2PX6A

Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
253
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQPTHNSLFLFDGSPTYAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioesterase domain
publication title Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 2px6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2px6A01
2H7XA 3RKSA 5EHZA 3W9BA 1VA5A 3BJRA 1DWQA 3ZPXA 5LKRA 1CRLA 2HFKA 4QZVA 3IBTA 3QH4A 5DJ5A 1RYYA 1K5PA 1RWQA 5ALLA 4PQEA 1N1MA 4RE5A 4DMFA 5AOAA 2JGMA 5FPPA 1BEZA 4KEAA 4B9AA 3BIWA 3QMMA 3AUKA 3V1NA 4J3JA 3YASA 5KBYA 5AKXA 1VOTA 3W04A 2YASA 3JYHA 1CIJA 3LS2A 4EY6A 2PSDA 3FCYA 2WHPA 1AMNA 3UUFA 2VA9A 4J0DA 1XZCA 3KSRA 2DHCA 1ZI8A 4F5ZA 5JANA 3I6YA 4L3WA 5ALGA 3WWOA 5IVKA 4XVCA 2AJCA 5DYTA 3U1TA 2X8BA 2G5TA 1NU6A 4UHHA 1WHTA 2JBWA 3AZOA 1LBTA 1QO7A 5ALVA 3Q0TA 5ALFA 1DX6A 1G5FA 2CUTA 1MAAA 4Y2SA 1CVLA 5CXXA 2HL6A 4I3FA 4IO0A 3BIXA 1IUNA 4RNCA 1Q0ZA 1J06A 2GYWA 2I3ZA 3FVTA 1XZLA 1UOPA 3PF8A 1JT2A 1Q84A 2V9ZA 3VVLA 2ZYSA 1VZ2A 3D0KA 4OB7A 4X91A 5ALZA 1ZGCA 5ISMA 2HU7A 4W1QA 5EIAA 2JGFA 5ESRA 3G0GA 1TAHA 2VF2A 4FMPA 5EIEA 4Q34A 5LZ9A 5JAPA 1Y37A 1HL7A 3QBJA 3KWJA 5AI5A 5JAUA 5A62A 5AI4A 1IVYA 2VAVA 5AJHA 1GZ7A 1YS1X 4AX4A 3C6ZA 5ALPA 3C8HA 4BCBA 4BCCA 5CURA 3MUNA 3QPAA 5A7GA 5HFNA 3FSGA 3JWEA 3O4GA 1QIGA 2V96A 4LXGA 5AM0A 3OTQA 4N5IX 1ZJ4A 4MYSA 4BC0A 4UBKA 1YA4A 3W2TA 2HM7A 2PSEA 4BB0A 2XUAA 2B61A 3P2MA 4FBMA 4CG1A 1UOQA 2ECFA 1LPNA 1J2EA 4GHWA 3SC2A 2WJ3A 1IZ7A 4U2GA 2QJWA 5E4JA 3C43A 2RAUA 2AJLI 5FDFA 1DT3A 1XZKA 1JKMA 3WKCA 2JEYA 4J0JA 4DMKA 3LIIA 1CUXA 3N2ZB 3PICA 1VE7A 3QPCA 2Y2VA 5KWJA 1UXOA 1QO9A 4LKOA 2WUEA 4C6HA 1F8UA 4FLMA 2HRRA 1QE3A 4U2DA 1ORWA 1IMJA 2G4LA 2QR5A 2ZYRA 4FFWA 4KYVA 4OB8A 5JATA 1N5RA 1MNAA 4G4GA 4W9RA 3FCXA 4IH4A 3TJMA 4X6YA 3NOXA 3FSGD 1XZIA 5CTAA 4PSCA 2I78A 4DTCA 5A7HA 3H17A 2QXUA 2XE4A 4WY8A 4B9EA 1GPKA 5AKIA 2EEPA 3WK7A 3WL7A 4UBMA 4UBIA 5AI6A 2ES4A 3HABA 2Y6VA 5AM2A 3FLEA 4G9GA 1LPMA 4ZRDA 1U4NA 2O2HA 1IUOA 1XRMA 1H2ZA 5CRIA 5FUMA 4OCZA 4CI9A 2XUQA 2RI6A 4U2CA 2WIDA 1BS9A 3A70A 3CN7A 2G63A 1X70A 3BF8A 4AMZA 2Z8ZA 1EDDA 3IA2A 2WIGA 1MO2A 2JF0A 4FKBA 1HQDA 2WTMA 5AKEA 1YA8A 4OU4A 4ZV7A 2XMDA 2Y2UA 1P0PA 3E1GA 2HA6A 2BGRA 4UHFA 1ODCA 1WB5A 1DU4A 5ALQA 2V98A 5IVDA 1CUEA 1S8OA 4NMWA 4CIBA 1WHSA 1HBJA 2FUKA 1EK1A 4X95A 1XRRA 1EB8A 1ZOIA 2XUIA 3DL4A 4E46A 3WMRA 2OQVA 1ISPA 1XLVA 4OYLA 4BC1A 3HACA 3QZUA 2PUJA 2C0PA 1MX1A 1HPLA 2JGIA 5AI8A 3DDUA 2O2GA 3FYTA 1LPAB 1DTEA 4NS4A 1AGYA 4B85A 5HF6A 4LYEA 2PSHA 2XLCA 3DLTA 3F97A 1OCEA 3HRHA 5JZ9A 2BGNA 1GQRA 2QZPA 3K9BA 4JUIA 4KE8A 3HYSA 2R11A 2P8SA 3STVA 3EQ9A 5I8PA 3B12A 4CFSA 4V2IA 3A2NA 3LLCA 2WHQA 3WKBA 2GZSA 3RLIA 5CXUA 1LZLA 2OGTA 3DD5A 1G66A 3WZMA 3Q8WA 4EUSA 4GDMA 2BUBA 4E14A 1QIDA 2OCIA 1XZGA 3STWA 4C4ZA 4X85A 4N5HX 1QIJA 4EHBA 1CQWA 1KEZA 4UHCA 5D3ZA 1YSCA 2VATA 3EBLA 1K63A 5AKYA 4J0IA 4O08A 4W63A 5EIHA 3FLBA 4K5QA 4MWTA 4G1FA 2ZJ6A 4DSZA 1W75A 5JADA 2K2QB 2GYVA 1L7QA 4UHEA 1FFCA 1R50A 4J0HA 3WI7A 5HK9A 2BUAA 4B0PA 4QLAA 4U2FA 1VZ3A 3STXA 5A2GA 2WM2A 4B83A 2OCGA 1YR2A 3RM3A 3VDXA 4ZXFA 1E66A 1A8QA 1JMKC 4K6HA 2RGUA 1LPSA 1AQLA 4WFKA 1YAJA 2O7RA 3STTA 2VSQA 4AO7A 4UBOA 3F67A 2UZ0A 1EH5A 1W4LA 5HFAA 4MXDA 1QLWA 4IQ4A 2BUCA 3DS8A 1N8SA 4AQDA 3BWXA 2XMRA 4ITVA 3M82A 1EHYA 2J3DA 3OG9A 1CUIA 5K3AA 3AIMA 2G5PA 4DGQA 4OYYA 4FOLA 5DWDA 3C45A 3V9AA 3QMVA 3OPMA 5FOQA 3IUJA 4Y7DA 4FFVA 4HRYA 4X71A 2ZSHA 3WKDA 4X7BA 1EDBA 1MTZA 4B82A 4NZZA 4MWSA 2EDCA 2C5GA 1VLQA 1EVQA 2NW6A 1Z68A 2OAEA 3H19A 2VJBA 1QIMA 4C88A 5ALTA 2ROQA 5AM4A 4P93A 1CUFA 4HZGA 4XJVA 4DIUA 4HTAA 4DNOA 3ESDA 5HF8A 5AKLA 4FWBA 4DNFA 3C87A 1CLEA 2OCLA 1PJAA 3F96A 2B4KA 2J4FA 1CUZA 1ACLA 3FVRA 4BTVA 4J0GA 5AHXA 1CFJA 2DSNA 3G02A 1CV2A 4G9EA 3C6BA 4U2BA 4IHAA 4Q3OA 1CUBA 1D07A 1GGVA 1CR6A 4QDUA 3H1BA 3K2IA 4B81A 5ALSA 1VKHA 1EXWA 4H7DA 3JW8A 3EQ7A 3AINA 1QGED 1UKBA 1HLGA 4X92A 3GBSA 1PV1A 1NX9A 4FDMA 3S2ZA 1XFDA 2HA5A 4D9JA 1CUVA 1CUYA 4DNQA 5HKBA 3WYDA 2D5LA 4PSDA 1QTIA 4XX1A 5DNUA 4ZWNA 4FBLA 3IIIA 5AK5A 1DQYA 1FFEA 2ZVDA 1QIFA 1W52X 1MJ5A 2DCMA 3WKAA 1MNQA 2IITA 5BV7A 3V1MA 1UK8A 2Z5GA 3I6MA 5AK4A 1FFBA 2HA0A 4BBZA 3VVMA 2WUFA 2Z3ZA 1PFQA 2H1IA 2WKWA 5FPQA 3FNBA 1G42A 3ZLUA 5DNWA 1GPLA 5SYMA 2AXEA 3D3NA 2H7YA 1XZFA 2FJPA 3FOBA 1OXMA 1MX5A 1XZBA 3TGLA 3G7NA 4S0XA 2DQYA 4H7FA 1K6EA 4KAJA 1EDEA 1F0NA 2GBCA 3O4IA 5CW2A 1C7JA 2W6CX 4H7EA 4JYMA 4ZREA 4IH9A 4PO3X 3GROA 4BRSA 3GELA 3DYIA 4MYDA 1CQZA 1ZGBA 5DLPA 4HXGA 4INZA 5LLSA 5FV4A 5CH3A 3RK4A 3PI6A 1SFRA 3WK6A 4Y2QA 3G9ZA 1ZD2P 4Y2VA 5A71A 3C6YA 1LNSA 1P0QA 1GXSA 3ZWQA 4BZWA 1TRHA 5C81A 4EY7A 4W1PA 4B80A 2AJ8A 2RHTA 4EY4A 2CKMA 5ALNA 4PSUA 5AKJA 4WFIA 2C4HA 3W05A 1MX9A 1E3QA 1FSSA 2WSLA 1B41A 1JFRA 2XMZA 4GEGA 1XKLA 1IZ8A 5FKJA 5LZ4A 3IB3A 2Z3WA 1MU0A 4BATA 1E89A 4N8EA 5EHNA 2OGZA 5AM5A 2WG1A 2I3DA 2Y1KA 2ZYIA 4JH0A 1XQYA 3ZI7A 2E3JA 2J3QA 4MQLA 4AN0A 5JIBA 3DNMA 5A6VA 5ALEA 4I19A 1FFAA 3H18A 5AH0A 4HRXA 2PU7A 4AXBA 2ZJ7A 1T2NA 1H23A 4CIAA 5ALDA 4HXFB 1SCKA 1HKHA 5AKGA 5ALUA 3E4DA 2QS9A 2FJ0A 3UMJA 4L9AA 1CUJA 4AO8A 5FLKA 3R3XA 2QKYA 3KD2A 4Z49A 4UBLA 1DX4A 5FP0A 3W06A 3O4JA 4J0CA 4QDTA 2QVBA 5AP9A 4AMYA 1FFDA 1BEEA 4QDXA 5ALJA 5JZSA 4KRXA 3BDVA 4MEBA 5AI0A 1JJFA 5ALOA 3VISA 2QRUA 4G8DA 4K6KA 1NU8A 4AO6A 1XZAA 4Y2JA 3WA6A 4G4JA 5C7YA 1A8UA 2O2IA 4G8BA 3O0DA 3EIOA 4BAGA 5JYCA 4EY5A 3H2JA 5EHQA 2CBGA 4CCWA 3QITA 3FYUB 1A8SA 5ALKA 1BU8A 5K3BA 3EQ8A 3IUNA 2QOEA 5E2IA 2XQFA 3BDIA 4IH1A 1ODTC 3PF9A 3H2KA 2VEOA 1SCIA 2H9YA 3B5EA 5HQ3B 4Q1VA 5DYYA 3V1LA 5LZ7A 2RIPA 3F9CA 2DHDA 5K5EA 1SCQA 1KU0A 1XZDA 2V97A 1IUPA 4HAIA 5ALWA 3TEJA 2RONA 1M33A 3IVMA 3V48A 3GFFA 5AM3A 1XLUA 4AZ0A 4F60A 3WIOA 4HVTA 2VJDA 1W1IA 5LP1A 4KJXA 4YX9A 2ACKA 3QMWA 3DQZA 2B20A 1LBSA 3I1YA 4PV7A 1H2YA 4UFNA 1EI9A 4X97A 1LZKA 1QZ3A 4DM7A 2AJBA 1AURA 3KOOA 4H7IA 3ZLVA 3SX4A 4A23A 3WYNA 2WIKA 4GI1A 1VE6A 4NVRA 3M3DA 3O95A 1EK2A 2R8BA 3FAKA 2BJHA 4J03A 3GUUA 3T4UA 4KRYA 1UK7A 1LGYA 1T4MA 3R0VA 2OGSA 4A16A 3I2GA 5K3FB 4C01A 2XUDA 5K3DA 5HF5A 1C4XA 2XQJA 3HSSA 1QIIA 3H2HA 3D2AA 4TGLA 5YASA 3MVEA 3VJMA 1R4ZA 4XWGA 5LYYA 1JJIA 2XMGA 1ORVA 2JGJA 5CH5A 4FNGA 3NWOA 5AIAA 2OAGA 3STUA 1VA4A 3MGAA 4BP8A 4UFPA 2HA4A 1E8NA 3HC7A 2X5XA 4RPCA 4N8DA 4DLNA 2WJ6A 1CEXA 2XMSA 1AKNA 5JASA 2QM0A 4X6UA 4DMCA 1J1IA 1VXRA 2PM8A 3O4HA 4P9NA 4W1RA 4EY8A 4QWWA 3L1JA 1YB7A 2QUBA 5JD5A 1JU4A 2CEKA 1XRPA 4G4IA 3KWFA 1CUHA 3VKFA 5KWIA 1X2BA 5AI9A 3ANTA 3D2BA 2WU4A 1ZD3A 2PUHA 3OOSA 4CG3A 2O7VA 4Q3KA 1CPYA 4P08A 4LXIA 4YASA 3H2IA 2GBGA 4BDTA 3WL8A 1QJ4A 2X76A 2WILA 2WHPB 2WG0A 3QM1A 3WWPA 2ACEA 1QOZA 2JGEA 3KXPA 2JGLA 5DTJA 4X6XA 4CCYB 3UUEA 4P92A 2J4CA 1QTRA 5T4BA 3ZV7A 2QTBA 1A7UA 1LPBB 3L1IA 2C7BA 3G9XA 1ODSA 3SK0A 4WDQA 2JEZA 4ZI5A 4GW3A 3ILSA 5F4ZA 1OILA 2LIPA 1YAHA 4OU5A 4BAUA 3WKEA 4E11A 2XQKA 5DNVA 4QDZA 1YS2X 2VTVA 7YASA 4F0JA 3KDAA 2ONCA 3FYUA 5D7BA 1JJBA 3WA7A 3VXKA 5CT9A 2FX5A 2XB6A 4GBGA 1N5MA 1UZAA 3PE6A 2WFZA 5HQ3A 3FLAA 4DMHA 1XRLA 4EBBA 4DYHA 3D59A 5CBKA 1Y7IA 2WHRA 1R1DA 4WDRA 2XT0A 2WTNA 5J3JA 5ALIA 1CUWA 1P0MA 1Y7HA 2PSJA 1QIKA 3U0VA 3IULA 4Q82A 1WPRA 1UWCA 4BCDA 3C5VA 3AZQA 2JIDA 4ZGBA 4KAFA 4I4CA 3C70A 3G8YA 4KACA 1BCSA 3BJMA 4JYPA 3DCNA 2D0DA 3R3YA 2XMCA 1GKKA 1Q0RA 3E0XA 5AOBA 2XMBA 1F6WA 1P0IA 1U2EA 2XQIA 5I9IA 3G0DA 2WFMA 3H0CA 2GZRA 4GECA 3HLKA 3HJUA 1TCAA 3ESBA 2VJCA 2Y6UA 4AZ3A 3AIKA 2W22A 4K2AA 4ARBA 5K3FA 2DFPA 2XDWA 3F8SA 3G0BA 4G5XA 1I6WA 1ZI9A 2CJPA 4ZV9A 1XROA 3OM8A 1VXOA 2Z8XA 3C5WP 4WFJA 3AILA 2IIVA 4HXEB 5FXMA 1TK3A 5AIBA 1THTA 4BYMA 5AK3A 2BCEA 3G9UA 4Y2RA 3K6KA 5T4FA 4BZZA 4KAAA 3M83A 3D7RA 3X3HA 3WWEA 4J0KA 2HU5A 4K6GA 3LP5A 1CUAA 3T52A 2XLBA 2VJAA 5LIPA 2Q0XA 4LHEA 3WK9A 2BKLA 3NGMA 1UKAA 2WFLB 3F98A 2OQIA 2HA3A 2WU3A 4X93A 1GKLA 2WUGA 3C6XA 5JD4A 3WLAA 3V1KA 3WJ1A 1UT6A 5HK8A 1EB9A 3ICWA 4YPVA 4Y2XA 3R3WA 1UK9A 3ESAA 1XQXA 3PUIA 1SC9A 4H7KA 4MJ3A 3QVMA 4DNPA 1BROA 1U8EA 2GBIA 3LIPA 5FRDA 1CUSA 4CG2A 2GYUA 3BXPA 2YH2A 3DKKA 4CCYA 4Q3LA 5BWBA 4X90A 4DSAA 3BL8A 1E5TA 4BDSA 1MPXA 4TVKA 5HF9A 1EX9A 3DOHA 2HHAA 4J7AA 3IURA 4G8CA 5CT8A 5DTIA 1ZJ5A 1AC5A 3B3QA 4ROTA 1ZICA 4KR0A 1KU6A 1TKRA 5IH7A 2HA7A 3H2GA 3WK5A 3G0CA 2HIHA 5JARA 4MQMA 4OSEA 4TPKA 4OD0A 5HKAA 3HI4A 4QLOA 1TCBA 4KE7A 4QA9A 4X94A 3I28A 5IKXA 3BF7A 1XZHA 2WG2A 3STYA 1GPNA 4WCVA 1XZJA 1GT6A 1YASA 2XI4A 4FNMA 1YB6A 3DYVA 2OG1A 5EFZA 5I7UA 3RARA 5BOVA 4C89A 4FLFA 1ZIYA 6YASA 5T4EA 1J07A 3CCCA 5JALA 3WZLA 2XMQA 2QXTA 3D5EA 5K3EA 5EHXA 4H35A 2C0QA 3ICVA 1TQHA 3AIOA 1UOOA 1H22A 3SWWA 3I1IA 1LLFA 1QONA 5ALXA 5CT6A 1WOMA 4Y2TA 3E3AA 3G9TA 3GZJA 3C8DA 4ARAA 3H1AA 2WJ4A 3I2KA 3I2FA 4KE6A 5T4HA 4Y2UA 4UHBA 1O6FA 1XZEA 4ETWA 1CUCA 3D2CA 2XUGA 2YYSA 1R88A 5EGNA 4BE9A 3DOIA 3PFBA 4BP9A 1XLWA 1GQSA 5CT4A 3G0IA 2EDAA 3A6ZA 3AZPA 3GA7A 1BCRA 1BE0A 3HXKA 2ORYA 3O9MA 4H18A 4C87A 1JMYA 4B0OA 1AZWA 2XUHA 4L0CA 3WWCA 4LIPD 3IUMA 3QYJA 4XIIA 2PPLA 1O6GA 1L7AA 1QFSA 4LYDA 4OUKX 3R3VA 1VJ5A 3DJYA 4F21A 5DYWA 1BRTA 4RGYA 1U65A 2WUDA 5JAHA 2BFNA 1BN6A 1F0PA 2WFLA 5CH8A 5E4TA 2QMQA 3R40A 4PW0A 2DR0A 2PBLA 3I2HA 4EZIA 3OC0A 5IVIA 3HZOA 4M0MA 2PKYX 2WIJA 1C7IA 1ZD4A 1UFOA 4E15A 2WLSA 3WK4A 2CZQA 3ZLTA 5AO9A 3WQHA 2HRQA 3AFIA 4C4YA 1R3DA 1W76A 4PF1A 3WWDA 1XZMA 2GBFA 1XKTA 2RHWA 5D3KA 5ALHA 1MN6A 1SOMA 1AX9A 2QUAA 5K3CA 2HA2A 4MEAA 5JZBA 5IVHA 4L72A 4RE6A 3OURA 2IX9A 5D6OA 2HADA 2VT7A 2YXPX 3WJ2A 1X2EA 2XUPA 5ALRA 3WK8A 4AB1A 1R9NA 4B7ZA 2DQZA 5HZGA 3FWHA 3S8YA 2CMFA 4BRZA 1FJ2A 1WB4A 1CUUA 1H2WA 1ACJA 3R3ZA 2QJRA 3ED1A 2XUFA 2C5FA 5AICA 3MUOA 4QEKA 4WY5A 1EINA 1QFMA 2ZJFA 1UK6A 2OPHA 1E8DA 1K8QA 3DL7A 1YCDA 2WQZA 2PX6A 2HFJA 2PU5A 1H2XA 4H77A 5CMLA 4Y2YA 4B84A 5ALYA 3IDAA 1JU3A 4BE4A 5AKHA 2B9VA 4H7HA 5JAOA 3IUQA 4FHZA 3A2LA 4UHDA 2AJDA 4WJLA 4BVLA 1DT5A 4HS9A 4EA6A 3FYUC 1DINA 3DKRA 4GWLA 1TCCA 4PNZA 4FLEA 3WL5A 1ETHA 2VT6A 4M0FA 1ZD5A 3AJAA 1USWA 4JEIA 2DHEA 3PUHA 5CT5A 2I03A 1DWOA 2CB9A 4X00A 4FTWA 3CN9A 4B6GA 1LPPA 3HEAA 1CUDA 1E8MA 3NUZA 4BTLA 1WPXA 2ZSIA 5AM1A 5EI5A 4BAZA 4Y2PA 1XQVA 1XRQA 1EVEA 2OLEA 3BE8A 3I6ZA 4H7JA 1WB6A 4BVKA 4QWMA 3L1HA 1DWPA 4QNNA 3WIBA 3DEAA 1W6RA 2HDWA 5AK6A 1A88A 5LKAA 4N8SA 4GLBA 1BN7A 1TIBA 3VJKA 5HCUA 1MT3A 5A7FA 2VAXA 3R3UA 4AN1A 2JGKA 2XUOA 5C8ZA 2PVSA 1HDEA 5AKKA 4UBJA 4OPMA 5C8XA 4X3CA 2VQ6A 4OB6A 5BWCA 1ZI6A 5JD6A 5LZ5A 4C4XA 1Q83A 5AOCA 1QIHA 1QIEA 2WIFA 3ESCA 1AUOA 1EA5A 3VJLA 2XUKA 2XQGA 5AKZA 2QT9A 3WL6A 3CCBA 4M0EA 1G4HA 2PL5A 3PFCA 2BAGA 4H0CA 1K4YA 3A2MA 1JI3A 2OCKA 1RP1A 3W9UA 1MAHA 3CXUA 1XRNA 1LPOA 4Q05A 3M81A 3I2IA 5ALMA 3EF3A 4QE3A 3QPDA 4Y9SA 2HU8A 2OXEA 1L7RA 4JNCA 1WCYA 3LCRA 4LXHA 1B6GA 4GXNA 4UUQA 3TRDA 3N0TA 4BVJA 1XQWA 1UKCA 1ZIXA 2C58A 1WM1A 4QDOA 4KE9A 4UBNA 2XUJA 3D4LA 2PSFA 3PDCA 5LZ8A 5C8VA 4UPDA 1DQZA 3R41A 3I2JA 4W1SA 4UFOA 5SYNA 4A5SA 3FBWA 5KREA 5LZ2A 4YK7A 2H7CA 5E4YA 3O9VA 2ZYHA 4EB0A 1R9MA 1CUGA 3H04A 3ANSA 5H3HA 1THGA 4U2EA
chains in the Genus database with same CATH superfamily
2P79A 5CDFE 4KBGA 1SBCA 1XRJA 3RKSA 2WF9A 4C7KA 2WI8A 2FXIA 1I5EA 3W9BA 3RVMA 2VPIA 5ADVA 2GI4A 1NNI1 4BNGA 5A9RA 4TZTA 1VA5A 3HDTA 2QVZX 1OBOA 3AVWA 3SICE 2C5SA 5BPHA 1CRLA 2V4ZA 1YJAA 3GFSA 1P0FA 1BD3A 3S2SA 4A36A 2OOKA 5K20A 3ADKA 4QZVA 4YFYA 1J0EA 4MUGA 3V42A 1NDQA 3TAXA 4DR7B 2JHPA 3MM4A 4GYWA 4U63A 2LRHA 2CXSA 4INAA 1EP2B 1RWQA 3BFPA 1FTNA 3OD1A 4PQEA 1RVDA 1N1MA 4MI1A 3EJ6A 1RXSA 4DMFA 3GLIE 2JGMA 2XV1A 5FPPA 3R5JA 3TTYA 4E03A 5AVTA 4C6TB 3BIWA 4HEJA 3GLIA 1JN0A 3IYLW 3II6X 2G0NA 3A6FA 3D6HA 4LZPA 4GZ3A 1RLUA 3YASA 4B8YA 3DVSX 1XR3A 3DMNA 2YXLA 8LDHA 3BWEA 5DYIA 3FTNA 1FFWA 4FFSA 4JJEA 3W04A 4A8PA 1A7KA 3FCEA 1ZA2A 2X58A 1EPUA 3JYHA 2OFFA 1LSJA 4R31A 5K1ZA 2XF2A 2BE9A 1XA4A 4F5DA 1KC3A 4RACA 3UJCA 2YMQA 2IZZA 1REQA 2P9HA 4CNBA 3LS2A 1EIWA 1FYEA 4RS3A 4Y0AA 5GV8A 4MA5A 3FCYA 1PTKA 2JPDA 1VHTA 2J08A 4XOUA 4KXWA 4QGHA 1TEHA 1ZSYA 3R5SA 1U3WA 3LBIA 2IA5A 2QL5A 4OQZA 4TKUB 5DP2A 3FKQA 3TW8A 2VNIA 1JEJA 1XMIA 1IC6A 1W47A 3IJPA 1PFVA 1SU4A 1PGQA 4Q9DA 2FMUA 2D5IA 4IL5A 3QJ5A 1SAYA 4YJGB 2HYIC 3TB6A 1LUAA 1VCNA 3E7PA 2B30A 2D8AA 4L3WA 2OHIA 3RV3A 3G88A 1RQGA 3QUAA 3O03A 4WACA 1Q2XA 3RHTA 1OD6A 1LRJA 4W8GA 1XK6A 1T0PA 1X74A 2PGXA 4FZJA 1E2PA 1ZOPA 4YAIA 1E2DA 2AJCA 4NBNA 5DYTA 4FD3A 1HE5A 4HH1A 3U1TA 4LZOA 2JGAA 3UAZA 5KHLB 4JX8A 4MI6A 4H27A 2FMFA 1Z22A 3F2IA 3Q5GA 2QK4A 5TX7A 1VDMA 3D7SA 1XO1A 3DKIA 2GRUA 1DJOA 4OH7A 1QO7A 3NBAA 1BMTA 1Y4SA 2E9SA 4QU9A 4YJHB 1ZVVA 4KI7A 5ALFA 3ZHBA 1SC6A 1V9SA 2I2FA 3EZ7A 1CJTC 1C1HA 3VPCA 1TAQA 4OP1A 4U4AA 4Y2SA 1P1CA 3WICA 4POOA 1P2UA 3ASZA 5FF9A 1WB9A 4FCCA 1IK6A 3VGPA 1DAPA 2ZIAA 4DL9A 2G06A 4KSYA 1IUNA 2ZJ1A 3A2KA 3V2IA 2VTBA 4QFCA 3L7AA 1YZVA 5JV5A 5BMVB 3I37X 2QM8A 1DIOB 2GYWA 4I6JA 1ZSVA 1DIAA 4HVAA 4ZKDA 4QFMA 5HKKA 13PKA 3PLAE 1ZOOA 2WBLC 4RKYA 4DCMA 1LH0A 3AKEA 5BR8B 4O4LA 4ENWA 5KQPA 1JT2A 4R8MA 3CWQA 2I7XA 4MLZA 3VVLA 1RBYA 2ZOSA 3R23A 1E4YA 3R3SA 3AUYA 5HR5A 5HEKA 4HUTA 1FJXA 3PCTA 3COPA 1VZ2A 4CLHA 2IL1A 1NHGA 4OB7A 3K4PA 1XD2A 4R1OA 3GUZA 2FDRA 4A2CA 1ULUA 2VPPA 3GBVA 4F11A 3EX7C 1FFHA 4AD8A 4V0KA 4HQFA 3AY0A 3VSDA 5L7TA 3RT7A 1AUQA 4PZEA 4TV8A 2NO5A 3K5PA 4LJ6A 5HE8A 2RARA 2ZUSA 3B9QA 4ILKA 3VRHA 1R27A 5EIEA 4CF3A 3SNKA 1Z4IA 5JY6A 4MPRA 2YWFA 4W5JA 5JAPA 3L0PA 1OAAA 1TVEA 3M1YA 2Q8QA 2PLAA 2V7UA 4AWBA 4HWPA 3EAGA 2CT8A 1HL7A 4PXYA 4M0CA 4LGYA 3VPGA 1EZZA 1GWNA 3TSWA 5KYYB 3S8EA 1ELOA 1R6BX 2GETA 3T5CA 1XTIA 3Q3VA 5A62A 3AF5A 2ZI4A 1X1CA 3LKZA 2PAFA 5JE8A 2GEJA 5JDCC 4Q6BA 2WM3A 3GAZA 2QYTA 3NYIA 4IWXA 3BL6A 1N75A 1EFKA 3AUJB 2VAMA 4YAWA 2IT1A 5BRJA 5ALPA 1C7QA 3IMEA 1XJWA 3N7AA 4KVAA 2VYND 4KV7A 4MGYR 4RORA 3MUNA 5A7GA 4KIGA 4NMXB 3IOMA 4OFZA 5ADWA 1ZVJA 3GR6A 3JWEA 1SRQA 5FNVF 1L1QA 3HCEA 5B12A 2XXAB 2V96A 1M6HA 3GXOA 3UCXA 1H5NA 1G8SA 4FUTA 3CF4G 4EYOA 5BQOA 3ZDCA 4R6WA 3WO0A 5I7RA 1OIVA 4MYSA 2EIHA 1K8RA 4KVZA 4CDRA 3C7TA 3GY0A 1PEDA 4NZOA 1DJPA 4D9CA 1ZEJA 1SIBE 3K32A 4EZBA 3UWKA 4AY6A 2JDID 3K8YA 4ZQBA 4BB0A 2KBFA 3RTEA 4DAOA 1U2ZA 1ODIA 2CNBA 3PE4A 2XGJA 1A9OA 3HRKA 4FBMA 4YUWA 5CB6A 2F3PA 3LUBA 1CWUA 4KN6A 5KTSA 1VCMA 5LJLA 1WE2A 4BASA 3EDCA 1UJ6A 3GUCA 1XU7A 1OSNA 5KOJB 1PS9A 1L5NA 2GKSA 2XTJA 2WJ3A 4AW9A 1O95C 1JV2B 3AY3A 5DHQA 5DKFA 4C3VA 3O8CA 3F9IA 1AXRA 1JA0A 4Z0PA 4ZEOA 1K4KA 1ZPDA 1A7AA 3WLTA 4B7XA 1CZRA 4BUZA 2HLDD 1VQ1A 1TYEB 1VG1A 2RHLA 3CVUA 5IRCD 3DR5A 3QE2A 2HMAA 4FM9A 4QYXA 2AJLI 4IXTA 1DO0A 2JEYA 1GNSA 4I50B 2P2GA 2GTHA 1ZR4A 1QNLA 5CFOA 3HXOA 1SJ9A 1ZUIA 1AA6A 3N2ZB 2BTEA 2W6IA 4IHJF 4M1MA 2QPAA 2EKQA 2R6ZA 4CUJA 1NVGA 3SYRA 3ZE7A 2HXYA 1SBNE 3IQHX 3PXEA 4WCFC 4MYCA 1OYVA 2Y2VA 4IDPA 3H5RA 3DWEX 3ZYCA 5KWJA 3LC2O 2AZDA 2QJFA 4PZ9A 4Q48A 1L4FA 2NP6A 1QO9A 3VSEA 1V8OA 2PYDA 4OQYA 4EG0A 2KPOA 1S4QA 4V0LA 1XWFA 4X3OA 3B1ZA 3PQ5A 1KYIA 1JR4A 1L5FA 1RQPA 2D2VA 2Q3HA 2VG8A 3CNQS 3K3PA 5E6UA 9MHTA 1NJFA 1P39A 1QE3A 5E3HA 4AIRA 4LNUA 4YUAA 4YMLA 2WEKA 3OIUA 1IMJA 3RFUA 2M6LA 2W11A 3VYUB 4LRYA 2H0RA 2W4QA 2G09A 3P9KA 1UAGA 5KYUB 2QR5A 3HG7A 3JQFC 2EU8A 5AFSA 5AXBA 4GZLA 4NNPA 1XPJA 1JG7A 1HYHA 1FXSA 2WSSA 3CC8A 4ZTBA 1Z8HA 2EJVA 2GFIA 3E4CA 4W9MC 2OD2A 3QBDA 5TLSA 5JATA 1U8AA 1T34A 4EB6A 1C80A 1W73A 4B4VA 4G4GA 5IJXA 2CE2X 2HF7A 2B78A 2GCEA 1O8CA 4HZUB 5K2OA 2WDPA 3FM9A 3HY6A 3EGDB 2M32A 2QX7A 2XWPA 4JNKA 4MCJA 1MEEA 4CEJA 1DAMA 2WKSA 2FAXA 4IH4A 4DIBA 4X6YA 2EX0A 3HV2A 2IOQA 3NOXA 4X7MA 2EWMA 2HWYA 3FSGD 1STOA 3FDFA 1F12A 4DTCA 1DO2A 3QE4A 4QYIA 4B31A 1ZN2A 3WLHA 4BBJA 1M2OB 2YMLA 2N75A 3FHLA 4PRLA 1GSOA 2BSXA 3M9LA 2L2QA 2WNSA 4U1RA 2OYCA 5ILOA 1JVBA 4IILA 3ZNPA 1Q3KA 4ZO8A 4AJHA 2EP7A 1G17A 5JNUA 1J0BA 3UK1A 4Z4GA 2WYWA 5FJIA 1NVBA 4AP5A 1F1JA 2HXSA 4G41A 4ZRMA 1MOPA 4O2AA 5LDDC 2Y05A 4Z9YA 3WL7A 1U11A 5AI6A 1TLLA 3HABA 3HKBB 1NC1A 4GPEA 1ZRSA 5AM2A 1R5JA 2AMVA 2BHLA 4ERNA 1JR3E 3SHQA 4QDKA 2CXNA 2VF7A 3FLEA 3Q40A 1NQTA 2A5FA 3O1JC 4D9KA 3GRRA 1I4OA 2CNLA 4FN5A 4IDGA 4P82A 4O4IA 4IM7A 5DLDA 3FNGA 4OHFA 3AEXA 2IPAB 1U4NA 2W9XA 2ZSFA 3SX2A 1P9WA 4ENTA 4FGUA 2A5DA 1F38A 1E5VA 5F3RA 5I45A 1Z5PA 2OKCA 1HE2A 4DA8A 4DVGA 3DFZA 2WWXA 4LJ8A 1HR0B 2ZJZA 1U3UA 4NATA 3CSDA 4HRVA 5K3OA 1VE9A 4MUMA 3LE8A 3VPXA 2YMMA 3BMXA 1FUKA 4O4JA 3KB6A 1Q50A 4XVRA 3TTSA 4JT8A 1NM5C 2IYLD 3CN7A 2NV0A 4RF4A 4CZ2A 5C7LO 1R2QA 2I5PO 1X70A 4H0FA 4WBSA 1X7WA 5EQJB 1YE5A 4G1CA 2FR0A 2OBLA 4BUCA 1WVMA 1QVVA 2CKDA 3LX5A 5B58C 4JI8B 1D2EA 4FKBA 1D7AA 1HQDA 3ND8A 4QBHA 1I2MA 1I5RA 3LRTA 4QFBA 2WTMA 5AKEA 2DBZA 3GLHE 1YB1A 5KU7A 1S9HA 3NT4A 3GLHA 1LBIA 3MPUA 2QRGA 2GN0A 3KLMX 3CX8A 3SS8A 2AKEA 3D02A 2XMDA 3CZRA 2WVAA 3UMBA 2IU6A 2E5WA 1P8JA 3WJAA 4A1FA 1U28A 2F8MA 3EGWA 4WZAE 4NE9A 2CW5A 2FSSA 1IH8A 3DDSA 4CKYA 2RKBA 1DU4A 1RHQA 2ZE7A 1C7RA 3V6MA 1OXKB 3N39C 4BKUA 4H9GA 2IVZA 4AZ3B 3FDZA 1JIIA 5JZVA 4DIMA 3P0EA 3FCSB 5CFMA 5G0WA 3DW1X 1MUUA 2PZFA 1GLVA 3KKZA 2B37A 4MW6A 2AMYA 1IG3A 3NGLA 2GPSA 1RXUA 3ORHA 3REQA 3RVJA 1XRRA 4HUQA 3HN2A 3S55A 1E6EA 5LQSA 1B14A 2LTAA 3ONEA 2P69A 2AG8A 4G5RA 4DN6A 3D3WA 3O6VA 1XBTA 4JOQA 3Q6MA 3B5IA 2ZRFA 3DL4A 3QUQA 3UJ6A 2EWWA 5IK2A 1XVVA 1XLVA 2HWXA 4CM5A 3H9GA 3GLFB 4OI1A 4REMA 1K75A 3TF5A 5DT9A 3HACA 5D84A 3VC1A 2D5CA 1P5JA 1EK6A 2HKIA 1RXYA 2PUJA 1UBOS 4YC7A 3F6SA 3NHUA 1TF2A 4ARIA 3EULA 1HPLA 1ZUHA 3ROZA 2JGIA 3H5VA 3HKDA 3H83A 4ALKA 5BUQA 4AU1A 5CVJA 4ZIRB 4B4UA 3DE5X 3I5AA 1E9EA 4DWWA 4NS4A 2EARA 4YCNA 2GD0A 4X8MA 2H2WA 9LDBA 3AH8A 2WJZB 3KFXA 5GJCA 2VT3A 4B85A 2ZBQA 4IOLA 4OFBA 1PR0A 5DSZA 4YB8A 5H81A 3DLTA 3BXHA 4IIDA 1A2OA 3ELYA 5LQRA 1OVGA 2PTGA 3HRHA 5TQJA 5JZ9A 2AZ4A 3QVGA 4MICA 5A5VA 1CQJB 3SF8B 2POCA 4Z3DA 1VG0B 4KFRA 3KZMA 1EJ0A 3AR3A 3L93A 1JIJA 2PXAA 3KOYA 4NFLA 4KE8A 1NF3A 2R11A 3L79A 5I8PA 4CFSA 4V2IA 3T38A 1E7RA 4BRWA 3AQ4A 3NHRA 2IHNA 3A2NA 2ORED 3WP1B 2BEKA 4BVEA 2D4AA 1VBMA 3R09A 3BRCA 2EC5A 2R84A 3HPRA 4ZDWA 2XYRA 2ZRKA 1FDVA 2I1VB 3P9SA 4ZPJA 4RENA 3A0RB 4YRBA 9LDTA 1CW2B 5FLXA 3UMVA 1XNRB 2NVUA 4L2IA 2O50A 2QYSA 2AVDA 1AUVA 4GFDA 5LP6A 3MRXA 3ITNA 2B83A 3OOWA 4KOAA 1QYRA 3Q7IA 4ZT4A 4CM3A 1CHDA 2IEAA 2DQKA 4J0EA 1G66A 1V39A 5CLIA 3UY4A 3WZMA 1OFGA 3K1YA 3O38A 4L5CA 2DY1A 4Q9KA 5A4FS 4AKSA 4Z86A 3TLEA 1F3LA 4J1NA 1PS0A 4OO3A 1KIAA 3TVDA 4IJ6A 1U8UA 2P2SA 2PCLA 4U39A 3ZNOA 1T9GS 3Q4GA 3ZWOA 4UM8B 4A82A 4B4DA 4UOEA 4LHWA 4ZCPA 3U19A 3EBLA 4YJ3B 4JUAA 2WA1A 4S1WA 4QAQA 1WBDA 4ZI3A 4XQ9A 1ZHFA 3A27A 2I9PA 3JZIA 5F7JA 1Q7EA 1TJYA 3B2EA 1P1IA 2FG5A 3C3JA 3ITDA 7MDHA 2V58A 2PWBA 4KMOA 4DSZA 1XNQB 2K2QB 3W8DA 4RZIA 1VMKA 2A5JA 1FFCA 4JJ7A 4J0HA 3OD5A 2AN4A 4FWIB 4QLAA 4B0PA 5A2GA 3OZVA 4EW1A 1TVKA 2IX3A 3GRYA 5J1TB 1NXSA 4K03A 2UUAB 3KCQA 2ALJA 2XXJA 1JSCA 5LWHA 1XEAA 3ENKA 3RS7A 4LWZA 4EPRA 4D8TA 3HU2A 2C94A 4PX5A 2E49A 1M7HA 3R7NA 5IYZA 3E3LA 1ZNZA 5JRJA 3KKEA 3CLRC 3GJ4A 4EQ6B 2WQ7A 1OAOC 2VI5A 2ID8A 2QQFA 4ZXFA 3UFBA 4DBLC 1DI0A 1A8QA 3MSXA 2QAGA 1MO5A 3GFOA 4CTKA 1MC8A 2Y8EA 4XVQA 1XTJA 1GCIA 4WFKA 5CCEA 2VDPB 4RY0A 2J7PD 1YAJA 5CYGA 3K16A 1Q1BA 3R9KA 5I5GA 4UTRA 5H80A 2BY4A 3THWB 2O7RA 3D4PA 1PT9A 4Z9FA 3EZFA 2FW0A 1AOXA 3CEJA 3FX2A 3GUVA 4RF3A 5DBFA 2PS0A 4J1SA 2VSQA 2JFBA 3RH0A 3STTA 1L1RA 2UVPA 3EXHB 2C7GA 4ZAXA 1U7UA 3NIBA 5F1KA 5K99A 1WDMA 2XODA 3VKHA 2VBCA 2EHJA 2UZ0A 1VIAA 5THKA 4OXNA 2O8FA 4I55F 4YRJA 1E5LA 4IQ4A 3L6DA 5IHXA 3GUYA 3LX4A 4RKWA 2QMOA 5EZYB 1Y9EA 1QP7A 2VKQA 1B76A 2AK3A 2WOOA 2NT4A 4FCVA 1BDMA 1ZD9A 2KB0A 4ITVA 4LA4A 5DHPA 4KP7A 2LCIA 2YHIB 1PV4A 2COUA 2G80A 1DVRA 2WZDA 4N6GA 4ZI7A 5A5DA 4XB1A 3RS3A 4G09A 3CO5A 1EHYA 4QM7A 1HUQA 1PL0A 2GLTA 1JW9B 1UL1X 4PCAA 5KNDD 1U7WA 2ZJ4A 3CSSA 1QK3A 4UMFA 5AVXA 3INYA 4F6LA 2AI2A 2C2MA 3HRIA 2LWIA 3LGXA 1Y33E 1I33A 2G5PA 3MCZA 3NP9A 4YA6A 1YQUA 1MAUA 3JZAA 4DGQA 3WAGA 2D74A 4C0HA 1VGVA 4OYYA 1FU4A 3UJBA 4YV2A 5JAQA 2R4TA 4R2JA 3V9AA 4I46A 1C30B 2QW1A 1L5LA 5KJ6A 2BM0A 2NZWA 4POAA 5CITA 1QR2A 2HLHA 3DTYA 1E9RA 3JYQA 3PZBA 4L6IA 4Y7DA 3T0GA 4EHIA 1R4AA 3BJZA 1DFHA 3H13A 2OC4A 3O1HB 1PD1A 4HRYA 4KKXB 2ZSHA 1B8NA 4DQKA 1UJ2A 3QUTA 3S40A 3UJ9A 1EDBA 2O06A 2ZUEA 1JDVA 3U3ZA 4NZZA 2XZOA 2W4IA 1UR5A 2CNWA 1PW7A 1UBRS 2I4NA 2WE8A 1CX9B 1IE3A 3R5XA 4JP1A 4EW6A 5GIOE 4FYJA 2GPTA 2IHKA 2OAEA 3H19A 5H16A 1PDWA 3EK2A 1GCOA 3JVVA 2R87A 5HGJA 2X40A 2OZVA 5A4JA 2V55B 1I3OA 2PRZA 2ROQA 1KEEA 3GN1A 4IGKA 4JX9A 4NNJA 4E3ZA 1P7WA 2PFGA 3HZRA 4YCMA 1P1BA 5KVQA 1MO3A 4HZGA 3UBTA 1E20A 2NZYA 4F3CA 3PHCA 5BSVA 1N32B 4RWZA 3VR4H 4D9HA 5IKMA 4DNOA 1T0IA 1JMVA 3ESDA 4JEMA 3RVPA 1O0CA 2IH2A 4RD6A 3ZJVA 3SOPA 1Z6TA 2XKAA 4DNFA 3MMSA 3UMCA 4GBED 4MW0A 1CLEA 1WY5A 2BJVA 4XDYA 4MUEA 5CD1A 2OCLA 5KJEA 1PJAA 5EE9A 3F96A 3LECA 4RHTA 1AMOA 1JDBC 3NJ4A 2JBHA 2P4QA 1MP0A 4JI4B 3DVAA 5A4AA 1ZRMA 2PMFA 1CFJA 2DSNA 3A6HA 5AHXA 4ZYZA 3W6OA 5EJ7A 2CF6A 3COYA 2VZEA 1P31A 3G02A 1CV2A 4KHZA 5EQTA 2VXOA 3CNLA 3PC8C 4IDAA 3DWFA 1S2OA 3OM1A 2ZKIA 3OI7A 2BTQA 4G2TA 3NHWA 2V8BA 4Q3OA 2D2EA 2H6EA 2WIAA 5AHOA 1L5RA 4HGNA 2PANA 4H6VA 2J5RA 4HPXB 4TV9A 2FMIA 2A9JA 5EKDA 1Q92A 1CR6A 4G8JA 3WYCA 3K6SA 2H4HA 3CF2A 1G2QA 4J9VA 3DOFA 2WPNA 2CDCA 4GVXA 2JCGA 4NQRA 4YV0A 3OQMA 5A05A 5JHGB 4OQEA 4UM7A 3H5IA 2P78A 5FWDA 4YJ2B 1PYDA 5FO0A 3NUQA 3FYDA 5ALSA 5GQSA 2GFQA 4E2WA 4ER7A 3B1XA 4WN9A 5B57C 2GM9A 1Q1EA 1NMEA 3E05A 5E3IA 1UPUA 2O8BB 1EXWA 2CL6X 2P68A 1ZWKA 1SHUX 1Q74A 3AINA 1QGED 3AWIA 3M5DA 3FOEC 1UKBA 3TTXA 3KUCA 4IUCS 3BICA 5JWHA 4AJOA 4D02A 1Z5OA 4S05A 5DN6A 3DEZA 4E4YA 3NTRA 1OIWA 2R47A 4URVR 1HNXB 2YYZA 5EJMA 1B7GO 5K45A 3KHSA 2C1EA 4FDMA 4D9IA 2F64A 4KNYA 4L9WA 4E07A 1WKVA 1J7KA 1T0HB 2AYZA 1UUFA 2YJ5A 1J8FA 4IR7A 3CWZA 1SZJG 4CLRA 3VI4B 4CG0A 1QQ5A 3DOUA 1ESEA 3M33A 3FCOA 1N2ZA 1XTKA 2G28A 4XX1A 1MX3A 3OCCA 4OOEA 4YTEA 2FSIA 4EVSA 2OUIA 2J9XB 3IIIA 2J4DA 4JVOA 2AE1A 3TN7A 2B6HA 3X1YA 1KGSA 3C5HA 3EOAI 1A0OA 5A3VA 2ODEA 4Z4FA 1JI0A 1HG0A 4RF2A 4AJ9A 2C7VA 2V7WA 1W52X 2YL2A 1F7VA 2OCPA 2NOAA 2IPOA 3GLRA 3EGXB 1I32A 3OZSA 3WKAA 2XKJE 1MNQA 1Z7GA 3AERB 3RGGA 2GCNA 4BQNA 5BV7A 4ME6A 3L84A 3ZVMA 4ZRNA 3ANNA 1XNHA 2PUDA 1JKXA 1V2GA 2YS6A 4G9BA 3UT6A 3TDNA 1Z5ZA 2WTBA 4PLGA 4BBZA 3I0NA 3QXSA 3OZWA 3JYPA 3NOVA 4KFTA 4F3NA 2BWJA 2X8JA 3IT1A 3LPMA 3WDLA 4MVJF 3SS7X 2H1IA 2WKWA 2XEDA 3U3DA 1P4HA 1XCBA 3FNBA 1I01A 3C6KA 4IMIB 4B6OA 5DNWA 4CIWA 3OBIA 2P2ZA 4WESA 4DR4B 4JJZA 4KRFA 1A1VA 2VRBA 3ANYB 4Q7EA 4FS8A 4R1NA 1J9ZA 2V3VA 3LLMA 3ZJUA 2A9KA 2LBPA 4EHLA 3VYSB 2REQA 2WUWE 2BJWA 6NULA 3OE7A 2HQ1A 2FJPA 4NBRA 3FFWA 1XDUA 2B34A 4DE5A 1OXMA 4EX7A 4CLOA 1E64A 1SRRA 5TV2A 4DXAA 2X15A 1WCXA 4HX9A 3KT8A 4A8JC 3CPJB 3ZR4B 5DNEA 1HDRA 1OXTA 2ZS7A 3FPAA 3IKLA 3KFVA 4PWZA 2V65A 3TM4A 2FKNA 1PBTA 4YCAA 5EXEA 5JSYA 3FYSA 4H7FA 5DRYA 1VI6A 4H1UA 4G86A 4RIEA 1VSBA 5I8ZA 3IQDB 2GBCA 2WWTA 3FMFA 3O4IA 1VPDA 3MNFA 1RAHA 2WP0A 3HFJA 3U6BA 5DWQA 3KAJA 3NCTA 2XWSA 3QUSA 1XXHE 2IKSA 2W6CX 3OCYA 8GPBA 1XXHA 3UMRA 1JLKA 3E2PA 4II2A 1GQQA 3P52A 4IJQA 4RAQA 5ELMA 5LOVF 1HZZC 4GQBA 2BR3A 3P4XA 3GC6A 1HETA 3LW8A 3ZH9B 3TNFA 2WT9A 1NUUA 3W2GA 4BV2A 5KWVA 4HXGA 2JFFA 5DISB 3C3EA 4FYVA 1W5FA 5FV4A 5CH3A 3PI6A 3QY0A 3VDRA 3KLOA 3ZHTA 1NQ5A 1EWQA 1NVVR 1ECGA 1DC7A 1NV8A 5H7XA 1YRAA 1QHHB 2QDXA 1YOVB 2BFOA 2ZBUA 1Y89A 3KKNA 3PSHA 4MLDA 4MVJI 4BWGA 2EW1A 2ZIXB 3E61A 2G9VA 3G9ZA 2PT6A 2GF0A 2ZRDA 3HCDA 2DG2A 4M1OA 1MBZA 4UD6A 5B1YA 2HPVA 2ZBRA 5AVWA 3R0QA 4JBGA 4L76A 3ABOB 2IQ5A 5EE1A 4BNVA 4MS1B 3FIUA 2F3UA 1P0QA 4OSPA 3ZUGA 4GXRA 2VWGA 4UARA 3CUWA 4ZDIA 2PNFA 2ZE8A 1G6KA 1QCDA 3JPYA 2PR2A 1DKUA 4BFYA 4EY7A 4W1PA 1JVNA 2Q1XA 2XB8A 1KDZA 3W1WA 2K4MA 2VYVA 4KPUB 1U1DA 4JYBA 4B80A 2YIVX 4M8LA 4GL2A 3AU9A 1K1EA 2CKMA 5I9LA 3AFGA 1FNNA 1KO5A 4J6FA 3RWMB 4ALIA 4MV4A 2V0GA 5F9HA 1QU2A 5AKJA 4WFIA 2WJGA 2YMPA 4RZ3A 1HT3A 1XEXB 1Q7BA 2IBMA 2NUTA 3W05A 5IFKA 1MIOA 4HEA1 4LSZA 3ZCTA 3EDOA 4QXMA 5LNK6 4GS5A 4XEUA 3T06B 3UCFA 2PUFA 2GVNA 5EKXA 5A4IS 3QTTA 2XMZA 4RDCA 5BMVF 4YAOA 3ZHVA 3O8DA 1PFWA 4LF5B 5EIBD 2Z4RA 2IOYA 3TKYA 3WMFA 3HUEA 4MVJG 3VO9A 4YRNA 2ZUUA 4HD8A 5LZ4A 3QELA 3J81k 2EV9A 1MU0A 2PX2A 2Q9AA 3DZDA 3AP3A 3MN1A 2PXXA 3GGSA 1ZCFA 1NZJA 4JFAA 4JZYA 3Q3CA 3HHPA 1EAYA 2CEAA 3DD1A 4QT0A 1GNPA 2OGZA 3WLRA 1FP1D 4RVCA 2O1EA 5AM5A 4HAOA 4ALJA 2O59A 3UMFA 1AV7A 4F5WA 1F0KA 1GU0A 2I2CA 2WG1A 4KODA 1VI5A 3K9FC 1DLIA 4LI3X 4CU5A 4EPYA 2ZYIA 4JH0A 2QT1A 3ZI7A 5M5BA 2ORIA 4LCBA 2E3JA 3VYVA 1LRLA 4Q1AA 4YLYA 5K9ZA 2P11A 4I4LA 4IO1A 1IJBA 5E6RA 3KLNA 2ESRA 5JW6A 1OFTA 1G5IA 5I7OA 3LCMA 1QV6A 3H18A 2QN3A 4HRXA 5AH0A 5E1OA 5COQA 3LC0A 1TF5A 4IFTA 1GZSA 4GMDA 2OFWA 4F8JA 5A6SA 1H23A 3B7GA 3GEDA 4EAAA 2QNIA 1KOLA 3HCWA 4NXNB 3O8QB 5C52B 1IM2A 5AKGA 5FBLB 3SOZA 2JJ8A 5ALUA 3UAGA 3NIDB 4HDNB 2FPPB 3E4DA 4BGUA 5C5EA 5CLJA 1E3WA 2Y67A 3OESA 2QS9A 4W6QA 4HNQA 2H0QA 1Q1QA 1U1IA 3LXRA 1FXUA 4CN9A 1DXHA 5AMXA 4JI2B 3R3XA 1TQ6A 2QKYA 1GTZA 3Q72A 3T7EA 4UBLA 1EDOA 2YICA 3LO5A 5JJKA 1KYVA 3ISVA 2JIOA 1DX4A 2V6BA 1OT5A 2PS1A 4K40A 4LN1A 1TC2A 1M76A 5CX4A 4WBNB 5KQLA 4X1OA 3LCVB 4MEJA 1BEEA 1PL7A 4M99A 1AHHA 1KQ3A 3K0FB 4P1ZA 3B85A 5JZSA 5HQTA 3NBKA 1QHIA 2YV2A 1K98A 2AT1A 2A9OA 3FDIA 4LAFA 3EXAA 2AA3A 2IHJA 3MYRA 5TARA 2VP4A 5JBQA 4XGNA 3R0XA 1KI2A 1XEWY 4ZOLA 3F8TA 3N2KA 3NDRA 1JJVA 3IEUA 4G8DA 4OAPA 2BBOA 1CY8A 4AS3A 3IUYA 1U8XX 5DM0A 1TPZA 1IJEA 1N7HA 1L8LA 5JVDB 3NNSA 4FNOA 3UAXA 2WPDA 4GMKA 1KSFX 4O5AA 1XZAA 3IKTA 4QUHA 3TJRA 1N0IA 3LDAA 1WA5A 2CD7A 3K9WA 4I7EA 4LS3A 5B6JA 5C7YA 5BW8A 4M37A 1Y1LA 1OLSA 2HPAA 2O2IA 3ZY4A 4JGIA 1T3TA 2GX6A 3OM9A 3FFBA 2GCOB 5P8WA 2DTXA 1CE8A 1U3DA 2LXNA 2RC6A 4HFMA 4H15A 2MCFA 3Q7PA 3I9NA 4YI3A 1N5DA 5EHQA 1NBIA 2CBGA 2QUKA 4CCWA 1GKUB 5KTYA 2G9QA 3P1JA 3TNYA 3QV2A 5ALKA 2IYEA 3O82A 4RA9B 5AVZA 2BZ1A 3GCDA 1TO2E 1IQUA 2QZSA 3ANXA 1JVSA 3IUNA 3EA5A 1CZLA 3MJ4A 4TQGA 1MIHA 3B9PA 3OPYB 5E2IA 2H1HA 3BDIA 4I50F 5G1NA 5FULA 4MQUA 4NU0A 1ODTC 4PO9A 1B93A 2PH7A 3ENWA 1XA3A 1GR0A 3RIEA 4LBVA 2EQBA 5JISA 3H2KA 1S2IA 3PU6A 1GA6A 4EF5A 2H9YA 2J9ZB 3E7FA 5DI3A 1Q7GA 4G37A 4Q4DA 2QTZA 4J75A 3IODA 2F17A 4E5KA 4Q3DA 2XHEA 5DYYA 2ZYWX 1V41E 1HLPA 2LPMA 3V1LA 4W5QA 2J0QA 1U0FA 3M6UA 4DR5B 4MR7B 1N2HA 4M0PA 1N2CB 3UQYS 3DPSA 3WB2A 4FEYA 3GPIA 1G98A 3SXUB 1BVHA 4IIXA 1PHRA 1UMCB 1II0A 2OO5A 1XZDA 3ODGA 3V48A 2JBAA 4XI9A 3IVMA 3TEJA 5F9FA 2JD2A 1UPCA 5ITZA 1BDJA 5AM3A 3NFYA 4AZ0A 2JAXA 2M6RA 3MFQA 3Q88A 3GJRA 3ORSA 4XW2A 1Y6FA 2F2TA 2RHCA 1HFWA 3IJRA 4AG6A 1E2MA 4B09A 5LP1A 5ERXA 1MA3A 1Z7BA 3DQZA 4FOSA 3K20A 2B20A 4PPGA 1N6LA 2XA9A 5I3ZA 2Z1NA 2XNDD 3E9ZA 3H5NA 2PZLA 4U9UA 3A4IA 1BE6A 1J8DA 1E99A 2WSMA 4V1CB 2SKEA 2FG6C 2HRCA 1EFPA 2ODNA 1LZKA 1QZ3A 5JJIA 2P2DA 5DIZA 4FKMA 4R8LA 4PYQA 3R7AA 1AURA 2P0EA 4GIBA 3WMXA 4DLLA 4H60A 1F4VA 3DBVO 1KOJA 1N57A 2M1ZA 4TLCA 4ZODA 3KPVA 3QKIA 2H1VA 5C8YB 3BHIA 3IS3A 4N12A 3EIXA 4HDRA 3ZG6A 1KDRA 2VJYA 2VRCA 1VE6A 3OEHA 2FMHA 1H0SA 1FY2A 2HWWA 5EE0A 4HDMB 2FP4B 4RQUA 1VHJA 5HJ7A 1FW8A 2JIZA 1XHLA 3M3HA 2B36A 3M7IA 3AMVA 4BNZA 1SZDA 4WXPA 5KQSA 2PL3A 2BEWA 3AF6A 5LYJA 1JB1A 1DQSA 4OXRA 1IHUA 3SE0A 1DV1A 3B89A 3TGPA 3MFYA 4G0UA 1G8GA 2A5LA 3ZZ0A 4LRQA 3JQFA 1MV5A 4FCWA 3V8BA 3EZYA 5K3FB 1NSFA 2I6TA 4ZQHA 4A5OA 1E4OA 2B8WA 5FNVA 2B4TO 3VVCA 5F78A 1KWGA 2A58A 1C4XA 3NOOA 3AHGA 1T0JB 1QLJA 2ONJA 5L6LB 1DBQA 3D8SA 3P2IA 4MMXB 3D2AA 4TGLA 2SCUA 5YASA 4XWKA 2HMUA 3L7DA 4MIKA 1SD1A 2OOSA 2D6FA 2I4TA 3THSA 4CMCA 1UAAA 2Q2VA 1GZ4A 3DHWC 3D1JA 1HNZB 3EWSA 1NTOA 3FXAA 1L8XA 3DQQA 3I0ZA 5GZ3A 1ZCZA 2NYUA 1XNJA 3D6JA 3QWFA 3ZE0B 4FPXA 5IHPA 3NWOA 4P0QB 1W0JD 1VBNA 4DMLA 4QUEA 4Z8YA 5K0JA 2WW8A 5EIOA 4D3DA 3OWOA 3JD4A 4NCIA 1CY7A 2O2EA 4PIPA 2BGLA 1YOBA 1UT8A 2EEZA 2QSJA 2E89A 4DG8A 1SD5A 4LISA 1Q15A 1GCUA 3EW9A 1II9A 2X5XA 1QH1A 2YHBA 2A9RA 3IHWA 1JDTA 4JGGA 1X1TA 4YMWA 1F0YA 2WJ6A 4JVNA 1G16A 5GM1A 5AJWA 1I1HA 4NEGA 5DVZA 2ET6A 1NBOA 1ZUWA 4A26A 3BE4A 4HGRA 2CXOA 3EVZA 3T9BA 4E6EA 5CAEA 3I32A 1TECE 3C3WA 4K3VA 1RRCA 2WMDA 4AMUA 1K89A 4JP5A 1UPXA 3FSJX 2NAFA 4G01B 4NZYA 1PQYA 1J1IA 1NVFA 1U6KA 2PM8A 1KR2A 3OX1A 1KI9A 2M2IA 4P9NA 5BSMA 3ROPA 1CDEA 1ADYA 1KAGA 2I2WA 3LLSA 4CNQA 2Q5IA 1G59A 4IHJA 2I65A 3LY9A 3AVQA 5FL7A 4PONA 2ODPA 3ZQJA 1DAIA 2BE7A 2DYKA 4ZK2A 4R81A 3LBFA 5INTA 3BFXA 4E5MA 1ZBDA 3EUAA 2PKQP 1IUKA 3TL3A 2V7GA 2VK1A 3GJTA 3LBAA 1N6NA 4ENVA 3QWBA 3G13A 1Y3DE 3KZNA 3ANTA 2WJWA 3A6EA 1P33A 2BGMA 1C3JA 3N8GA 3T5MA 4ND1A 2PUHA 4HX2A 2O7VA 2G72A 1CPYA 3ZZUA 3MYYA 5DH9A 2X7XA 3HKEB 4P08A 5KC9A 4U8GA 2D3WA 3LOQA 3MHPA 4B6EA 1A76A 3UG6A 3GA5A 5ANRB 5LU8A 4TL6A 4I3HA 2EFDB 3VDQA 2XTAA 4WZBE 3WL8A 2X76A 2Q3EA 3HYCA 4HGYA 4WZBA 5FT9A 3USZA 5AVQA 2HJRA 3KUKA 2HRDA 5EYPB 2WG0A 2C7PA 2P4SA 4U9HS 3PT5A 2FQQA 3WWPA 5AUPB 2J67A 2Z5VA 1QOZA 4PLVA 3KXPA 3QFHA 1QHNA 1NIPA 1SMKA 2AWNA 1ZM9A 2XDYA 4IX9A 2AIRA 1YFKA 5GGYA 1GFIA 1AD2A 3IKJA 2QG4A 3UUEA 2X41A 3T3IA 3I9JA 3IILA 4JXJA 1SHTX 4EEXA 1RLIA 2YQZA 1SHZA 3CU5A 2W0SA 4BO5A 2VFAA 3ZV7A 5KYWB 2DTDA 3DULA 1P2FA 2VDMB 2NTVA 1WDKA 1PSZA 1YRBA 2FW6A 1HYGA 1KAMA 3G9XA 1N0WA 1XEWX 1ODSA 1YT5A 2XVZA 3SK0A 2SBTA 2WJYA 1Z4JA 1T4GA 1G6OA 2YXBA 3LLUA 1RYBA 3QV1A 2HBQA 2IUEA 2A7QA 4V2UA 2B8JA 3ILSA 4GPZA 3RIMA 1V16A 3V8EA 1Y9ZA 3GYBA 3RREA 1MXHA 4JJ6A 5IF3A 2O8EB 5AVVA 4DJEC 3THYA 4WAUA 2G76A 1WPQA 4EF6A 2XQKA 2ZRBA 3FWPA 4OF4A 3HBAA 1Y8QA 4QDZA 4AUNA 1K9SA 2JLAA 2VTEA 1YUMA 1CU1A 4XEHA 4ISCA 3RRXA 4V0QA 2QPLA 1TYBE 5J4LA 2ORWA 2OYRA 2IOHA 4XFJA 1T35A 3EN0A 2G9ZA 2UKDA 3INTA 3L7LA 2P3SA 4GD3Q 1T3HA 4AKEA 1YR6A 3CKLA 3RVNA 1JKFA 2LUOA 4PPNA 4EMSA 1RWXA 4INJA 1EVYA 1G3UA 3BXEA 4K26A 1NUSA 4E5YA 3GT7A 3VR6D 1E1CA 4I9UA 2X5KO 2O0JA 3JQBC 1JDPA 1QG2A 4ZVLA 2VQFB 1U9CA 2FX5A 1FFYA 2IYZA 2GJ9A 2CHGA 3MA0A 1O87A 2YNMD 4F4JA 3PE6A 4WK6A 2FW9A 2PMCA 3AF2A 2WFZA 4GI3A 5TPZD 1MGOA 3U4AA 5FUQA 1J0XO 3BIFA 5J2TA 3LFHA 1QP4A 1VCOA 1ZEMA 2O3JA 3IHKA 4GUDA 4OIMA 3EG9B 3T5TA 4NG5A 1UXKA 5FI1B 3V8NA 3A4YA 3SSMA 4ESOA 1U0NA 4EBBA 4DYHA 1JG3A 5CVCA 3VH4A 3D59A 4PPQA 4YAGA 5EZ6B 4C3OB 2OZLB 4BNKA 5CEFA 1IWOA 2WHRA 1R1DA 4GU5A 2QNRA 2XT0A 2FP3A 2YC2C 3DKVA 3O26A 5H83A 2WTNA 4ITUA 4K9QA 1QWOA 1RS0A 3DCJA 3OLCX 5G0TA 2PSJA 3GLSA 3QU2A 3U0VA 4NECA 4L6AA 1Z0ZA 1LJUA 1NY6A 4DXHA 4CMGA 2JLWA 3OKCA 1P4RA 2CVQA 1U0RA 2H5EA 4YCLA 2DECA 1E2HA 2ZJAA 2PX4A 2QQ5A 3AZQA 4MWEA 4LEIA 4DFDA 4F7DA 3C70A 1TKBA 1OFUA 4QGGA 1E3DA 4GMHA 5L3SA 3AF0A 3PR1A 3GV0A 3GEEA 2GRJA 1E9BA 1AIPA 2FPRA 3QYPA 3TQIA 4JYPA 3HFRA 2P3QA 2D0DA 2J1LA 1D1TA 2G83A 2XMCA 1Y3HA 2I7CA 1OJLA 2JJMA 4BNYA 5L40A 5TVKA 1YL7A 4C03A 3E0XA 5DNDA 2W70A 5AOBA 4EVQA 5KPJA 5KAMA 5KINB 1P3DA 3SEAA 1F6WA 1WJGA 2X0NA 1A2BA 3TD2A 2WSYB 1NVAA 1U2EA 4J16A 5JC1A 2RH4A 4H6WA 5EZYF 3B78A 3RWOA 5DTRA 5I9IA 3MJFA 3G0DA 2VXCA 1L5ZA 1N5KA 1F5NA 2VP3A 3N2GB 1RHUA 2J9GA 2UXBB 3DPUA 2GZRA 2IHUA 3L43A 4KZKA 1HL3A 2I6QA 1U98A 3HJUA 1KH1A 5TSDA 2F59A 4OFXA 2RGRA 3EEQA 1UMDB 2VJCA 3KQQA 3QIAA 1KO1A 4J0QA 3UUGA 1E77A 2ZRNA 1KBOA 4JA0A 5DBGA 2G4CA 2Z1DA 5KDLA 3VSBA 1G19A 1YC2A 2A3RA 2R25B 4TWZA 4GRDA 4K88A 4KDRA 4XTCS 3VZPA 4DY4A 2PRKA 1ZD8A 3ADOA 3RTAA 4TVSA 5IF9A 1PN3A 1TUEA 4NCBA 3Q3GE 4TYYA 5FWYB 3QX9A 1I6WA 1PQWA 2XSZD 2PZAA 3DMFA 1ARZA 1BOOA 2CJPA 3GPDG 4GNRA 4F9GA 4ZV9A 1SOVA 1YE3A 1YQWA 3NI2A 4FKZA 3PQFA 3L7MA 4UE2A 4X63A 4B3CA 5BN3B 1VXOA 4K9MA 2FVYA 3ZCQA 3C5WP 5CXSA 2HSGA 2VCHA 1PG0A 2IIVA 3K5WA 1J6UA 2BMDA 1ECJA 4R84A 3RYIA 2EYUA 2FWRA 5TGZA 1I7LA 1CKEA 3CZ4A 3QF4A 5KTTA 4R2LA 1DXOA 4DTIA 1Z5NA 4G5YA 4M1EA 4MUKA 2FZGA 3MWDA 4ZO9A 1NYQA 4HO1X 1PFGA 2BFEB 4HDAA 2G1AA 3L8MA 4ZCSA 1DKQA 4HN4B 4BNHA 5HUHA 1XTPA 1LK0A 3MEQA 1GRNA 2J33A 4HNSA 3BYZA 3RSZA 1KI6A 2YYAA 3GEGA 1DCMA 4N6OA 3UTCA 5D3MB 4RTOA 1TIKA 4TXMA 3Q6NA 2OB2A 2R8EA 1DBIA 2HQOA 1JHQA 2CFIA 2E21A 3C1OA 1G64A 2UYGA 2J6HA 4YMSA 2ZM6B 2WF7A 5JFGA 1OLUA 3E3MA 3IAAA 2EW2A 2XLBA 4LRTB 5B37A 2NAPA 3ICEA 1ZCAA 2VJAA 4FFNA 1U0LA 2D1YA 5BN1A 2Q0XA 3EC2A 3RRMA 3WK9A 2BKLA 3S1AA 2NZ8A 3CRRA 2HC9A 3BXZA 4PHHA 4TVOA 2ZI7A 1CZHA 4QYWA 2I7VA 3EGOA 4F2HA 1BHJA 2AKYA 5IC5A 1BEUB 3RT9A 2KQUA 2HIAA 2CVPA 3WTCA 5KSWB 2HA3A 2PD6A 5IAEA 2WU3A 3X1WA 4ICIA 2V1XA 3ODPA 4CMKA 4LY3A 1AN0A 1O54A 1U2GC 2F62A 1TZBA 4TTJA 4KPFC 3ZTTA 2Z2YA 2X1HA 3LBYA 3N86A 3V33A 1E9AA 1T9AA 1QFZA 5TQ2B 5L9AA 4EB8A 3RLFA 1IXRC 4TWRA 2WU0A 4IIJB 5D86A 3TNLA 3T6KA 5KCMA 3W8NA 4C0KA 3BRQA 5IJWA 1QAMA 2XAUA 3PYMA 3VH2A 3UMMA 4OHBA 1M6NA 3P97A 4ZXPA 3H7AA 1UK9A 3QHQA 1E60A 3ESAA 3W3AA 1X3LA 4ZYWA 3ESYA 1SC9A 1Y5LA 1PV2A 2FRDC 3EZGA 3MWFA 2BP7B 4MJ3A 2IYAA 3JQQA 3T3MB 2ZPAA 3QXXA 1TDJA 3LCCA 1UJ4A 3RJMA 2II6A 4JQZA 3V55A 4TMFA 1IHPA 3HDVA 3KUXA 5IG2A 1LU9A 4M6WB 2FPSA 2YCBA 1D7OA 3LIPA 3O4VA 1R15A 1KDPA 4KH0A 3U7FB 3PVSA 4MV1A 1H1LA 4CG2A 1OH8A 5DCUA 2WMNB 1LY1A 3QOWA 4U02A 1UBLS 2Y1WA 3TNDA 2DPHA 3ORYA 3U1VA 3PA6A 1MB3A 1QE5A 3NHFA 3ZHCA 2FY8A 3HWWA 4DA4A 1EIZA 4FS3A 3P32A 3E5RA 2R0QC 3ER8A 4KGDA 3GD5A 5IM4A 2XPCA 1K92A 2QZJA 1EX1A 3L7YA 1OUMA 5JXHA 2I1QA 5E7QA 3ZWPA 1OASA 1PIWA 1VB5A 3A58B 4Z7OB 1HLFA 5MFZA 2BIFA 2XDAA 1N4DA 4BDSA 1EUCA 1XLTA 1Y3BE 4RLQA 4RVNA 2MR6A 1P2SA 4DQ0A 1J2YA 3KVOA 3OFKA 3UENA 1OA0A 3ROQA 3T4XA 4F38A 4J7AA 4BBPA 4MR9A 4KWHA 4QECA 1A04A 3EVDA 4R1QA 5DTIA 3SY8A 1ZJ5A 2QP9X 2E48A 5FADA 1UFVA 3IX7A 1U3VA 3QE0A 4CL2A 1OXUA 1V43A 1VKRA 1ZICA 1O9BA 1KU6A 2VYCA 5CB8A 3F9RA 3BIOA 1TKRA 4ARUA 4KK3A 4D8XA 3KVYA 2Y4NA 2PY6A 3EQZA 3G7UA 4TL9A 2YWJA 3WK5A 5JARA 2G88A 5K8LA 1T2FA 1CQIA 3LOPA 4TT3A 1QS0A 1CZOA 4OSEA 3G5AA 3I04A 3CE9A 4OD0A 2BEUB 4ISBA 4QQ8A 1KERA 1YBMA 1N2OA 2JIMA 3R8CA 1E2LA 3BF7A 2HSWA 1XZHA 2DFKB 3QF7A 4CMEA 1GPNA 1U9JA 4WCVA 5B3JC 4CIVA 1GT6A 2XRMA 4ZOAA 4XX0B 3JATB 3LLVA 5K7SA 2HZBA 3RRYA 4LVUA 3I5YA 1C29B 1Z6ZA 1VYTA 4MP8A 4TS3A 4EMBA 2UYOA 5EFZA 4C06A 3QPVA 3IXMA 2PT9A 5I7UA 2FSGA 5AW5A 4FOOA 5BOVA 2V0NA 3WWYA 3DMPA 3I9LA 4FLFA 3UJNA 1ZIYA 2QL6A 2YUTA 4M0KA 3BSWA 1GCAA 4DJFC 4RKQA 1T6XA 4XQEA 1CTQA 5T4EA 3CCCA 1QSGA 3HJTA 5FLYA 3SQDA 3JSAA 3K8QA 2XMQA 2QXTA 1WSDA 4FDAA 4XLZA 3H9CA 1M1NB 1PX0A 2GF2A 2YVLA 1WUKS 2UZ1A 3A36A 3MCAA 1FTGA 1DAEA 3DFIA 3PDHA 2VO1A 4ID9A 1X80A 4GVPA 3TLGB 4HFRA 5K3EA 2BRUC 2C0QA 4E12A 2B7LA 4KVFA 4YRLA 2CV1A 1TVCA 2AYYA 1E5QA 1AY0A 5C1DA 3RUIA 2FKAA 5EZ5A 3SDSA 1GUZA 2ZJ3A 4OJYA 3ZTWA 4R01A 3LQQA 5CA0F 2OMKA 2YZ2A 2GJ4A 2ODWA 2JA1A 3DLPX 4R7ZA 4TWJA 1WOMA 4Y2TA 4XGQA 3HJCA 2QP4A 4CT5A 3DGEC 1NGSA 1KZ7B 3C8DA 1W19A 3K2EA 2HAEA 2J3LA 3OZGA 4JLKA 1R8SA 1FOEB 2BELA 2ZSAA 1CJBA 4QSMA 5TQ0B 1N8NA 3CBQA 4ENQA 3R9XA 4LF9B 1T1SA 4D4KA 5K0FA 3PV0A 1QUFA 1ULBA 4RHCA 2NUAB 3TECE 4L4RA 4D6PA 2JB9A 4MRMA 3MWLA 3BTUA 3MMXA 5KMGB 2JLYA 2DR3A 1QMGA 2HYDA 3HMQA 3PXCX 4RLHA 4LRXA 2C04A 3H75A 4ZARA 1DQPA 1Y82A 4KQWA 3W7BA 4B4OA 1HKUA 5L3QB 2ZIEA 3LHKA 1FYVA 5CNKA 4ZAGA 1S0UA 1O6FA 3MBKA 4L5JA 3E1KA 3RQSA 3HDYA 3Q2OA 3SSOA 2ZRMA 1T24A 1DBRA 4NJMB 3L7NA 3ZE9A 2OK8A 2G70A 1T8YA 5CPFA 2LVBA 1MAVA 3BMCA 2YW2A 4PINA 4CMIB 1BMFA 4NNOA 1DAOA 5EGNA 1G8AA 3K31A 5E7MA 4F72A 4DEVA 2NWQA 1UC8A 1VLZA 5LUAA 1HZZA 1JLSA 1KMHB 3KSUA 3M3PA 4V24A 3WMWA 1M6EX 2C59A 1GJRA 4WD3A 3G0IA 3T7TA 1SWWA 1TJPB 1YMQA 1NW9B 2FU5C 2HQRA 4GKBA 4I8XA 4YGXB 4XQCA 3VOTA 1DEHA 1FSZA 4UU7A 3WZ2A 3GA7A 2QE7A 3A26A 1RLJA 2FWIA 1BCRA 3ZX5A 4NI5A 4M9QA 1WXQA 2R48A 3CINA 3DEYX 1ZVKA 2ORYA 3QLUC 1P60A 1QQ7A 1QC5B 3T5AA 1QYWA 4H18A 2IHTA 2OGUA 3ZXYA 2BFFA 2A33A 4L28A 3QVUA 4LTDA 3WOVA 4CDNA 1LWNA 4YRKA 3H5AA 5CCXA 2IYWA 1SUSA 1JMYA 1I1QB 1AZWA 1LQUA 1PGPA 1PP4A 3IBCA 1G20E 3T35A 4A4DA 2XDQA 4PZ0A 3TRIA 1G20A 1QG4A 3ZBQA 4LIPD 5KEIA 2PKXA 4FYWA 4ND5A 1X7DA 4PCUA 4TLEA 2J3HA 3ND5A 4F5YA 2ZXEA 2Z4TA 4QQKA 1N5LA 4MVJE 2GXAA 1E1NA 3BVPA 4MVJA 3MTAA 2AOUB 3NHYA 4LVNA 2PPLA 3I73A 4HQOA 4QOSA 3VPHA 1O6GA 3AHCA 3W5IA 4YDHB 3OE5A 2CXTA 3D6FA 1Q1GA 3C3MA 4HT3B 1Z0JA 1R8QA 2DSTA 3N87A 2JI7A 3OZAA 4IF4A 2W37A 3DJYA 5KYNA 3WLPA 1HZJA 4F21A 3L0BA 2QB5A 4MV6A 4YVFA 2B94A 5DYWA 3T1TA 1SA0B 2A4MA 1GAQA 3AM3A 3L7OA 1WXGA 2JD1A 3DKPA 4IDEA 5DEOA 2AC7A 1QXSA 1UPFA 2CHVA 2EG5A 2IUTA 5I7FA 3B2NA 3FZEA 1WMBA 2HT6A 4BFCA 4CTMA 2HI0A 3PNLA 3R40A 1JG2A 4PW0A 3WHLA 1JUDA 3LPNA 4HAUA 2DR0A 2IGTA 4KUEA 2IXBA 2ZI5A 3RBAA 2WQ6A 4BX8A 1XP5A 3VOBA 1HO3A 4UM9D 4EY3A 1FMTA 4N0DA 5FUMA 4BO4A 4M0MA 3AKYA 3L4BC 4C7BA 2HNBA 5B3KA 1C7IA 1FYXA 3JX9A 3ZWXA 3V2GA 2KBEA 5LXTB 1PNRA 3OY7A 1EKXA 1GA1A 2O5EA 3EAFA 4R8KA 1S2DA 2XCIA 1B1CA 1O97C 5KC8A 3DTVA 5AO9A 1L5VA 3ES9A 1D9XA 3WQHA 1CR2A 2HRQA 3QKUA 4E5SA 5JDIC 3AFIA 5T41A 1F2UB 2GEKA 5JVDF 1N6IA 4FONA 1W76A 1TJ5A 2ISSD 4LJ9A 1V1RB 3I01A 3WWDA 4RQTA 3RQIA 5JSFA 3DBRB 3LUCA 1PAUA 1SCNE 2P75A 2P5UA 3F7NA 4IIFA 3VU9B 5BVHB 4JI0B 3ACBA 4RVHA 2GBFA 4RZQA 2ZTSA 3GLGA 1DG1G 1NT4A 2LDBA 2IDJA 4ZT3A 5ERGB 3GXBA 2HA2A 1VYHA 1AN9A 5JZBA 2C7QA 4QJ4A 4FW9A 1FU8A 3ORRA 2AH5A 3BE6A 3EGEA 4L72A 2C00A 3K6RA 1PWHA 4RE6A 2HZ7A 1HEIA 1BJTA 4RJIA 5EINA 1JZSA 3T0FA 1QHSA 5AESA 4MAFA 3E22A 4P4LA 3ZQUA 2H48A 2YXPX 3V9PA 5EP4A 4QGBA 2BH9A 1APBA 1CIPA 3MJVA 1CY1A 1W8IA 3VPAA 1E6MA 4MQ6A 2K6GA 4P58A 4YJFA 3FPSA 2R1VA 4KQMA 3D7LA 4HDSB 1GCGA 4KWIA 4ND6A 3GA0A 3JVIA 4JJIA 4A92A 5IT0A 2A9PA 4NYIQ 3RCBA 3KQNA 4J90A 2VOJA 3ELBA 1E3JA 4BLPA 5IDXA 3FWHA 1K5GA 3LY5A 2CMFA 4H3VA 3N7UA 5CDSA 3OZIA 3RAJA 1RZUA 3TLZA 3FBTA 2ISCA 1VL5A 2GO7A 3PR2B 2HQSA 3LSTA 3PS9A 4QTYA 4H1WA 2WTUA 4EPTA 2CNOA 3S3TA 4II7A 1CUUA 1FRZA 4NU6A 3K70C 5CPBA 1K3UB 4A7PA 4M8IA 2QJRA 1KS2A 4DABA 4CCAA 4NJEB 5GVRA 4RZXA 3ZGVA 2NIPA 4IDOA 1E8DA 3ORFA 4NCKA 4ZZ2A 3I12A 3O31A 2VK8A 5NULA 4QHTA 5A4DA 5A3QA 5K4GA 3FVQA 1F2TA 3PT9A 3PIRA 3NM4A 1KKUA 2EZ4A 5EWJB 4OY3A 1FX0B 5KSPA 5GVSA 1LC0A 1QDLB 4Q7KA 1YCDA 4WERA 1NNSA 3SDBA 2HFJA 2JAUA 1IXZA 2RHMA 4LOKA 4Y2YA 4NU8X 4BOYA 3CJTA 5FTNA 5B55A 1C7ZA 1K08A 4KQCA 5ALYA 4CQLA 2QW8A 5JJCA 1R0WA 3QLTA 4JR1A 1X38A 2VTDA 5L53A 2O6HA 3KHKA 3LT2A 5IASA 2B8EA 1JU3A 1ATIA 1MOSA 1ISMA 2P27A 4XUGB 3FTFA 4NEHB 3LTEA 5JAOA 5UKDA 4HN9A 4FHZA 4G6ZA 5THXA 3DQPA 4RXUA 4UHDA 3D1LA 4XCVA 3WNZA 4MW5A 4BVLA 4OLAA 1Z06A 2C4MA 2NZ2A 2VZLA 3G2NA 5EJ2A 3NDIA 4KGVA 3P7MA 3EWNA 3NHJA 2FRXA 3WXBA 1T4DA 4ZAYA 3TB4A 1T91A 1J0DA 5CYOA 3GLIB 4FLEA 1GDDA 1ETHA 1SXHA 2VT6A 1ZD5A 3BCUA 4M0FA 2XT9A 3QX3A 2H9IA 3I01M 4XSVA 4JA2A 4US2R 1USWA 1ITZA 4R2IA 4TTRA 1PI3A 1EUYA 4JQYA 2CWDA 4XLLA 4E30A 5EP3A 1XZQA 3K7EA 5F5LA 4PG4A 5HDBB 1REQB 1XAHA 3ETHA 3F6YA 3N3AC 4Y30A 4X00A 4EPXA 4DY6A 3H5OA 1AKVA 1GR1A 2ZPTX 3DAHA 3KJHA 3NX4A 4AY2A 4F2PA 2AQKA 2RGDA 3GOQA 1E8MA 5GOTA 4DYVA 6REQA 3TW8B 5FBQB 2DLCX 5BPFA 3LVFO 3S2UA 5AM1A 1G8MA 3GT4A 4OHKA 2D1SA 4DB2A 1XRQA 1E2IA 4I4IA 2CMHA 3IKMB 1NQOA 3GHHA 2JCYA 3CB4A 4AF6A 4R54A 3CRNA 3BZUA 1FRNA 1S4MA 3G85A 1UDWA 1VKJA 4DUPA 4OGLA 4EA8A 1ZK3A 3M6LA 1E94E 1FS5A 1WVGA 4LNHA 1S3IA 4BVKA 4GKVA 2Q6VA 3W34A 1CZKA 3DEAA 3ZWVA 4MIEA 5C2JB 3AHDA 1L7NA 3C3AA 5LKAA 2WV9A 1X1RA 1WMSA 5I48A 1TT7A 1YVRA 3RYHA 3TOSA 1CYDA 4TN5A 4PS0A 3VJKA 1CJUC 1SN7A 5FFFA 1DBWA 3DGFC 5HCUA 3HMKA 4ARCA 1LSOA 1CDOA 1QB7A 2XF8A 3I76A 3SQLA 3F3KA 2CUZA 1E59A 4TYWA 1KIMA 3PFFA 1E1RD 2NXWA 1K2VN 3PC6A 4LSGA 5IAJA 5LL6P 3P20A 4OGFA 4IZHA 1ZJZA 3NRJA 4DLSA 2OLJA 3R7LA 3DBIA 2QE6A 4LXXA 2ZSBA 1DCKA 3BX1A 2PN1A 3DMRA 3OCZA 1KHHA 2VTBB 4IV0A 3QKRB 2D7JA 1JHXA 4QGAA 1JAHA 2O20A 2X8WA 4YUYA 3PXBA 3EOBI 1VFNA 1Z4KA 3ABQB 3FHTA 2PT5A 1LDEA 4UBJA 1ZNXA 4DRZA 1LWOA 2PMDA 4OB6A 3KHUA 4O4LB 1N8KA 3TUJC 1GGNA 1FDOA 1PG2A 2BI4A 4FYYA 4XWOA 1YXMA 3S5UA 4DIOA 3B9BA 4LZWA 1Y9AA 3C2QA 2JAHA 3W8EA 3PQEA 1QZUA 4TN1A 2VF5X 4L4SA 1XD2B 2O19A 4CM8B 2V3WA 3V3KA 2V3CC 2J9RA 4YJDA 5EGSA 4BPRA 2RE8A 3ESCA 4YBRA 1FW6A 1RQRA 5JXIA 4WK0B 4TV8B 1A72A 4R1MA 5J59A 1PVDA 1IAVA 1JKJA 2RK6A 3A9WA 3FRJA 3ZI4A 1F8GA 1NZFA 3G89A 5D00A 1M1XB 3VR5H 3IAHA 1XC7A 2QT9A 1YQGA 5C31A 1RYZA 4EJMA 4UASA 1ENZA 2ZB2A 3QA9A 5D1HA 9GPBA 3J7AC 1I6MA 2YXNA 5E6RB 4Q1EA 3A6PC 3L6OO 3GZNB 2HXGA 3EJWA 3TTTA 1J8YF 2OC9A 2PL5A 4WA7A 1FE8A 1YR1A 1GKYA 3I6BA 2JCSA 4UW9A 2D2IA 4CMBA 3AC0A 1QRSA 1K4YA 5DHUA 4AJEA 3CX4A 4S1PA 1RWNA 4XJTA 4MAMA 1XU9A 1L5HA 4AICA 1ZSNA 2O3RA 4MRNA 4NFSA 2C4UA 1Y9JA 3ENNA 4PTYA 3FGPA 1QHEA 4FSXA 4Q3EA 3L5KA 4IEIA 4QG3A 3OU7A 4QULA 1YZGA 1KZGB 2QAIA 3EH1A 2DY0A 4M21A 2FW1A 5CIQA 3PB3A 1Y42X 4OBEA 2Q3MA 4Q05A 3FTQA 3Q7SA 4FGZA 4EUNA 3MJHA 4GMXA 2I71A 2ZJ8A 4HNVA 5I5EA 1K86A 3O3CA 2I66A 2OY0A 2OXEA 4BL5A 4CM9A 1QHGA 2PWYA 4O0LA 2AL7A 2Z3VA 3SZOA 4BO2A 3BA1A 1EP1B 4EKGA 1Z6GA 4X41A 2AUMA 1KDTA 4IBOA 4NICA 3TLMA 3N0TA 3ZVKA 4F3TA 1PGOA 1E9VA 2P2YA 2I3AA 3CY6A 1BVUA 2H1RA 3BMNB 3HL4A 4BJ5A 4LZZA 3LYAA 4KE9A 4BVHA 3S8YA 2PL1A 3FMOB 4XXHA 1IPHA 2AOTA 4DA6A 4L51A 5DW0A 3U4DA 4J94A 4EL0A 1E7MA 4HGQA 4TKLA 2WB4A 1DQZA 2ZB8A 1PJSA 1W5BA 2AFHE 2YVQA 1C3OA 3NNDA 4MGKR 1KTVA 2HNKA 5IULC 3GFPA 3ZCPA 1KYTA 3W0LB 5A02A 5JO0A 1XDWA 2CXXA 4ZVQA 1KP3A 1L4HA 3AY7A 4C2UA 3HK2A 1M2JA 5KREA 2P2LA 1SIOA 1P7ZA 5HS6A 4HJXA 4PYJA 3GDHA 4BLRA 2P4HX 5T3UA 4DDVA 3ZHXA 2ACWA 2ZYHA 1ZH8A 2GN8A 1R9MA 1V5FA 3PDIA 3SJ7A 5IWAB 1XCJA 2JZCA 4WSOA 3D3JA 1R6DA 1KORA 2JLXA 3HP4A 4RZUA 4DMMA 4BY9E 1HE1C 1KARA 4OM7A 4EW2A 5BQFA 1K7SN 4ADSG