4AB1A 3W06A 3T52A 2PSFA 4EBBA 4UBKA 5AKIA 1CUHA 3ESCA 2WIFA 4XIIA 3G8YA 3A6ZA 4J0HA 3IDAA 3H2GA 1LNSA 5K3EA 4HZGA 1EH5A 3WK9A 2WFMA 3VJMA 1WCYA 4B83A 1MT3A 1P0PA 4J7AA 3STXA 5HZGA 3VXKA 2VAVA 2WQZA 1E8MA 3G9XA 4C4ZA 2ZJFA 5AKGA 4AO8A 1JJFA 5LKAA 1XZKA 2QR5A 1LZKA 3FSGD 2ZJ6A 4NZZA 3ED1A 1J1IA 3I1YA 5C81A 1LLFA 5ALTA 1UOOA 2GYVA 2HADA 2QXTA 4CCWA 4C88A 2GYUA 3WK8A 5DYTA 3DS8A 1TRHA 4Y2JA 5DJ5A 2J3DA 2XMSA 1XZCA 4INZA 4J3JA 3A2NA 5ALZA 4FHZA 4D9JA 3PFCA 4A5SA 4LHEA 3L1IA 4BAUA 1ZJ5A 4WFKA 1A88A 4Y2YA 2XT0A 4IO0A 1MN6A 2EDAA 2XLCA 4Y7DA 1ZD3A 1FJ2A 3FOBA 3WL5A 3FVTA 1LPBB 4FFVA 1A8UA 2WTNA 2H7YA 2ZSIA 3H2HA 5BOVA 1ZIXA 1CUIA 4GXNA 2CUTA 5AKKA 1MAHA 4EA6A 2VJBA 3IVMA 3F9CA 1XRRA 1YB6A 3EQ8A 4YK7A 1JMYA 5ALUA 2W6CX 4H77A 1ODCA 1FFEA 5AKZA 1AKNA 4QZVA 3FLAA 1UK8A 3WKAA 5JALA 1N8SA 2AJBA 4BCCA 2WIDA 4X71A 3H1AA 4LKOA 1XZLA 1N5MA 4UFNA 4WCVA 4BAGA 2Q0XA 3R3ZA 4BC1A 1J2EA 1P0IA 4AO7A 3R3UA 3DEAA 2ROQA 3GUUA 1XRQA 3FYUB 3VKFA 2BGRA 1KU6A 1ZI9A 4ETWA 4KE7A 3BE8A 4E14A 4U2BA 4BP8A 3WA6A 1ORWA 4H7HA 4JEIA 5SYMA 1JJIA 4Y2TA 2XUIA 4AN1A 5ALPA 3V1NA 1CUSA 4C87A 2V9ZA 1LBTA 4X92A 5DLPA 3JYHA 4W1SA 1U2EA 2B61A 3D2BA 3ZWQA 2J4FA 1PFQA 2VJDA 5CXXA 2HA0A 1JT2A 1WB6A 4RNCA 1AC5A 2OQIA 2GZSA 2WHPB 1XRLA 3DCNA 4F0JA 3KSRA 3TEJA 3C6YA 3T4UA 2JEYA 3S8YA 4GDMA 1QLWA 5LP1A 4K6GA 4WFJA 4FBMA 4HXEB 4QEKA 2I3ZA 4Y2PA 5EHNA 1MNQA 4E15A 5ALMA 3KWJA 2WU4A 5J3JA 2RIPA 1F0PA 3I28A 1LGYA 4G8BA 2WUFA 3NGMA 2OLEA 3WK6A 4UHBA 3VDXA 4K6KA 5HF5A 4DNPA 1WB5A 1WHTA 2I03A 1EINA 1CR6A 1QIDA 3F98A 5A62A 1MX5A 1HPLA 4J0IA 4BDTA 4G5XA 3FAKA 3G0DA 1ETHA 1TK3A 1MNAA 3H2JA 5ALHA 1XZDA 2R11A 3D2CA 2XMGA 1Q84A 3A2LA 2ZYHA 2PX6A 2AJ8A 4L9AA 1NX9A 3HSSA 4DNOA 1VE6A 3AIKA 2R8BA 2XUQA 1CUEA 5DYYA 3I2HA 5AOBA 1XRPA 1J07A 3DNMA 3LIPA 5IVKA 4F5ZA 1QIHA 2VA9A 1KU0A 4Q05A 3AIOA 4LIPD 5LZ9A 3WJ2A 5AHXA 5ALNA 2O2GA 1USWA 3JWEA 1XZBA 2O7VA 3BF8A 1JU4A 1JFRA 3B12A 1LPMA 2X8BA 1CUBA 2J4CA 4E46A 3C5VA 3W2TA 5JARA 1Q0ZA 5AKEA 2DFPA 4BE9A 4H0CA 5AI6A 3F96A 1YAHA 2HA7A 4EY8A 2Y2VA 5JANA 2WG0A 4E11A 1QIGA 1O6FA 1DQYA 4NVRA 1SCIA 3ZLTA 3WL7A 2QMQA 1G66A 1XLVA 3HEAA 2XMDA 3QPAA 3QBJA 4W1QA 3QITA 2C7BA 3DJYA 5D3KA 3OM8A 5E4TA 3W9UA 4ARBA 4U2FA 4EB0A 2WIKA 3WWCA 3H0CA 5LIPA 3QPDA 5AO9A 3BF7A 4EZIA 3I1IA 2WJ6A 1GKKA 4BCDA 2PSJA 1EXWA 5BWBA 2AJCA 2VSQA 1FSSA 4RGYA 4X6XA 2XUFA 3IUNA 5KWJA 1GXSA 2XE4A 3OC0A 3WL6A 1QJ4A 1WHSA 1XZHA 1TCCA 2EEPA 1H2YA 5ALGA 1IUPA 3OPMA 2BUBA 1QIFA 2QUBA 4HXGA 3VJLA 1NU6A 1THTA 1QIIA 3STYA 4EY5A 1AGYA 3HACA 2JGIA 1YB7A 2QXUA 1THGA 2RHWA 3BL8A 3R3VA 4Y2RA 5SYNA 2WTMA 1IMJA 3GBSA 4DMHA 3PF9A 3BDIA 3EF3A 1C4XA 1GQRA 3HI4A 5FKJA 3NUZA 1R3DA 5A71A 4QDOA 1A8SA 4IH1A 2G5TA 3PI6A 1YAJA 3O9MA 3BIXA 4KE9A 2WJ4A 3I2GA 2ACEA 1AMNA 4QDTA 1F6WA 2PUJA 3ZPXA 4AO6A 3FBWA 1LPPA 4F60A 3O4GA 3OURA 4X85A 5DYWA 4I19A 2BGNA 5AIAA 4DSZA 4N8SA 5CH8A 1QFSA 4BRSA 5DNVA 2GBGA 4KEAA 3WKEA 5E4YA 3DD5A 5IKXA 4G4IA 2XQIA 3NOXA 1G5FA 4Y9SA 3D3NA 4W1PA 3FNBA 4H35A 4Q3OA 1RYYA 4B85A 5AKHA 3CCCA 2X76A 3VISA 3KWFA 2WUGA 1PJAA 3I6YA 3D5EA 2PPLA 2PBLA 1W6RA 2P8SA 4B0OA 4J0GA 2Z3WA 4OD0A 4OB6A 1EB8A 5K3FA 5ISMA 5A6VA 3QMVA 3ZLVA 2HRRA 2JGFA 4LXGA 3FYUC 2DHCA 1VA5A 3FCYA 5CT4A 4W1RA 5FUMA 2QVBA 2WM2A 3PE6A 4B0PA 3I2FA 4UBOA 5JATA 4QE3A 1W1IA 2XQKA 5ALDA 5DNWA 1CUJA 3F8SA 1LPSA 2WJ3A 5HF6A 3WK4A 4CG1A 5ALFA 3V1KA 3DYVA 5JAOA 2RI6A 5CT9A 4UBNA 3E4DA 4FMPA 3V1LA 3G02A 2O2IA 4QWWA 4ZXFA 2QJRA 2JEZA 4MJ3A 4QLAA 5C8VA 2QKYA 3FLBA 1Y37A 1CUAA 1XZAA 4K6HA 1UT6A 3I2IA 1GPKA 4MQLA 5C7YA 3D4LA 4GWLA 5HFAA 2PM8A 4UUQA 4QLOA 4DGQA 3WWPA 1SCQA 3WYDA 3KXPA 1XQYA 1WB4A 5LLSA 1P0QA 5FPPA 5ALLA 1C7IA 4B82A 1GGVA 2FJ0A 2ES4A 5ALVA 1HKHA 4B6GA 4X91A 2OCKA 5AM3A 4WDQA 3WKDA 4DNFA 3FLEA 5JD4A 3ZV7A 3WZLA 2G5PA 2OCIA 2OXEA 1K6EA 1FFDA 3OG9A 2CMFA 3H19A 3SX4A 5AM1A 4BTLA 2GBCA 3AILA 5HCUA 3DL7A 1LZLA 3IULA 2OCGA 4N8DA 2QS9A 4JYPA 3WIBA 5JAHA 4UHCA 4W63A 2HA2A 4Q34A 4OCZA 1JJBA 3AZQA 1VXOA 1EVQA 1R1DA 1QTRA 2VF2A 1MPXA 3QVMA 4KACA 4Y2VA 2Z3ZA 5K3AA 5BV7A 4EY6A 3CXUA 1ZICA 4BVKA 4CG3A 1A8QA 1LPNA 4LYDA 3EIOA 2H9YA 4MXDA 3R41A 4IQ4A 3S2ZA 5CT8A 1EI9A 4HS9A 3UMJA 1HBJA 4KRYA 2QJWA 4QNNA 5AKJA 2HA4A 4FLEA 3D2AA 5LZ4A 4Q82A 2B20A 2GBFA 4YX9A 1LPOA 4ZREA 3WYNA 2I3DA 1W75A 2XUJA 5AM0A 1EDEA 2VEOA 2UZ0A 4FLMA 1ZD4A 2VAXA 5JZSA 1XROA 4PW0A 1MX1A 5CH3A 1YS1X 4OU5A 1TIBA 4MWSA 2X5XA 4IHAA 1JI3A 2IIVA 4FKBA 4NS4A 4AN0A 3TJMA 2G4LA 6YASA 2XUHA 5I7UA 2BCEA 3DOIA 1QONA 1UKAA 1UK9A 2H1IA 1UZAA 2HA3A 2VT7A 4BVLA 4HTAA 1DWQA 3BWXA 3I2KA 5EFZA 2HA5A 2DHDA 1CUDA 4Q1VA 1OXMA 1T4MA 5DNUA 1Z68A 4CI9A 2D5LA 4JH0A 4YPVA 4N5HX 1JMKC 2H7CA 3HJUA 2H7XA 2RONA 2DSNA 3WIOA 5AK6A 3IIIA 1QTIA 3WI7A 1UFOA 4CCYA 2V97A 4GI1A 5E4JA 2OGSA 5AK3A 4BP9A 1CLEA 3C8DA 2HRQA 5CH5A 5JD5A 3ESDA 5AOCA 3V48A 2JGJA 3A70A 5EGNA 1ODSA 3ZLUA 1E5TA 1CUFA 1QIJA 4BVJA 3H2KA 1XKTA 5IH7A 1W52X 3K2IA 1R88A 1BCRA 3ANSA 4WJLA 4LYEA 2JIDA 4MYSA 2JGEA 3MUOA 1I6WA 2WIJA 3ICVA 1GPNA 3G0GA 4KE6A 5I9IA 1QE3A 2D0DA 1DINA 5FP0A 1U8EA 3OTQA 4RE6A 5IVIA 4B81A 3RARA 2GBIA 2CEKA 3WWOA 1HDEA 4B84A 3MVEA 3V1MA 3D0KA 4MEAA 4AMYA 5FXMA 1QO9A 1R9MA 4N5IX 5FLKA 1XRMA 2AJDA 1EK2A 1BEZA 3STVA 3NWOA 3N0TA 4M0FA 5AK4A 4HAIA 4UHEA 4H7JA 4UHFA 2QUAA 5LYYA 4PNZA 4X7BA 1WPXA 4H7EA 2XQGA 4B80A 3X3HA 3EQ9A 2BFNA 3BJRA 5ALXA 2JGLA 1XQWA 5A7HA 1L7RA 1TAHA 2OPHA 3UUFA 4FTWA 1PV1A 1LBSA 2HIHA 4FFWA 4UBJA 1XRNA 2QZPA 3E3AA 1R9NA 5AM4A 2IX9A 4OPMA 4DMCA 4FOLA 4FBLA 2BJHA 1GPLA 2W22A 2WLSA 3U1TA 4IH4A 5AI0A 4YASA 3RKSA 2XQJA 3DL4A 5DWDA 3W05A 4X3CA 4J0JA 5EI5A 3QYJA 3C6BA 4PV7A 1H2XA 3E1GA 4DTCA 4AX4A 4MYDA 4JYMA 5KREA 3FVRA 4XVCA 1K4YA 4G4GA 5EHQA 4U2EA 2JGKA 1HQDA 1P0MA 4ZWNA 1L7AA 5ALWA 5FPQA 1AX9A 1UKBA 4M0EA 4X6UA 4WY8A 1AUOA 4I4CA 1XZMA 2QT9A 4WY5A 4X97A 1OILA 5FOQA 4KR0A 1VLQA 4K2AA 4EY7A 3IUQA 1X2BA 1FFBA 3WK5A 3GA7A 3AINA 2ZVDA 1VKHA 4DM7A 2PSEA 5D7BA 2OGZA 3KOOA 3HYSA 1VA4A 3ESAA 4BZZA 2K2QB 1FFAA 2CB9A 4QWMA 5T4FA 2FUKA 1CEXA 4CIAA 3IUMA 2C0QA 5C8ZA 1U4NA 5ESRA 3TRDA 4B9EA 4HXFB 4BZWA 2ZYIA 3GELA 3A2MA 2BUCA 3OOSA 3WJ1A 5CT6A 2PVSA 4XJVA 4BBZA 5AI8A 1SC9A 4KAFA 1CUUA 2DCMA 4QDXA 1QFMA 4GW3A 1JKMA 4X95A 3QPCA 1RP1A 5LZ8A 5HF8A 2HM7A 5AICA 5JYCA 2C0PA 4J03A 4PO3X 1G42A 3QM1A 5HK8A 1B41A 3R40A 1DWPA 2OAGA 3O9VA 3G0CA 2PU7A 3BIWA 4AXBA 1D07A 1L7QA 1ZOIA 1XQXA 1YR2A 2HU7A 1ZJ4A 4Q3KA 3ZI7A 1YCDA 2Y1KA 4KE8A 1H2WA 2I78A 4OB7A 4PSCA 1CRLA 4KJXA 4JUIA 4MEBA 1YS2X 2QM0A 3G9UA 4G9EA 3VVLA 2XMQA 1IUOA 1UK7A 1R50A 3WKCA 1SFRA 2WUEA 5AI9A 2JF0A 2ZYSA 1YASA 4C01A 1CQZA 2CBGA 4FWBA 2CKMA 1CUXA 1MX9A 1BE0A 3D59A 2XUKA 3F97A 5HKAA 2WKWA 1AQLA 3C5WP 5AKYA 3W9BA 2VTVA 3WLAA 3FYTA 4U2CA 1QIKA 2HDWA 2XUPA 3ANTA 4P9NA 3DQZA 1YA8A 5LKRA 2Z8XA 2WFLA 4O08A 3C6XA 3C70A 2OQVA 1TKRA 5H3HA 5K3FB 1Y7IA 3VVMA 1IUNA 1MAAA 3PF8A 3SWWA 3BDVA 1UOQA 1IVYA 5D6OA 4PF1A 1ZI8A 4OYYA 2OCLA 2XUAA 3N2ZB 4ZV7A 2OGTA 2ACKA 3O4IA 4QDUA 1IZ7A 4J0KA 2PSHA 4G1FA 1M33A 3GROA 2VJCA 5ALSA 3DDUA 1CUWA 2ORYA 3WQHA 4NMWA 5CMLA 5EIEA 4GEGA 1XZJA 3DYIA 3AUKA 5A7GA 3HLKA 4ZI5A 1EA5A 4RE5A 3RM3A 3TGLA 4Y2SA 3V9AA 1NU8A 5ALRA 2Z8ZA 3PICA 1E8DA 3M3DA 3LP5A 1X2EA 2YASA 2XMZA 1TCAA 4XX1A 3LS2A 4CIBA 2CJPA 3CN9A 4PSDA 1N1MA 3PUIA 4HVTA 4HRXA 2HU5A 1MU0A 4DYHA 4UBLA 4H7IA 5CURA 1H22A 5K3BA 3U0VA 2WHRA 3STTA 5A7FA 4PSUA 4EHBA 1BEEA 2OG1A 1N5RA 3R3YA 2GYWA 3HC7A 3IUJA 4ZGBA 4U2DA 3D7RA 1CUCA 1CUGA 1ZGBA 3WMRA 3B3QA 5ALIA 3C43A 7YASA 4AZ3A 4WFIA 2RAUA 2WIGA 4CCYB 3H18A 1UWCA 1HL7A 3WKBA 4BRZA 5JASA 3C87A 4H7DA 3B5EA 4CFSA 4BC0A 1DU4A 5LZ7A 3WWDA 4Z49A 3G9TA 4TGLA 3EBLA 4ITVA 2WFLB 2JGMA 3CN7A 3HABA 3E0XA 3G0BA 5CTAA 5JD6A 1DWOA 5FRDA 1GQSA 3IB3A 3LLCA 4ROTA 5I8PA 1XZGA 3KD2A 2O7RA 5EIAA 1CUVA 3IURA 4J0DA 4A23A 5AI4A 1ZGCA 3HXKA 2G63A 4FDMA 4I3FA 1XLUA 4G8CA 2C5FA 1A7UA 3H04A 1CIJA 2J3QA 2ZSHA 2GZRA 5ALYA 1XKLA 2RHTA 1YA4A 4TPKA 2B9VA 4Y2XA 4C6HA 2V98A 4GBGA 4L3WA 3AIMA 3BJMA 1BN7A 3I6ZA 5K3DA 1ZD2P
chains in the Genus database with same CATH superfamily
2WR8A 4OYLA 2CLOB 3DHYA 1YS9A 3ENQA 1GXSB 1XIVA 1FC0A 3KU1A 4KQHA 1LDYA 2IEIA 2OLJA 2P9QA 3H9CA 3LSTA 3QE3A 4ZVLA 1Y1SA 4WW0A 3U62A 2HT6A 1BO6A 4M9CA 1IM2A 1HE4A 3PDUA 1EUDB 4HAXA 4IDHA 4I55A 1W4ZA 4OB8A 3N6XA 4BO8A 2X41A 1QG0A 3DF9A 1JTEA 2FRDA 4MPPA 4JBNA 1DVRA 5DYGA 5FI0B 2O4UX 1Q0HA 1DJQA 1OSNA 3L0SA 1V39A 1H0RA 1T36A 2E4VA 4KGVA 5DO9A 3UH0A 4H1WA 2WJPA 3SSMA 1BW9B 1QWSA 3IILA 4GX5A 3RSSA 2WG2A 3PFBA 3WV5A 3CGWA 2O1SA 4OQFA 2FEKA 4AZVA 2AXEA 2VF4X 3AFIA 1N0IA 1CS4C 1ZMTA 4ZEWA 3WLKX 2BKVA 3HY4A 1SC3A 6GPBA 4H0NA 3BE5A 4EWLA 2AQHA 1M6EX 3LFTA 1ZRHA 2VP9A 1WOMA 2XXAB 1XYYA 4O5AA 3IC5A 2ECFA 3GPCA 4OGFA 3RKUA 3ZDDA 4GWKA 3W1EA 2PV7A 3P2YA 1MA3A 1PNQA 1Y8RA 3BFVA 2G07A 3BXPA 4IS3A 1W76A 2YJ6A 4N49A 1FW8A 1QLJA 3DB2A 3A1TA 2OM6A 3UYLA 1Z34A 5AUNB 1TQHA 5CBKA 4Z4IA 4IWNA 1SU7A 3MT8A 1JVNA 2HMUA 4MAMA 4DLNA 4NCAA 4LJ7A 2E4UA 1D1SA 2YWEA 3I58A 3ZGVA 3E9MA 1J90A 3P8ZA 1DS6A 2MU1A 3M83A 3SYKA 1KZYC 3PV0A 1WDWB 4HN9A 4BB0A 2H17A 5EINA 1OA1A 2B4RO 1TYBE 4RK6A 1QRSA 3U6KA 2VJAA 3Q7QA 1FMTA 2VTBA 1D6NA 4IS2A 3ZWOA 4ADSG 5A9SA 5IUJC 1LF5A 2ET6A 2DUJA 4HDOB 1Z3CA 4Q4HB 1W8DA 4IDFA 1YRBA 4JGBA 1XT6A 1SUPA 2Y99A 3BRSA 3N39C 1OE0A 3WL8A 3AWDA 4KXYA 2WF5A 1HLGA 4IXDA 4XD2A 4ZMRA 2EX4A 3PUHA 3MSCA 2ZR7A 3VZSA 2FJUA 3P32A 1Z83A 4X84A 4AVYA 5JOQA 5FFMA 1VLHA 3M9XA 3ETHA 1HE8B 2ZJ0A 1UPTA 2CXSA 2Y93A 1XKXA 5KX5B 3AEKA 2FLVA 1GT6A 2JFNA 3B38A 3EBPA 4FGWA 4OP2A 1LK5A 1Y48E 2N75A 1PV2A 3K9NA 4DXAA 4YGXB 3AERB 4JBYA 2VK1A 3FWNA 4UZEA 4KREA 1JAYA 1ZXLA 4RIEA 4XEUA 4RQBA 1KEPA 3O8LA 2BR3A 5F73A 4DJDC 3GP8A 3AR3A 4DEYA 1B8NA 3G0HA 4LY3A 3KDPA 3I9V1 3BYZA 2I4IA 1A2OA 5KOYA 1BOFA 4L02A 1XRJA 3HVUA 3NXKA 1Z0JA 2C82A 3C6ZA 3ZTYA 5C8XA 3I04M 1TU4A 1YQTA 3LCRA 1RM0A 4LHVA 5EIHA 4YRLA 5BN5A 2C5HA 3PRJA 3W8NA 3SXUA 1XDZA 1NXSA 3ZIUA 2O52A 5EP1A 2XRZA 1ID8A 5AVOA 3IRUA 3K5PA 3CCFA 3NTRA 5CW2A 1VOTA 2RGXA 3WNZA 3IEVA 4QYMA 3ZZ0A 3RHTA 4NE9A 2R2AA 4J0CA 2I91A 4LRSB 1YCHA 1DOHA 2VP6A 3P2KA 1CPYA 1KYZA 4G1VA 1LFDB 4X7PA 1JAXA 3TPCA 2BHSA 2FHPA 4EHIA 4YJHA 4QXQA 5GGYA 3UMYA 4D4HA 1HZZA 5FV4A 4TYYA 1CUYA 4Y0AA 4CG2A 4US2R 4AF6A 4RVUA 4DG8A 3I62A 1R4ZA 4RSRA 4CKCA 3O2SB 1DBRA 4UMVA 1EAMA 3CR7A 3QFFA 4RS3A 5LZ2A 3QYPA 3V8VA 1WZCA 3CH7A 4DDUA 3FRJA 3B7PA 1NDUA 3BTOA 5SYAA 4YRQA 4YRMA 1E59A 4CQMB 4YMUA 3T1HB 2BHRA 4XGQA 2XLBA 1XN4A 4IH9A 2BDUA 4I5EA 5M34A 1V41E 4AWAA 2FOXA 1IN7A 4PPFA 4QGGA 3AKEA 4UE6A 4Y2QA 4US1R 3GG9A 4PN3A 5JFOA 3X1WA 3HG7A 1QFZA 2IPLA 4NBRA 1QG4A 4NCXA 4ODIA 4S35A 4Q5IA 5LB4A 1C1XA 3PC2A 4HSGA 1DEAA 4TRRA 1XE3A 2J5QA 3SHFA 1I0IA 5K4AA 2VHUA 1VM6A 4J07A 3AB3A 2WV7A 4XGNA 3UCEA 1OAKA 3CRMA 2V8OA 4IOKA 2HSEA 2NT4A 4L8LA 5J5CA 2Q2QA 4TTAA 4AUMA 3ZDQA 2ZRNA 2PJDA 3A6GA 3AVPA 4R3WA 3RROA 1IXSB 3VPAA 1FUUA 2PUHA 3BD6A 5TF0A 3TINA 1A95A 3K0KA 1I14A 4EZEA 1ENYA 3M81A 2ODQA 4LYHA 2HAEA 4GOLD 1W9HA 2UUAB 1WP4A 2NTEA 3VFDA 2C8JA 2A0WA 4PX2A 4RZXA 5IXSA 3N53A 3U3RA 4FYPA 2YFKA 2I6GA 4JSYA 4GKBA 3QV2A 3OJFA 4A9AA 3IERA 4LZZA 5AK5A 1EB9A 4JJIA 5JSYA 1ZVKA 5IXYA 4OQQA 2DKFA 1VI5A 4H1TA 4EG8A 2B4QA 1OCEA 1QRAA 4R7TA 5LCXA 1GQFA 2K87A 2V96A 3G3EA 3QLVA 2GTHA 3BMNA 3ZCUA 4KFUA 4QELA 4AJ9A 3W2FA 3QF4A 1GTZA 1NY6A 2GCGA 3P97A 3A06A 4WLOA 3IPXA 3SC6A 1FP1D 1YZGA 4TKZA 2YWHA 2FHSA 3W4JA 4IMJB 3GF4A 5C1IA 1EK6A 2O2YA 3JV7A 4CLOB 4CIDA 4HT3B 2AKAB 1Q1NA 3QPWA 1GTMA 1TUIA 4RCZA 3VV3A 2C1ZA 1XNJA 4EUEA 1CUZA 2WPDD 3AYXB 1JPUA 3JVIA 3MTJA 1C8VB 4PZCA 4LK2A 3AUFA 5CVCA 3T54A 5BSEA 1DQZA 1E63A 2E49A 3K1AA 4K5QA 5K3CA 1C0KA 1Y5MA 4DUYB 1M1NB 5BMVF 2IITA 3DAGA 1FBTA 2IEGA 1H2BA 1C41A 2JARA 1GY8A 1OXBB 3FFBA 5EXPA 5HF9A 4YFYA 4YUYA 3FOAA 5ALEA 1P9OA 1YE3A 4Q3BA 5T4HA 4KRXA 5EHIA 1GRNA 4NYJQ 3DGEC 3OQPA 4G81A 2XZOA 1LPAB 2GSWA 1NL3A 1S2DA 3BTVA 4BNTA 3RC9A 2Z2YA 4E88A 3E3LA 3IE1A 2PXHA 1AKMA 3PA6A 3R2JA 3R4CA 4UHKA 5KWSA 4ASUA 3HRIA 1QZTA 4ZO7A 4AP6A 1KEZA 1GNRA 4PZLA 4UNRA 3RLIA 1EFPB 1BX0A 1MMFB 4IHKA 2YFHA 2X1HA 3BXFA 5EWMB 721PA 1PYGA 1HEIA 4QQRA 1ATIA 5E6SB 5GOZA 5D5HA 3TM5A 3MCVA 1VGRA 3CWCA 3LPLA 5A4AA 2CL6X 3OM9A 1E2IA 2JHGA 4PXAA 3L4KA 2LV8A 2BEJA 2C5EA 4BV2A 3TM4A 2X1VA 2XYPA 7ADHA 1CQWA 1QYCA 3K96A 3NBAA 7REQB 2ON6A 2A35A 5JMTA 3NAMA 1Z9BA 4BMZA 1J9GA 1Z63A 1RWQA 4G4SO 1GVNB 2VBCA 2BDEA 3M6LA 2PD6A 4XTCS 5CM2Z 4QL3A 5AVKA 1H42A 1VZ2A 2IGBA 2PSDA 3L8CA 4UHHA 5B5SA 3GLHE 2QIOA 2DR0A 4KX3A 4EYGA 2BFAA 4PFKA 1WETA 1KQPA 3FYUA 2P0EA 1V5WA 2QYOA 4MVCA 4DY6A 2WRZA 3G7NA 5LUAA 5L6LB 2O2DA 4GYYA 2VQEB 2FU5C 3GD7A 4B43A 4O5OA 4RPCA 4MDEA 3P45A 2J5XA 2VIIA 3QKRB 3OZAA 5FTNA 3SHTA 3ZI0A 3NLLA 3UTDA 2EKPA 2ZBDA 1TB4A 3I6MA 2CW5A 4X44A 2C03A 1SCJA 1P80A 1XNGA 4FZRA 3ZE0B 3DZBA 1RIFA 2NW6A 3ND7A 3K1TA 1CJVC 1I2DA 3I39X 3K70C 2C4UA 4X1KB 4RLHA 3RVQA 3QZUA 5EN4A 2B78A 2V7TA 2LIPA 4HNGA 1W35A 2R5WA 3EX7C 2BFOA 3W3AH 1XL1A 3ECCA 5BQ3A 3JQFA 1E89A 4DILA 3I2JA 2J7PA 1U65A 2E87A 2WT4A 3D8BA 5KCMA 2Y76A 3GMIA 4UM9B 1ZGGA 5KTSA 2F55A 2NXNA 2P5UA 1E5QA 4JR0A 1B26A 1NF8A 1IEVA 1UJNA 1WDLA 5IK2D 1PL8A 2ZJ7A 1VXRA 5IJXA 3QX9A 4MR9B 3EA5A 4JUCA 1L7BA 4ZKDA 4XOIA 4KU4A 2PKEA 5AJHA 3KPYA 3DPSA 3O0DA 4E32A 2FDCA 5T4BA 3ZLBA 1LLCA 2CZQA 3RUDA 3W6NA 2ERCA 2SECE 3RSOA 4HDNB 4DRXB 2XTJA 5HKBA 1Y9ZA 1G41A 1K9SA 1UKVY 2PFSA 4M0MA 1DX6A 3KJZA 4H7KA 4UULA 4JI3B 1HT2E 2IPAB 2W6ZA 4K9NA 2Y6UA 1QV7A 2R65A 4UVHA 4C0LA 1U7UA 2OM2A 2Z1NA 3GLIE 1AIPA 3EMBA 5EZQA 4DCNA 5CCEA 4C6TB 1V1MB 1LSSA 2WWGA 3EK2A 5EVJA 4L74A 3VTFA 2UVPA 2YWRA 3A0UA 2QUJA 3LY7A 4GGPA 4MQUA 3NBXX 4LY6A 4QU9A 1YCFA 1W0KA 3KHSA 3THOA 3VDNB 4PYKA 1MZVA 3PDCA 3IIMA 4HEHA 1XTIA 1VL2A 3BCHA 4K86A 4O4LA 1NATA 1P5FA 1PX2A 1UBRS 5J4HA 2ZJ4A 2NSYA 4D98A 2X9QA 2CDNA 4X90A 1ZMRA 4D41A 4FYWA 1QGUB 4GM0A 2GEUA 3R20A 3HV0A 5BPHA 2PX8A 2VJMA 4LMRA 3SPXA 1H1LB 3ZXYA 4CV0A 3T7SA 2VPZA 1NF2A 1KMHB 2AG8A 1DOZA 3WGQA 4RMJA 1EE9A 3BRWA 4IGIA 3C4JA 3DEHA 1OBCA 2C2XA 4DA6A 2OCBA 4HEJA 1KRWA 4Z99A 3DE3X 4A2CA 2ECKA 3H9UA 2YS6A 4FFBA 5C3MA 5J2TA 1HNXB 5KTNA 5GONA 1QH8A 3N07A 2XUOA 1AXRA 5IC5A 1WLSA 2VSXA 4DMKA 5GVSA 5IJWA 2I62A 4BVGA 2PK3A 1Q0LA 4X45A 3K9BA 3OH8A 3R7AA 1OB5A 5K01A 4IEIA 1NBAA 4XLLA 4NAVA 3TW8A 2JLVA 1DG3A 3DVAB 4MZDA 3TSAA 5DGDA 1Y89A 4DAEA 3OZBA 1CY2A 1O95A 2OD7A 4UQOA 4J49A 3HCNA 1CVLA 2BFMA 3V6MA 4CR8A 1PDWA 4ZRNA 4E2YA 4QT4A 4B73A 3OQMA 2VPPA 1T6BY 2NZWA 4KNVA 4QXPA 3IIJA 4QUIA 1N6OA 3O4JA 4K40A 4GAEA 4LISA 5HFNA 5BW6B 2E3JA 3QWBA 4P32A 1XZIA 2P1ZA 4AZ0A 2BE9A 5CK5A 3D0OA 2QLNA 4AKIA 2ZXFA 2JBWA 1UJ6A 5IG2A 4LWQA 2C7RA 1XAJA 1TEXA 1J4AA 2RHHA 3ZCXA 2C2YA 2YX1A 3KSMA 4XWYA 1CVIA 4N5LA 1OMOA 3E61A 3PUKA 4HI0E 3AZPA 3DM5A 4MV4A 4IZ6A 4UHDA 4H16A 2ZDGA 5B64A 3G7UA 4EMSA 2GXAA 3C3CA 5FUWA 3R76A 1N7JA 1DTEA 2QL6A 2OZPA 4UAJA 3TB4A 1NJ5A 3T9CA 4DLSA 3LQFA 4WCFA 5A03A 1EP9A 1GZ6A 1PLLA 4GKJB 3BMOA 3GEPA 3EEQA 3M5PA 3MXOA 3QFCA 4JIMA 4YRTA 5DLEA 4LBYA 3GYBA 1UPCA 1LC3A 3GCZA 4PRKA 3FDXA 1BU8A 2GGSA 3N2GB 4NJEA 5EZYA 5CCXA 2YYZA 3WXMA 5DCWA 4OMDA 4TL7A 3CISA 2O3TA 2WTEA 2CBXA 5C34B 1P1JA 2RGCA 5GVRA 4YQEA 5EPUA 1S0UA 4RD2A 3CX4A 4F9GA 4RD0A 2FSIA 3KYDB 3EVNA 5HE9A 3U2QA 2OORA 5D6NA 3W90A 3CG0A 4DW8A 1GRCA 1NMXA 2YFQA 4Y2UA 3UWPA 5JS8A 3S2YA 4ARAA 3AVXA 2W2KA 4QPZA 5K8JB 1J06A 1GN9A 1XU4A 2E2WA 4AMZA 1NP6A 3FPAA 1C29B 4U0JA 4Q21A 1UPXA 5LZ5A 1E1MA 4E2XA 1REQA 4G1EB 3OEHD 2UVQA 3G49A 5AM5A 4BECA 3VR5H 2IXDA 1EFUA 4ZQEA 5H83A 1X70A 2IOFK 5ED0A 5DWQA 1U1IA 1X1AA 5I4CA 1BGXT 3BWYA 4EATA 5I6DA 2BKUA 1T6XA 3QVLA 4NHOA 5BYJA 3BMXA 4UVGA 1MJ5A 1G8HA 2A94A 5DT2A 5I48A 2IJGX 3W4IA 4E33A 1RXWA 4OLFA 2Q9CA 2GS9A 3IMEA 4WNCA 5DCLA 2Y1OA 1ULAA 3DKRA 3I9LA 2BDTA 4NENB 4BBPA 2VPWA 2WAYA 1SHTX 4BQEA 1QRDA 5K0EA 3M6XA 4WUVA 4RVNA 4MGZR 1TUEA 1XQ9A 5HX7A 4RTSA 4Q7EA 4ETIA 3B9BA 3THYB 3P27A 5M29A 4IIYA 1JSRA 1UDXA 1NPTO 4TWAA 5BSWA 1OLSA 3T52A 3ZV4A 3K8ZA 1BAPA 2EFHB 5IT5A 5FUBA 5AUOB 1P9RA 4MAAA 4UBKA 5AKIA 3I76A 1RM4A 1RYZA 4XIIA 5K0LA 4E2FA 3KBBA 3EXHA 3GUZA 1ZVVA 4J0HA 3IDAA 5KAMA 4EQ6B 1IZ9A 1CR1A 1A1SA 1R66A 1JRLA 3W9YA 4AU1A 4R5HA 1A27A 2GZAA 1RXEA 3CLTC 2X7HA 4W6ZA 3R75A 3VOAA 1EH5A 4WAUA 3K05A 1O2DA 4LHYA 2RGNC 2IW1A 3GRYA 5TT0A 4NAUA 1W47A 1E61A 2HHCA 4IVQA 4RY9A 1TJNA 1MT3A 1YS7A 4MARA 4YBZA 5LXTB 3BD7A 1D9XA 1ML4A 3KC2A 4MRNA 1T4CA 4KHPB 1YMQA 1RAGA 1DC8A 5I9MA 3AOEA 2AHRA 1U7TA 3O75A 4GE0A 4HB0A 3UJHA 4GKAA 3V55A 4CLHA 5FO0A 1PZNA 4HPJB 5KNDD 1JFFB 2V9PA 4DR4B 1U0LA 2F1OA 1E1KA 3NCTA 1E6KA 5LKAA 1XZKA 1PS8A 3IT0A 4RFSB 3TDMA 3NCHA 4AKSA 3DOCA 3K71B 4MPRA 1LZKA 3WP1B 1FF9A 3GLFB 3PCRB 3L1KA 1K66A 4JVOA 3C85A 3K09A 5T67A 1E64A 5BMVA 4EJ2A 1RYNA 3IBYA 3FDFA 2PKQP 1T3GA 4II3A 4RHCA 5C81A 1GGNA 5ALTA 4KQFA 3OFKA 4LF9B 1JBKA 3BSYA 3L7BA 3HDTA 3OUZA 1NQUA 3H4TA 3Q9SA 1NFRA 1WY5A 3EH2A 4I1IA 4M87A 1U0BB 2VNIA 3VKHA 2JIZA 4WVLA 3M6VA 3GNSA 2FPGB 2LD4A 3TH5A 1BXRA 3E03A 4AJPA 4ZU6X 2VJLA 2A4MA 1JX6A 2AMJA 2IL1A 2ZLBA 4FINA 3A4YA 5K0GA 5I3CA 2X58A 4WJZA 3E70C 2L42A 2P30A 5HM8A 2TRSB 3PVSA 3B7WA 4F46A 4J3JA 4BGEA 3ZZTA 2MSLA 4D9JA 3PFCA 2V4ZA 4IYRA 4F3KA 3I45A 3L41A 4LHEA 4K3UA 2QG9A 2W6PA 5LP6A 1KMQA 2WTAA 5JEEA 4E30A 2OBNA 5C3UA 1A5TA 4REOA 2KSQA 1UMDA 2YHAA 5DTQA 1C3LA 2CFCA 4WFKA 2XT0A 3PQ2A 1HDRA 3QHQA 5DU2A 1WMAA 5JTTA 3RWBA 2QSUA 5THKA 3VR6D 2COKA 4HNTA 1UQRA 1MIHA 4KQEA 2O5RA 1D2MA 4FEAA 3TVDA 4FFVA 1LPBB 2MSCB 3G2IA 3T7JA 2WTNA 4RHUA 4U39A 3HB9A 2QRVA 4BNUA 2IF0A 3KL2A 4BVFA 3MFQA 2ZUFA 2ZSJA 2ZSIA 5AYVA 3M1AA 1SBQA 4DLBA 5A04A 1TM7E 4E08A 5IKEA 3DTVB 1AHHA 4NATA 5KTMA 4BASA 3TI7A 4HWOA 3GGDA 3LU1A 3RC2A 1M34B 3CGGA 2UYYA 4L7QA 2ZJ5A 3NV7A 2VBIA 3F2IA 5AKKA 4ALNA 2FETA 5LYJB 1B6RA 1M2GA 3CUEF 5KKAA 1HOXA 4D45A 1WUTA 2OMKA 2R00C 1I10A 2OOKA 3QW4B 4UCFA 4X61A 4CKBA 4CR7A 3IVMA 1W30A 1NA5A 1NZFA 5I5EA 1C0EA 1AJEA 4X1IA 5B7QA 2HEIA 5J4KA 2A9VA 4EB6A 1YULA 5AKZA 2PHZA 3N2NA 1XDUA 4H2DA 4C4SA 5KYTA 1AKNA 2Q8NA 2ZR8A 1YB4A 3SE0A 5EE0A 4QZVA 2Q3EA 3GLSA 1KWGA 1SRQA 1D5WA 2ZB4A 5DW3A 4IDDA 5DWVA 2HEGA 4ZCRA 4JC0A 5CDFE 3A7DA 2NO7A 4G5RA 1HWYA 1Z25A 4CMIA 5HHTA 2AJBA 4F86A 2JS7A 5J59A 4DEVA 3KJHA 4TN5A 4GP7A 5BNIA 1I3OA 4YCMA 1DHRA 4LKOA 2OFXA 1N5MA 3L04A 3TB6A 4BZPA 2Q3JA 1GKIA 2PX4A 4BC1A 1XTVA 2NACA 3DP9A 1AKWA 4I36A 5HOEA 4HLDA 3O93A 1DARA 6AT1A 1W46A 2FN4A 1AH2A 3JAWA 3I0ZA 2HT1A 4RPIA 3DEAA 4OOEA 4UPEA 2WWHA 4IJUA 1YTLA 3E9YA 3H65A 1V5FA 4QXMA 5TMBA 1P18A 1GLNA 2TSYB 3GOHA 1T3HA 4J0QA 4UARA 2QRMA 2CJWB 4ZCIA 4K05A 4DLTA 5F7JA 2ARKA 2QTVA 3Q3JB 1ZI9A 2FQYA 2ZEJA 4IYJA 3VR2D 4ETWA 4HWKA 4QRIA 3FMOB 4UASA 2QPAA 4E14A 4F38A 1O96A 3V4PB 5JZVA 5LBIA 4AJNA 1TT7A 4D6XA 4U2BA 4WACA 3T7KA 3WA6A 1EQAA 3H9BA 1Z35A 1YDFA 2EKZA 2R60A 4I8IA 1W88A 2QVGA 1D7OA 4HMQA 4GZ6A 2CVPA 1EMDA 3PK0A 3LZ6A 3CWZA 3I01M 1Z7WA 2KS6A 4FZ3A 5L53A 1LA2A 3ITEA 4HDRB 1U0OC 1L4BA 4W5TA 1FLDA 4HH1A 3WQSB 1X13A 3VV2A 1CUSA 2CHVA 2HRDA 3E5MA 3EUAA 3CNBA 1XHEA 5SV2A 4C87A 1G7SA 1WTCA 4XASA 1HE3A 4U3JB 4PSVA 1CY4A 5G2OA 5CJPA 1VPLA 3NO4A 5J4YA 2FX2A 1AGRA 3MT9A 4WECA 4LF6B 3GJSA 3WB1A 3UG6A 3ILYA 4MV7A 3OF3A 5IM4F 1U2EA 3TTTA 1RPTA 2B61A 3K70B 2QQFA 1OVMA 1EGQA 3D2BA 4GQBA 2J4FA 2UDPA 3LH5A 4UTPA 1V8PA 4U7DA 4CKEB 1XPOA 1WB6A 2A0UA 3FGNA 4H6VA 3CY6A 1G8KA 1SBCA 4RNCA 1AC5A 2JJ8A 4MUIA 5HW0A 3A4MA 5IDWA 3NHWA 1ZOLA 4MRSA 4V0RA 4NCHA 3ZW8A 2ASVA 1QJCA 2XTZA 5AVZA 1NQ5A 2C9OA 4Z9YA 5TRTA 4LRYA 4ZO9A 5LP6B 2R97A 3DMHA 3VR5A 5KINB 3DFZA 5C5IA 2RKBA 1V7CA 3LBNA 3NHZA 3QW2A 4IPTA 4XVHA 1KDZA 5IKPA 4QTTB 3RAFC 4B17A 4CM8A 1UBNA 3EGOA 3RTBA 4B3IA 3FJ1A 1PCXA 2X0IA 3WGTA 4OHFA 2WMOB 2UV8A 1R8JA 3TS1A 3KXKA 4WFJA 2OUIA 1N8KA 2DT8A 4FBMA 1FTSA 5LNK6 3VGJA 1L5RA 2C5BA 4P2GA 4BL5A 2I3ZA 6REQB 2OK8A 3SVTA 3HJGA 3LQKA 5EHNA 3OICA 3U7QA 2ATCA 2W11A 1ISSA 1MNQA 5F33A 4E15A 3AF1A 1FTGA 4JSTA 4HBGA 4TLMB 2EW8A 1WLYA 2O1EA 4LXXA 3R7LA 4KRFA 2VXBA 3IOBA 2QLLA 2W6JD 2ZAIA 3OE7A 1EGVB 1ESDA 3GLTA 1NI5A 1D1QA 1A0OA 1INLA 4XJSA 3I1JA 1QGYA 1LGYA 2F1KA 1FFXA 1QK5A 2AI1A 1SCUA 2GQ0A 2HQ1A 4ZALA 4B45A 2NO1A 2WUFA 3T3IA 4BGVA 1KDRA 1ZEMA 1PZXA 2IYZA 4B3GA 3L7AA 3HDYA 3I72A 4RD3A 4MVJH 4DIKA 4FX2A 4K6KA 4PPNA 4XOUA 2PCLA 1CQPA 1PQ4A 4DNPA 4HGQA 2P4QA 3K9HA 4LK3A 5BQOA 1WHTA 5FI5A 4WN9B 2H0QA 1EINA 2A7XA 3VR2A 4UTNA 3PRHA 4UZFA 3RB8A 2I66A 3F46A 4YAUA 2BZGA 3VC1A 2DKOA 1DB3A 3GZ4A 5A62A 2D3TA 5CW1A 4HNUA 4HVLA 1JG1A 2IYRA 3Q85A 3LWDA 1E0JA 2BKEA 2EARA 1EFTA 4AM8A 1JFTA 5EA2A 1ETHA 1B0PA 4Z7NB 1PUXA 4MRVA 4AMBA 5BWNA 4X64B 2P65A 4TTRA 1V3UA 3RS8A 1JN0A 2OHJA 2PT7A 5H80A 4DJEC 2XWSA 5FORA 1Q84A 3NMUF 1NMQA 2I2AA 2O06A 4ZCSA 1EAYA 2NZ8A 4KIFA 3FMGA 3RW9A 4WZ6A 5ICGA 3H16A 3PITA 4E4TA 2AJ8A 4W9MC 3GEDA 3R7FA 3HSSA 2IUEA 4YP0A 1VE6A 4LDZA 4RMHA 1LF0A 2A5DA 1EVKA 2AFVA 1CUEA 1KQNA 1MR3F 4TMWA 1Z6GA 3GUCA 1DAGA 1L8QA 2XTAA 4K28A 4UVIA 3A10A 4ZHQA 4ZZ3A 1XTTA 4WINA 2JBAB 2WHYA 3TKAA 1XFAA 2GWRA 2Q99A 4IF6A 1QIHA 2AS0A 2C3PA 4G25A 5BQXA 1J6UA 1GFIA 3CR8A 3O1JC 3ZE2B 3PDIB 4XGIA 4IILA 3WYFA 3IDFA 2FZLA 3RTAA 3ZU2A 1IXZA 1OVGA 1JEEA 3TRKA 3W7BA 1USWA 2JIQA 4L27A 3OQ6A 3JWEA 4K81B 3MCUA 4BEBA 3D9QX 3R5TA 4D92A 2Y1WA 1W2WB 1RAEA 1OT3A 3OTOB 3THYA 2FH5B 3AIIA 4OK6A 4YH1A 4C7OB 2VN8A 1E99A 3K1JA 4URXR 3IKTA 1NVEA 4PXYA 5G1OA 1NC3A 5ELXA 4NCKA 1QC5B 5KX5A 2GD6A 4HDKB 1ZN7A 4MUFA 4M3NA 5JCOC 3T1TA 1CUBA 2J4CA 4TMTA 3DZKA 1OLXB 3HGQA 1M5RA 3L84A 3BGIA 3CRW1 4A0RA 4XZ3A 2GNPA 4GVLA 5CYOA 1O08A 1A9TA 2L69A 4IRXA 2UU9B 3LQYA 5CEJA 2XB4A 1TAGA 4FIDA 1CZKA 5H9WA 5BN3A 5ABPA 2PDAA 1P29A 1VG0B 4F1WA 2GBPA 1F06A 2ZUCA 2IV7A 1TC2A 3B3AA 2F4NA 2VXOA 3EVGA 1ISJA 1HFJA 5DLYA 4TVSA 3N8HA 5AI6A 2CNNA 3KEGA 3HJBA 1YAHA 2E6UX 2GAJA 3TRIA 4LVNA 4AYWA 5AW1A 4ASUD 4IIGA 2B2NA 4BLRA 2VDOB 3NANA 4TWRA 1CEYA 1F8FA 4IRUB 1YQDA 3GP3A 3NAQA 4LSZA 4YMIA 2NNLD 1EFLA 1K6IA 3KYDA 4E11A 2J0QA 1GLVA 1U6IA 4D97A 2NU8A 1O6FA 2C98A 4ZFNA 4KHZA 3PFGA 4TKUB 1T8YA 2WYUA 1DQRA 3RAPR 2O2SA 3D8UA 3ANMA 3DF7A 4IP0A 1XBTA 4Q7LA 2FMKA 2Y05A 2O7QA 1EM8B 3PVCA 4WA7A 3U3DA 3R5HA 3QEMA 4GUAA 1JE0A 3FZQA 3K31A 3N8DA 1S4QA 3NYIA 2NV6A 2IYAA 3DJYA 3OM8A 4LYGA 1GGMA 4NH4A 1GITA 5DIZA 3TZ6A 1YZKA 4BQQA 3EG5A 1SZDA 3OY7A 4ARBA 4F9EA 3IKJA 3SGLA 1K5GA 4U2FA 3SDZA 4BGUA 3TIIA 4HHEA 2WAAA 1LB1B 2QY6A 3DH0A 4YEDA 3ZK8A 2CXNA 2LUOA 2AI2A 3QSGA 1U0NA 4MJXA 4V24A 3VR6H 2HLPA 5AO9A 2NSJA 4JBIA 2ZSFA 3SQWA 1PR1A 5TV2A 1IBMB 2FYTA 4XM1A 3TIFA 1ZVQA 2ZIVB 4EZIA 5JJKA 3MZ0A 3VI4B 2B3TA 4J7CA 3ZIAA 5IAEA 4XJXA 3OZTA 1FU7A 1F14A 1Y4SA 4BCDA 3M33A 3AL0C 2AJCA 3O31A 4MQEB 3UIEA 1FSSA 2OGWA 2ZIWB 4YGYA 1EUDA 3OFND 3ZBQA 2AG1A 4CTMA 1ZNZA 3NC0C 1ORTA 5TQVA 3LXXA 5C9ZA 2ODNA 1V8FA 2PWPA 1W34A 4RDIA 1GXSA 5SY6A 4KYUA 1JA9A 1JWAB 4KWTA 4EPRA 3V46A 3OC0A 3ZNQA 3RPEA 4QQFA 3W9SA 2SKDA 2OHOA 4IUDS 1RXSA 2Q62A 3ZYCA 4ISCA 5JFTA 1G20A 1HGXA 1HZZC 1PL0A 4FYHA 1NLUA 2C0CA 3PSHA 5B37A 4DC0A 1CY8A 3D6JA 5JXGA 1Z6YA 5JUWA 2R3SA 2JLCA 3WICA 4QUBA 3RI3A 1H2YA 3HVHA 4BEWA 4U1RA 4WXHA 3OPMA 5BYBA 3OOEA 3KYBA 4EW1A 4LBVA 5D5QA 1QIFA 1V2GA 5EZ5A 4HDMB 4I46A 1LBQA 1Q14A 3IPCA 4FFBB 4KQWA 5I5GA 4JC8A 4WLFA 5J2TB 1OJLA 1VB5A 4UNSA 2BBSA 2WUWE 3UWKA 3TAXA 5DF1A 3VJLA 1THTA 4EY5A 3AR4A 1BVYF 2AEFA 4A82A 5AVWA 4C7JA 5FD8A 1Y3FE 4OUDA 2IHZA 5L9AA 3U60B 2QENA 2IFTA 1LKZA 1R4NA 1G2QA 2DPMA 2WICA 1JE1A 1DHTA 2AYXA 3EGVA 3PG5A 4FHDA 4Y2RA 4C6TA 2VJMB 4DG5A 4BZXA 4MI9A 4YMGA 3L7DA 1MB4A 2JKVA 3DEZA 3AU9A 3KQPA 1IMJA 1TCVA 3GBSA 3MTIA 2DPHA 4C30A 3U7JA 3PF9A 4DMHA 5B7GA 4DBVO 3BFJA 4O4LB 2HSGA 2C9DA 1D03A 3EF3A 4UATA 1JEOA 2HHJA 1GWNA 2Y9PB 4E09A 1PVDA 3R6TA 4TMKA 4QOSA 3TCKA 3NUZA 7MHTA 1R3DA 3AEQB 1U8YA 3ELDA 3LDHA 2Y0DA 2NTJA 4P58A 4RXUA 2I33A 4INAA 4ETNA 1PNRA 4MR9A 1MEJA 3R5SA 2GVZC 1SQ6A 2NLOA 4IG9A 1NHWA 1V8ZA 3I32A 4CLRA 2KLBA 2O48X 3EN0A 4H6PA 2F8TA 3CZ4A 1V7PC 3NEJA 2P11A 2AFRA 4WV3A 5GQSA 5F5XA 3V8QA 3T1QA 1T2VA 4NQZA 4NU8X 3UB3A 1W7AA 1FXWF 1O7JA 1J5PA 2PSSA 3OJLA 1NQTA 4KCGA 3MJTA 4KVZA 5EQFA 2GM9A 5KJCA 1F6WA 1IDOA 1KZHA 4FHFA 2Y27A 4MHTA 2AC4A 2H4XA 3LDAA 3G8DA 3I12A 3P19A 4JY7A 1V4VA 4RA6B 1YDEA 1Y8ZA 2ZIAA 2YMMA 1E4EA 2J3JA 1UBHS 2BGNA 5AIAA 2FVXA 5FTJA 3AUUA 3HZRA 4IIDA 2XZPA 1YDWA 1Q0TA 4NBWA 3QKRA 3CH4B 1QFSA 3SE7A 1PFYA 2P68A 3F1KA 2GAAA 3CZ5A 4RGVA 2FMTA 4KEAA 3HADA 1R15A 3E84A 4LTNA 3WKEA 3T8YA 2BBOA 4QSHA 3TE6A 1M5UA 3JAWB 3AOGA 2Z4RA 5JMPA 5FNZA 4UEWA 4R1PA 1FBNA 4ZQIA 3DD5A 3L0IB 4C1BA 2QMZA 4EA8A 5HVNA 3P9NA 1O6BA 3GJRA 1P2DA 2ORWA 5KAPA 4LC0A 1G5RA 3O1HB 3TOVA 1U1GA 2Z8YA 2R8ZA 3WMEA 5JQWA 5L51A 3PYLA 4MUXA 2ZREA 3RIYA 3BGSA 4YMTA 4ZJZA 1LVGA 1ZNWA 3BB4A 4PO9A 3U1VA 2ONJA 2PH5A 2A67A 2W93A 4YV0A 4D3FA 4IGFA 5G40A 5H8WA 3GJ7A 1Y82A 2D7JA 2EX1A 4I1VA 4R1MA 4YUAA 3S29A 4WL0A 3IP7A 5JSFA 3IAEA 3IGFA 4B85A 1T9HA 3CCCA 1JZTA 3SAJA 3PRYA 2REQB 4Y6RA 2OP1A 3I6YA 1J22A 2D1RA 2IYXA 3D5EA 4EPYA 4ND8B 1ECBA 1YOVA 5KQRA 2IQ5A 2OZLB 4EG1A 1F3OA 1FNSA 5CG1A 4OD0A 3FAZA 2ATEA 1DBSA 2CL5A 2Z2ZA 2C4KA 3V7UA 4F6RB 1NSFA 1C81A 3LK6A 4M88A 2ZBQA 1IEQA 1G20E 4J90A 4NFHA 5E6UB 5EZYF 2CV2A 3L6BA 1FPMA 1XNQB 5T57A 2Q7XA 1H6CA 1DUIA 4X8HA 3NNSA 2HRRA 3WISA 1GVHA 5DX8A 3V3TA 4LXGA 5EWMA 5JFGA 3FYUC 1B73A 4MQ5A 3W2HA 4RXTA 3ZHUA 1IN1A 4N9QA 1SHKA 1ONOA 3E2IA 1Z5GA 1M34A 1VA5A 2D62A 4TXNA 3HUUA 3VM6A 5JBNA 5KSWB 5LQJA 1Z4NA 4DJJA 4CKWB 3TLXA 1MJFA 3GIWA 3PE6A 1XR3A 3L1UA 1L7DA 2XA9A 3F6YA 2EAUA 5E7MA 3SNKA 3PU6A 4YMVA 3IQEA 3MT7A 1KI9A 2ZW9A 5JATA 3UT5B 3KSZO 2QT1A 3IP8A 2FMUA 1ZH0A 4LNHA 4M0PA 4M76B 4BLPA 1IN8A 2B0JA 1NF9A 1Y1QA 1CUJA 3N28A 1Y4DE 3RYIB 3NGLA 3LZCA 1GZ5A 2V7XA 3WK4A 1YR1A 2JANA 2ZS7A 2QN9A 3F49S 3ZHTA 4IKPA 5ALFA 1OV4A 1QGZA 3DYVA 5JAOA 2CLSA 1IRIA 2AUNA 3PGKA 4A6XA 4DZZA 3GCXA 3OTHA 3FW1A 4UDNA 2JAXA 2UYGA 3ETDA 5CT9A 4UBNA 3D4OA 3E7DA 4KDFA 2XCSB 1X7YB 3E4DA 2NUTA 1HMPA 4FMPA 2TMYA 4YRAA 3G82C 2YJNA 5HDBB 1MA0A 3PXCX 2Z09A 3NX4A 4RSGA 1MAUA 2O2IA 3G02A 1BVHA 1SC1A 2CCKA 1EFHA 3B7GA 2PMEA 5LLDA 1Z18A 4H4EA 3HM9A 1GUYA 5GV8A 2PT9A 4RV5A 3NETA 1KYWA 4PWYA 3HCOA 4N0PA 4XYLA 4MHOA 4NV0A 2BR4A 2G72A 3A37A 3SZOA 5IDXA 1M2NA 1IQUA 2IZ6A 5C8VA 4FHCA 1TKCA 4JI2B 3FLBA 3RVJA 3VX4A 1NUTA 2CJFA 1OUMA 5F51A 5GOTA 1C9KA 1YQGA 4C0QC 5KVVA 3HJTA 2FPXA 3FY4A 2G1JA 2PLFA 1QO0A 2X7JA 1EUQA 3A2KA 2DZDA 4U8GA 3MAGA 1SUSA 1B74A 1YJBA 3CLKA 5IHXA 5C4MA 4R9RA 3COYA 3K0CC 1RWOA 4MQLA 1KAHA 4GWLA 4HGOA 4KDRA 1ZQ1A 4M1QA 4HQRA 3RFUA 2YQZA 2BGJA 2JKYA 2FZKA 4JYBA 4GYJA 5TR9A 3SKYA 2JDIA 5K99A 1XA0A 4W7IA 1Q1EA 4O4HA 1YB5A 1EFAA 3IMCA 3TW6A 3GWGA 4CQMA 3IBGA 3TLAA 3WYDA 1D5CA 4UD6A 5L95A 2O8EB 4RPLA 4DWWA 1MHPA 3ITDA 4KYTA 4MQFA 1WB4A 1RLMA 3IHLA 1E5XA 1GSHA 2O05A 1P0QA 1JSZA 2DWPA 3ETNA 3NHFA 1FSZA 4KNWA 4PZEA 4BKOA 1QFYA 1BJRE 1JSXA 3V2GA 4DUZB 1F60A 5BSMA 1U3FA 1HURA 1L1FA 4X3PA 4B6GA 2V4UA 2WTUA 5DHAA 1A04A 3Q0EA 4MR7B 5SZIA 1SUAA 2OCKA 3I4FA 4FD3A 3ROEA 4E4RA 1GSIA 1JYSA 4QU8A 3IUBA 1TVKB 1U9YA 3KAQA 5CLQA 1JXQA 2E89A 4UREA 3ZWDA 2C04A 4ZVSA 1L7XA 2A88A 4UW9A 1PZGA 5CLIA 3SXJA 3WZLA 1YRYE 2G5PA 1P7YA 4ARCA 3EEYA 2PLWA 2G4VA 1PBTA 4BMYA 4KMRA 2BTQA 3JQDA 4BN5A 2C95A 1VBFA 1PJBA 2HMSA 4TZKA 2CMFA 1HEUA 2DCUA 2WQ6A 3H19A 5FBZA 3SX4A 3O4VA 4PY2A 1C1HA 3LECA 4KIJA 5ECDA 5EEHA 4X66B 1N32B 1ZOOA 3V7FA 3OF5A 5FIUA 3E8MA 3AERA 4LYAA 3QVXA 4WOPA 2C8VA 3CZ9A 4V1CI 1R12A 1ZSNA 4NENA 4ZOQI 5E3HA 3ZBTA 4V0SA 1U5AA 2YUIA 5EG5A 3WNVA 4XXHA 4G0XA 1J0CA 1Z2DA 3VYWA 4EG3A 3AILA 1UJ2A 3ULKA 1UMBB 1ULHA 2I6SA 3IPLA 1X9HA 3KDSE 4HDQB 2OWEA 3JZAA 2WPDA 2PVPA 4UAUA 4TKVA 1J39A 4IJQA 4M8SA 1OXKB 1RAHA 3RSLA 4MI3A 2MYNA 2QW0X 4G5GA 3RYCA 2H18A 3DL0A 5DV9A 3IULA 2EL9A 3HA7A 3WIBA 4JYPA 4UOEA 3LBHA 4L4UA 2HNBA 4NTZA 3QUTA 1SUBA 2ODWA 3O3OB 4B6QA 4OCZA 2Q07A 3IEUA 4AI6A 3GNLA 3IUYA 1M8GA 1EVQA 5KNCH 1II9A 1R1DA 1Z0DA 4I08A 1AUVA 5GY7A 2FPLA 2GSDA 2WJAA 2Q5LA 3MCZA 5FJJA 3UFBA 2XOEA 2YIVX 1MPXA 3DZCA 4WZBE 2YNMA 1JR3D 2UXBB 5F4BA 4Q4HA 2DQKA 1PG5A 3DWEX 3RASA 4HZUA 1WL8A 1NVKA 3JQAA 5KUTA 3EOBI 1TQ4A 2C84A 1ZICA 2AMFA 2XY4A 1ULSA 1BJKA 3A3OA 2OHGA 1C1YA 1A8QA 5DMXA 4B5KA 3E8XA 3T5GA 5KNBH 3AY3A 3R9IA 1R6BX 4G65A 4A27A 2H9YA 5K4HA 4B1FA 2ST1A 2X19A 3W7AA 2HOQA 1P62B 1X9GA 2GDZA 5CLGA 4BO3A 3PSAA 1I7LA 2IYQA 5CT8A 1V3TA 3GJXC 4EA9A 3SHQA 3QTTA 2IXFA 3QUQA 1TFRA 1PGOA 3G8AA 1KARA 3LHKA 4DPKA 1E2DA 2XWQA 3UMJA 4ALKA 2I67A 3D7NA 1IDN1 1H2RS 1TVKA 4KDEA 1QG6A 3BN3A 4KTVE 1KVTA 3E0QA 3D2AA 5KYGA 3ZVRA 4KO1S 2RGAA 4Q82A 5KDLA 2EOAA 5K0BA 3CPSA 2P0AA 2QLJA 4UU7A 1OQAA 1ONSA 2ATVA 1CR2A 5DYIA 1ILEA 2QL7A 1VIAA 1Z8NA 3E15A 3W5BA 2BKXA 1IZYA 4F2WA 2P2CA 2I3DA 4JL6A 1F5NA 2AEEA 2BFBB 2QM3A 3D81A 5DGTA 3FN4A 2A78A 4GOJA 3L8ZA 4FFSA 1EDEA 2VEOA 3LW7A 3SX0A 2OPBA 1H65A 2FUCA 2H31A 3IO3A 4FC7A 4DCTA 1U1FA 3LGSA 4FLMA 3T34A 1DXHA 2VQFB 2VAXA 1VLMA 1M74A 1E9RA 2Q6TA 3U0BA 3NV9A 1G3UA 4D4KA 9MHTA 2O5VA 4IMPA 3IAS6 1TTQB 5D3MA 1L5FA 5A6SA 2QQGA 4PW0A 2R86A 2H2GA 1UP4A 4RJLA 2Q1TA 4LPSA 4LUCA 1H05A 4U8HA 4Q93A 5HS4A 2Q3FA 1ISMA 3HJHA 2W83A 1ACMA 5HQJA 1RBZA 1SKQA 3URKA 1C9DB 5IKMA 5J4VA 1I8TA 3KJXA 5AHKA 2FY8A 3SZ3A 5BR1A 2V0GA 2EERA 3WB9A 3ZLJA 4FYVA 4MYRA 4R3NA 4DZTA 1F0KA 4U6QA 1KSHA 1FXUA 3GLKA 3I34X 1U02A 4HB4A 2X6QA 4AN0A 5G4KA 1Z62A 4GRDA 3S8EA 1U2PA 3EHDA 4G4SP 4PZ9A 3VU9A 5DCYA 1L0BA 1WXFA 1YQQA 1QG2A 4U63A 3DAHA 5HR5A 2XDQB 5I7UA 5JSZB 5IT4A 2R6GA 2AWOA 1OBOA 2ORVA 2OYSA 1QONA 2C9ZA 2VEDA 1YVEI 3R7WA 3U9TA 3MQ2A 2DTEA 1SKYB 4Q37A 4MMZB 4BVLA 4EMBA 5JQGA 2HTEA 3BWXA 4ZN6A 4MW9A 3NBUA 5K8IA 1JJVA 1QH1B 4KITB 4AY2A 1WF3A 4KMMA 5BT8A 1K27A 3UZUA 4B3JA 4D8VA 1KHHA 2H16A 4X5OA 4P1ZA 3K0FB 3RS0A 4PAGA 1H2HA 1JW9B 2UVPB 1JWLA 2EF1A 1QWOA 1Z68A 2CFIA 1CVRA 1PJTA 2HLDD 2PH3A 3OZCA 1YS6A 4Z4CA 4HK4A 4BMCA 4AZTA 4EEXA 3J80A 2O1WA 3PJRA 2I4MA 3S68A 1GLGA 4JLPA 4JH0A 4L22A 1TTPB 2BFFA 4IIJB 4MV0A 1YQXA 1KYYA 4FUQA 3H5RA 4YRPA 3ZE1B 2P2SA 3LMKA 4FMDB 5BNZA 4YPVA 1CSEE 1JEYA 4EDHA 2H0AA 1PU2A 4N5HX 3CZCA 3TEMA 4YRKA 2YMQA 2H7CA 2PQMA 2QNBA 1Z5PA 4JVSB 4JCCA 2H7XA 2DSNA 16PKA 2A9OA 5T6MA 3FBGA 3FNQA 4GICA 5T8KC 5JCJA 2P4UA 5H81A 3D1VA 1CDOA 2WA1A 4NOMA 2E5WA 1WOYA 2P9GA 4DIMA 3A1DA 3EVDA 9LDBA 2A5JA 2I7VA 4OHUA 5BVHA 3EXAA 1LWOA 1QQAA 2EP8A 1BMFD 4Y98A 2CF5A 4KBFA 1RQLA 5F52A 3R7DA 3RS5A 4RM3A 3NUQA 3LWZA 1E3WB 4GI1A 1ZLXA 3STHA 1YNOA 2HQSA 2LKCA 4HEA1 2VHZA 2YYAA 4GMKA 3ZTTA 2REQA 5LIRA 1II8A 4OHRA 4DQXA 1XXHB 1YKFA 2HRQA 5F23A 3V48A 2MSKA 3A7EA 4OP1A 3WHKA 5EGNA 1K2WA 1UZUA 3CU5A 4GBED 1E5TA 1KK3A 1Y3AA 1CUFA 3F4BA 5A02A 4ZJUA 3INTA 4Q6WA 4OJNA 4C1NA 2BGUA 5IZCA 1VRCA 3C7CB 1T1SA 2R96A 2ZRJA 3HFGA 1XKTA 2PLAA 2PGOA 2P78A 4TL8A 4EBFA 3L6DA 1NN3A 3NWEA 1JAIA 1W36B 1N78A 4CKXA 4Z4GA 2RCNA 3KXIA 3LCVB 2XF2A 1I0LA 1BCRA 3ZCVA 1MEEA 2CF6A 1X1SA 1KKMA 4WNAA 4WXRA 2P6RA 1YWWA 2ZIEA 4LYEA 1N1EA 3BD9A 2JIDA 3GN1A 4B4VA 1YH3A 3L7CA 4K0RA 1LY1A 3ER9A 2JGEA 4LY9A 4ZAGA 3I6IA 5AXCA 2WIJA 5JWHA 4GDFA 2WWWA 3U3KA 3VC7A 3ESXA 4D99A 2D0DA 1NTRA 1GQYA 4PLVA 4M1ZA 4CEJA 3R4VA 4PNHA 1UKYA 4TMFA 5BNTA 5HKOA 4B76A 1V11A 1U8EA 3GARA 3KOMA 4JN6B 4D74A 3ZJUA 4G0QA 3A26A 4RE6A 1DC3A 2Y71A 3ZCPA 4XGRA 4CF5A 1EPUA 3QUAA 3CV3A 4CGYA 1NNSA 4URFA 1IOZA 1SIWA 1IK4A 2HCJB 4GNKA 1G2IA 1LVHA 1Y5NA 5AHWA 4AZWA 1QP7A 4RVSA 2GBIA 1LRKA 1I24A 2CEKA 3AETB 3DZIA 4YJGB 4QRHA 3WWOA 4B84A 1TAUA 4YIKA 4FN5A 1URPA 1RLIA 2VNKA 5JCXA 3TX2A 5FUXA 4JLKA 1G9XA 1K8ZB 5LQDA 4A03A 1BFKA 3WDSA 2WMYA 3WXBA 3FX2A 4FGUA 5FXMA 4RV9A 3W4KA 5EJFA 2CNOA 5FLKA 3S28A 2ZWVA 4JASB 2ZI9A 2GLTA 3K0EA 4PYNA 2P2NA 4AY5A 2P7IA 3K0FA 1EK2A 4A8JB 2V3CC 1BEZA 1AF7A 3O8QA 4E5YA 2PBFA 1Z16A 4QATA 2XNKA 2RHLA 3CRVA 1L4YA 3EY9A 3K1AB 4RIIA 3R8XA 2GN0A 3L4BA 5CB4F 2ZBVA 2FPSA 2NYAA 3K4PA 3NJRA 5HBGA 2H1FA 1QP0A 5DBOA 1E4YA 4B80A 2JFBA 4CL2A 3EQ9A 1E9EA 3PNOA 3PEWA 1GZHB 2A58A 3E9CA 3PFWO 4XCVA 1Y3BE 1T5TA 2RHDA 4RZSA 1YA6A 2OFFA 4BLSA 2CSUA 4AURA 1HFEL 3BMNB 5IUNC 4FCCA 4J0EA 4MSUA 1QKJA 3I8XA 4PS0A 3L8HA 1ZGHA 2IIBA 4XIYA 2VZ0A 3UUFA 4FTWA 3VYSB 5KVSA 1AA6A 2GHIA 2MHCA 3EDYA 3Q2IA 1ZH4A 4ILEA 5IZ4A 5DGHA 2NQ8A 1ID1A 1I01A 3H9QA 3M4ZA 3PX3A 2XECA 1HT0A 4FFWA 2EVWX 1MABA 2QZPA 4BS9A 5KOJB 2Z95A 2PKWA 5A6SB 2X8WA 1W87A 4EAQA 2DAPA 3EPLA 4QTYA 1OR8A 3CEJA 4DMCA 1QV6A 4FDAA 4FOLA 4FBLA 1P7VA 4HTFA 2G17A 1Q92A 5GAJA 1J9EA 1V8OA 1GPLA 2W22A 2P5TB 3BQMB 3DMYA 5MGBA 4GYWA 3JQRA 3RKSA 1NM5C 3ZUPA 4MCIA 5DWDA 5FEMA 2L17A 1VHTA 4YCDA 3W1VA 1G1AA 1RJ9A 3A4LA 3R3SA 1HQKA 1MOPA 1H1DA 2WB4A 3CKKA 4PVDA 2AG5A 5IBCA 3L3BA 3KJEA 1F2TA 5BN4A 2LP4Y 4HUTA 2VDKB 1E60A 5EI5A 3B13B 4KGXA 1VCIA 5SY9A 1XXLA 2ALJA 1U1EA 4PV7A 3DE7X 1LDNA 5HJEA 4P54A 2PUTA 1NHGA 1SWWA 3FVRA 3TL2A 1N57A 5I9NA 3KB8A 1XTQA 1E5LA 4X0EA 1RBYA 3W34A 2JGKA 3E9QA 4BRWA 3U9SA 3C3DA 1L7NA 1XZPA 2QJFA 3FCEA 3S5UA 4B4UA 1MXFA 4JLWA 5AVTA 1Z4QA 1JEJA 1RFLA 1YBVA 4YJHB 3O38A 4FD2A 4RWZA 4F2PA 4E13A 4R2KA 4FCWA 4X6UA 3IEKA 4WY8A 1AUOA 1NUQA 4I4CA 1AZLA 3LC0A 1VJ0A 3CPEA 4ZI7B 1Y5LA 1Z5NA 5IHPA 2Q5QA 2RH9B 3DEYX 3TO5A 4M38A 1Z0FA 1XK7A 3EAGA 2QT9A 1CNEA 1M7GA 4XB2A 4X97A 5FOQA 1GM5A 3IAAA 3DZDA 1BDMA 3IAFA 3EDOA 4EY7A 2JFWA 1BXGB 2JAWA 1Z7GA 4QJ5A 4XCXA 1KO1A 4RMIA 3E9NA 2IV2X 3WK5A 4CM5A 1MJGA 2DUWA 4CBVA 2YRXA 3MINA 1CRQA 4TRMA 2IZOA 2Z5VA 5C5CA 1GL3A 3EG9A 2PSEA 3VSAA 3ELWA 2WAXA 5A3SA 5BW5A 2YN4A 5D1NA 4CIVA 2Y9MB 4R54A 2IEBA 4FHEA 2AVDA 4D4MA 2PX2A 5HOQA 1UANA 3MJHA 3ZW9A 3ZVKA 3QLJA 2IK8A 2Z30A 3HYSA 3ZE7A 3M2PA 3P0RA 3BERA 2JD1A 4QWMA 3N0RA 1GZVA 1EFVA 4WEQA 4N9WA 4IDOA 5F9MA 4LWOA 1XTSA 4KO2S 4NKRA 1W4BA 4NZMA 1J49A 2NUAB 3RVKA 3SLGA 3SOZA 3S2SA 4C7OA 3A6FA 2ODEA 1LJLA 2GF0A 3B1YA 1SURA 3NHRA 1DQSA 2C96A 4X63A 1Q1ZA 2Q9BA 1W5FA 4YAEA 5KYWB 3A2MA 3FBTA 3HA3A 5IWAB 4BNFA 2ZIXA 2BUCA 2IEAA 4ZYYA 3KSDO 3VMMA 3PDIA 1ZH8A 2BM0A 4JYAB 1A5SB 1N5OX 2VJPA 3ADDA 1JALA 2V9CA 5FUQA 1H94A 1TI7A 1VL5A 1ZCBA 3OJOA 4P83A 3QVWA 4WASA 3CA8A 4YJ3F 4YT5A 1VI2A 5CA0A 5L3QB 3II6X 4IIXA 5C1BA 1MENA 3IQGX 1SC9A 3MEQA 1UP7A 1CDZA 1APBA 1L7VC 1LNQA 2WWVD 1S2OA 1CUUA 2F9LA 2VPYA 1UPUA 5CB0A 3T5AA 5BXQC 3BL5A 1C30A 1JKMA 1HUQA 3JWHA 4KWEA 3QPCA 2Q6IA 4Y9RA 1RP1A 1T9KA 5HF8A 2J87A 3FYHA 3U7IA 4B8YA 2DTDA 3H3JA 1N7IA 2HJWA 1X7ZB 4JP5A 4FZJA 3KQYA 5ANRB 1ZN8A 5HZHA 5K8LA 1U7WA 3LRXA 1RYDA 5JYDA 1IATA 4RMNA 5DNCA 4F5DA 2ENUA 1NBWB 3CR3C 3W2EA 5F1OA 3O83A 2ZZNA 1EP1B 5F9FA 2DPGA 4QBHA 3F6RA 2PU7A 4PGGA 1PVOA 5G0UA 4AXBA 4KBGA 2V58A 2BMVA 4E4YA 1X86B 4C2TA 4ND6A 3QBVA 1XQXA 1YR2A 1EU1A 5TT1A 3E18A 3IDSA 4ZHSA 4Q3KA 1YCDA 5C8YB 1JG4A 4RKEA 5JVDA 4ZT3A 1N2OA 5I7OA 1UFRA 4YRGA 1T8UA 4J8PA 2CVZA 2IEZA 2AW5A 3RU3A 3NC1C 3NORA 3WE7A 1C0LA 2FZWA 4Q02A 3F0TA 3PQ7A 4MIYA 1OIVA 1N2IA 3LC2O 4BKPA 3T9BA 5LOVB 2RAFA 5F21A 5BN1A 4A7PA 2E21A 4MEBA 4NABA 4RD4A 2QM0A 3NJ4A 5CM8B 4RTMA 1P7PA 1SCUB 3IVGA 3IQDB 1UK7A 1NW8A 2GRJA 4JXKA 4Q66C 2WD7A 1NUSA 1B8OA 3M1IA 1YV9A 2YNMD 1F3LA 1L5WA 3FCUB 4QQ8A 1WDMA 3ZQJA 2QPTA 1E7MA 3FOFC 5AJYA 5AI9A 1P19A 5FADA 3GOQA 3ROMA 2C20A 3EVFA 2PTGA 2ZYSA 1PTJC 5G0TA 1YASA 1A71A 1PJSA 4NOLA 2J45A 2X9LA 4AKEA 1QSGA 5EC8A 1KJNA 4MVXA 2CBGA 2CKMA 4G0OA 2TMGA 3PGVA 1T9BA 2C42A 1XCPA 5EMJA 3DOJA 1MX9A 1TZCA 1U5BB 1NXTA 2HMAA 2R1TB 2VC2B 3EEFA 2ZVPX 3JYQA 2NPFA 5EJMA 4BGIA 4Q3EA 4RZ2A 2YN2A 1ZK3A 3D59A 3PJDA 4HO1X 5L7YA 2WKWA 2D7CA 2DRIA 2PZBA 5AKYA 5IDQA 4JNKA 1UBLS 2QTWB 4ED9A 4UXHA 3BSWA 3G59A 4ZICA 4OYHA 5CDUA 3FTFA 4E7OA 3AKYA 1QIKA 1GOTA 2H2IA 2I80A 3FZGA 2CHUA 1T0HB 1D6MA 1ULTA 4Y6GB 1V1RB 2G40A 3DQZA 2HC9A 3L07A 3MRXA 3AESA 2IHKA 3OPYI 2JJYA 2A9PA 3BA6A 4CM7A 5IT0A 3IPYA 1E9FA 5JRZA 3IDOA 1PWHA 3GDFA 4YPFA 4FFLA 2FNAA 5LSAA 4EHHA 3PGMA 4LKRA 4CODB 2P4HX 4RORA 3C6XA 2ZZKA 2BEVB 2J8ZA 3NTOA 1IAVA 3E9ZA 3HUFA 4MTCA 1NRWA 5FBHA 1AK1A 4V0MA 3WLEA 3ANNA 3ZHRA 1DTWA 2AJTA 2PUFA 2OZLA 1ZIPA 4L9SA 3TRJA 1OJ7A 3VVMA 3GRCA 3OE7D 3SWWA 1QHXA 1ZNYA 4ESVA 3BDVA 3LL4A 1IBKB 1VPVA 1DAHA 2VWPA 4PF1A 2ZYAA 2O8EA 1DC7A 1TMOA 2JB9A 2X7XA 4D0RA 2BIFA 1BA2A 4FGSA 1A8IA 4HQOA 1N6PA 2OCLA 4NBTA 1Z2EA 4XCQA 1SUEA 2PKCA 3N2ZB 1A77A 4ZV7A 3O4IA 2ACKA 1FSFA 4QDUA 3L0CA 2O6LA 5BV0A 1OWLA 4J0KA 4Y1EA 1WQ1R 2HI0A 3KVYA 4KN6A 4G1FA 1DDIA 4WKPA 1J5EB 1U3TA 1TCUA 1U98A 7ABPA 3GROA 5CDYA 3ENKA 1T26A 1ZONA 5BVGA 3RJ9A 3B60A 1J00A 1W73A 2A57A 3DDUA 5ALSA 1L8OA 2KBEA 1SPBS 4HYEA 4MRRA 1GUDA 2RCYA 4K9MA 4PX9A 4FMBB 4R69A 3DBLA 2FG6C 2FEOA 5FNVF 3FUVA 3ZKAA 5JD3A 1UMKA 5FOXA 2OBYA 4DQDA 3WRYC 3VR4A 3AUKA 4CF3A 1OU0A 3O0TA 4PLYA 5FLYA 2F9FA 4D9GA 1NU8A 1L1EA 2CNDA 2J1LA 3PICA 5CYPA 1MW9X 3VNRA 1X2EA 3BM5A 3IIKA 2ZULA 4PGMA 2IYTA 4ZO8A 4MVJI 5KMGA 3AY6A 3RYHA 1E79D 4B75A 1OW3B 2W2OA 3ISTA 3MOGA 2IU6A 1PX0A 2IBSA 2O3JA 2JI8A 3JD3A 2WT8A 1JBQA 5DTEA 1JPNA 1W8IA 3UMRA 5A1TA 3EQZA 4J1NA 4EKGA 2CJPA 2XQVA 1KNXA 2ZITA 3QPBA 2HTFA 1UDCA 1EP3B 1Y8CA 1B14A 3HR4A 3LFHA 4ONEA 1ZYUA 1CQJB 4MHSA 4JBWA 3HNOA 4L6IA 1NAHA 2QDKA 1NVTA 3OM0A 2BF4A 5JXIA 3ABIA 3GDGA 5EQTA 5AVXA 5ICMA 1QGAA 5IZCC 5CX1A 5A7FA 1ZQ9A 3SZRA 5K6AC 3B8HA 2B2XA 2OG1A 3FUXA 1IY8A 5HQ3B 2C00A 2IC5A 2QRPA 3C3AA 3EVBA 3GJZA 3LHDA 2C9MA 5F1KA 4MDHA 1SBZA 2GYWA 4CM9D 3FPJA 1G8FA 3IUJA 2WC1A 3EZGA 1MOSA 1M10A 2W37A 1M7HA 1XG5A 3W5AA 2G4CA 1XDGA 2BF7A 2YS7A 3HCRA 5KQSA 1NDQA 2XUZA 3HBFA 1J42A 2UZAA 5EXDA 3AF2A 1ZL0A 4KNYA 8LDHA 3C15C 1H8HA 1P1FA 3OMWA 4GPBA 5DHFA 4AZ3A 4BQOA 3ZWXA 5KC8A 5FLXA 4PQRA 3QKIA 1KAGA 4RTRA 3D7KA 4Z8YA 2IPOA 1S2MA 1UWCA 3GB9A 2NAFA 4BRZA 2NZXA 1E7WA 1K4MA 2GTIA 1G20B 4YYEA 5CM9C 4ZGWA 2IUUA 3NKVA 5KJFA 1VE5A 4PHCA 4ZQHA 1NULA 1J8QA 1ESCA 4URVR 4JDPA 5K0ZA 5IM5A 4OQYA 4OQEA 3CVOA 3OZSA 1T0UA 3WWDA 2H6EA 1T35A 4L4SA 1YE5A 3UJCA 2YV5A 5FA5A 3ND5A 4XWKA 1I1NA 3NAZA 3N8GA 4Q0MA 1RWWA 2Q6OA 3FJYA 3KEQA 4ILKA 2W71A 2JGMA 2H2WA 3UJ6A 3BJEA 3HABA 5CTAA 5JD6A 3OKFA 3LA6A 4HLUA 5J5AA 1XRSB 3NHSA 3RSZA 1K9VF 1NJFA 3ZJ4A 5F7OA 4ARSA 2PPVA 2PR2A 4MQ6A 1XMXA 2Q2NA 2X5OA 5I8PA 3NOQA 1LX7A 4OLJA 3NDIA 5HQTA 4J1QA 5EMLA 1CZUA 3SJ7A 3P2JA 1IQ0A 1E6WA 1H5QA 3Q9UA 3WYBA 2CFSA 3HXLA 2ZVJA 4KW7A 3VR5D 2HSDA 2ZJ2A 1XCBA 2YWFA 3EUFA 4D3YA 2Z98A 3HWX1 1QE0A 2VRNA 3I9OA 4PR0A 2F4VB 1LW6E 3GAFA 1N6HA 1M1YE 2G63A 3PX2A 4ZCPA 4EF5A 3K9LA 4FDMA