2PX6A

Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
253
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQPTHNSLFLFDGSPTYAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioesterase domain
publication title Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 2px6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2px6A01
3KWFA 3AFIA 3D3NA 2ZYRA 3B5EA 5CRIA 1XZEA 3IUMA 2OCGA 1LZKA 1ZD3A 4MEBA 2RHWA 3WWDA 2HA0A 4HRXA 1YCDA 4J0JA 2WQZA 4AN0A 2PL5A 1CUJA 4OB7A 3G02A 2BGNA 1RYYA 4FWBA 1C7JA 2OAEA 4PSUA 4BTLA 1P0MA 5I9IA 2VQ6A 1A8SA 5AI5A 1QIJA 5ALPA 3WK9A 5AI9A 5HF8A 2HA7A 1ZD4A 2YASA 3OTQA 3FYTA 5LZ8A 4EY5A 4PSCA 1CUXA 1F6WA 5AI6A 4EY4A 4P93A 1JU3A 4H0CA 4X85A 3R3UA 3WK7A 5AM1A 4X94A 5LKAA 1ZICA 2Y6UA 3ESCA 3F96A 4L0CA 4NVRA 3W9BA 1ACJA 3ANSA 5AKGA 2WIJA 2HU5A 3AJAA 4QDOA 2XQIA 1DQZA 1G42A 3I2IA 3W06A 3G9UA 5JALA 1R9MA 5K3EA 2GBIA 4BE4A 1GQRA 3H0CA 1GGVA 1CRLA 4EA6A 4IH9A 1DU4A 1LPAB 2HL6A 5EIEA 5FRDA 2HA4A 2GBGA 2XUIA 1EX9A 3HXKA 3I6YA 3ESDA 4B81A 2CJPA 5DWDA 4IHAA 3R3VA 1UK6A 2O2IA 3FYUB 4B83A 3CN7A 4FLFA 4X92A 5AIAA 3WKEA 2WSLA 4KACA 5K5EA 1IVYA 5IKXA 2WFZA 5ALEA 2Z8XA 1X2EA 1SFRA 5I8PA 5DJ5A 1MT3A 1MNQA 5EHXA 1YASA 2DHCA 1K5PA 3F67A 3I2KA 2JGMA 4BZZA 2GBFA 1FFDA 3KDAA 1XQYA 4AB1A 3F8SA 2YH2A 4X95A 4LYEA 3ZLUA 3BE8A 1JJBA 4KEAA 1E3QA 1XZKA 5ALUA 2XLCA 2WUGA 1KEZA 1GPKA 2XLBA 5FP0A 3FLEA 2ZSIA 5AM3A 1E8MA 3PUHA 4DNFA 4X97A 3GBSA 3WKDA 5HZGA 4RGYA 4W9RA 4KRYA 5BV7A 1QONA 5K3FA 4BATA 2CMFA 3X3HA 5HFAA 3H2JA 4W1QA 1H2XA 4B0OA 3VISA 4I19A 2CKMA 3OC0A 4LXGA 2GYVA 4WDRA 2RAUA 1HPLA 2DR0A 1Q84A 5ALVA 2V9ZA 1UOOA 3T4UA 5E2IA 1YB6A 3DD5A 5JD5A 4INZA 1K8QA 2B9VA 4QDZA 3G0DA 3I2FA 4RE6A 6YASA 4H7EA 5JAHA 2RONA 2PKYX 4F0JA 5LZ5A 1XRLA 2VTVA 1CUUA 2Z5GA 3IA2A 5A62A 4Q1VA 2J3QA 5EHZA 4FFWA 4E15A 1MTZA 4UHDA 1E5TA 4EBBA 4H7FA 2PSHA 4QLAA 2XUDA 2RGUA 4A5SA 3AINA 5IH7A 4DNQA 4DSAA 3OPMA 2XUJA 4ZV9A 3O0DA 5T4FA 3D4LA 5E4YA 1MN6A 1XKTA 3EIOA 1QJ4A 4BCBA 4Y2RA 2CBGA 2BCEA 2V98A 3WL5A 1XRMA 3FSGA 4AN1A 4Q05A 4QDUA 5AM2A 2OLEA 5IVKA 4FBLA 1BCSA 4CG1A 2OCKA 3KSRA 1QIDA 2AJCA 1JJIA 1E89A 2JGKA 3FOBA 5E4TA 1VLQA 2V96A 1SCIA 3MVEA 4H18A 2W6CX 3VJMA 4C01A 2PPLA 3CCBA 4EY8A 5KWIA 1XLVA 4Y2VA 2RHTA 3R3XA 1TK3A 3VKFA 4FOLA 2QT9A 1R3DA 3EQ8A 4Y2XA 2OAGA 2VJCA 4PO3X 4E11A 2WG0A 2GZRA 1A8UA 3A70A 4BC0A 4DYHA 3PE6A 3AZOA 3W9UA 4C89A 2AJDA 2ZJ6A 1IZ7A 3WKBA 4CIAA 3TJMA 1MJ5A 2GZSA 2WIGA 4LYDA 5CTAA 2CB9A 2XUAA 3V1KA 4YK7A 5AI4A 2QUBA 5JATA 5DTJA 4OSEA 1JMKC 4C4XA 3P2MA 1B41A 1XQXA 2QR5A 1X70A 3R40A 4KR0A 5HK9A 3FAKA 4CI9A 3ZV7A 4C88A 5D3KA 2WUFA 1QO9A 1QTRA 5BWBA 2WKWA 3O4JA 5E4JA 2C5FA 2OGZA 1EK2A 3GA7A 3N2ZB 4G4JA 4CCWA 5K3CA 1Q0ZA 4PV7A 4UHCA 2WTMA 3LIIA 3STUA 2BGRA 2WFMA 3PFCA 2AJLI 5FKJA 2ES4A 1XZAA 1ORVA 4Y2TA 3R3YA 5FOQA 3O4GA 1XZDA 4FHZA 4Y2YA 4WY8A 4J0DA 3BDIA 3D2AA 4OD0A 1UZAA 3ESAA 1ZOIA 2WIKA 4KE9A 2Y2VA 1EDBA 2AJ8A 4Q3OA 1A8QA 5K3BA 4PF1A 3LIPA 4KRXA 4C4YA 2Z3ZA 1MPXA 4OYYA 5D6OA 5A6VA 5AOCA 2WG1A 1H2ZA 1ZIXA 1JFRA 4AX4A 2HRQA 1JI3A 1UOQA 3Q0TA 5AOAA 3HACA 3W04A 5LP1A 1ZI6A 3QPCA 4S0XA 1G5FA 1TQHA 1AGYA 4N5IX 4QNNA 4QWMA 4GHWA 1DWPA 2H9YA 3AILA 2WILA 1CUEA 4GECA 1XROA 2PU7A 1THTA 1AUOA 1GKLA 1TIBA 2H7CA 4K6GA 2ACKA 1UWCA 3H2GA 4IH1A 3G7NA 1EXWA 4X7BA 5AH0A 4FTWA 4BZWA 3V1NA 4JYPA 4AZ0A 3AIMA 3WL8A 1A7UA 5DNWA 4BAGA 4OCZA 1J2EA 4KAJA 4H7DA 1CFJA 1EINA 2Q0XA 1CR6A 2XMDA 3D2CA 1XRNA 2ZYIA 5K3AA 2B4KA 4N8EA 4E14A 5ALIA 2Y2UA 1ZD5A 1GQSA 4BBZA 1QIFA 2WJ4A 3R0VA 4UBLA 2I78A 3G0BA 4CCYA 1WB5A 4PQEA 1AURA 3FWHA 5ALHA 4BB0A 5CMLA 4Y9SA 2X8BA 4CG3A 5ALKA 1YB7A 5JAPA 2IITA 3IDAA 3ZLVA 2HA3A 5C8VA 2EDAA 3STYA 1CUIA 1H2WA 2XB6A 3S2ZA 3EQ9A 2J4FA 4HXFB 1BN7A 3IB3A 3DL4A 5CH8A 5AM4A 5AK5A 5J3JA 4DMCA 1CQZA 4L9AA 1L7AA 4XVCA 4J7AA 2JGEA 5EGNA 3B3QA 4V2IA 1XLWA 4G8DA 4MWSA 3I1IA 1Z68A 3CN9A 4G5XA 2OCLA 3ESBA 3BDVA 3DOIA 4ARAA 4CFSA 5EIAA 1R88A 1BEEA 4JYMA 4LXIA 3M83A 3I2JA 3FVRA 3QM1A 2OG1A 4G9GA 1EA5A 2Z3WA 3C6ZA 1JKMA 4Y2PA 1WCYA 1LPMA 1QIMA 1UT6A 5LZ2A 3WA7A 2VF2A 1QO7A 5JZBA 4AO7A 1VJ5A 2XUKA 2VAXA 4H7HA 2IX9A 4KAFA 1XZGA 2DSNA 4RPCA 4G8CA 5ALQA 4DNOA 5ALRA 3UMJA 1BEZA 2RI6A 4U2GA 1XRPA 2ZSHA 2OXEA 1N1MA 4KYVA 1DWOA 1LPSA 5CH5A 2OQIA 3F9CA 1NU8A 2QOEA 4WFIA 3BF8A 2VJDA 2QKYA 2BUCA 2JIDA 2QXUA 4NMWA 3QVMA 4EY6A 4CIBA 5LZ4A 2O2GA 1E8NA 5AKEA 5DYYA 4WFJA 1MU0A 1WPRA 1HBJA 3G9TA 5AI0A 4ZREA 3F97A 1YR2A 2WU4A 1W6RA 3U0VA 3SK0A 2OCIA 3LLCA 2HM7A 1T4MA 3DQZA 1WB4A 2HU8A 2WFLA 4ZXFA 5AHXA 3TRDA 1CUYA 3WK8A 5KWJA 3GFFA 2WIFA 2H7YA 3FLBA 1XZMA 4LKOA 4GBGA 1TRHA 1K4YA 2G4LA 4A23A 1EH5A 3ZWQA 3M3DA 3C6BA 4JEIA 3PDCA 4B0PA 4WCVA 2XE4A 3STTA 3A6ZA 5LLSA 4UHHA 3BIWA 3C5VA 5FUMA 1CUDA 2C0QA 2BKLA 2PSJA 5ESRA 3SWWA 3E0XA 4BC1A 2XUFA 4FDMA 3DS8A 1ACLA 3FBWA 3WZLA 4X3CA 3DYVA 3WWCA 5AM5A 2O2HA 3H17A 2G63A 3WLAA 4C6HA 1QLWA 1R1DA 5CT8A 4MJ3A 4L3WA 3G8YA 1ZGCA 3LP5A 4BRSA 1CUHA 3BF7A 3C8DA 5ISMA 2H1IA 4DLNA 1XKLA 4IO0A 1Y7HA 2AJBA 3A2MA 4MQLA 4X6YA 1W75A 3DL7A 3I6ZA 4HAIA 3C6YA 3I2HA 1SCQA 2FX5A 3G0IA 3VVLA 4H7JA 1EDEA 4J0GA 5A7GA 1YA4A 5HF5A 1IUNA 3R3ZA 4BDSA 2QTBA 4I4CA 3BL8A 3A2LA 1H23A 3MUOA 4W1PA 3DDUA 3LCRA 3G0GA 4G4IA 4GLBA 4O08A 4DMKA 3V9AA 1ETHA 3O9VA 3UUFA 4OU4A 3RLIA 5AM0A 4QA9A 4RE5A 3V1LA 1Y37A 4UFPA 2HFJA 5AKKA 3ZI7A 3H1AA 2C58A 2OQVA 4TGLA 3DEAA 4W1SA 5IVIA 3PICA 2DQYA 5CXXA 3FCXA 1CUSA 4U2FA 5DNUA 1JMYA 4JNCA 1U4NA 4UPDA 4H7KA 2VSQA 3I1YA 3ZLTA 3PUIA 3MUNA 5EI5A 1J07A 2BFNA 1EVQA 5ALDA 2I3ZA 5KBYA 2QJWA 2QS9A 1WM1A 4U2DA 2PSEA 1YA8A 3I28A 3DYIA 4YPVA 3V1MA 2FJ0A 2BAGA 5JZSA 5K3FB 4AO8A 1QIEA 1UK9A 4YASA 5C8ZA 5SYNA 4ZRDA 5ALMA 5CH3A 3IUQA 5AKZA 2WHRA 4I3FA 4N5HX 3WK6A 3BJRA 4B9AA 2AXEA 4Y2QA 1TCAA 1XZCA 2ZJ7A 3KXPA 5HFNA 5CURA 2WLSA 4UBMA 4X6XA 2PU5A 3G9ZA 1QFMA 5DYWA 3L1HA 1XLUA 1CV2A 1Q83A 2XMRA 4G4GA 3YASA 2Y1KA 3H18A 2UZ0A 4X6UA 2QUAA 5EHQA 3IIIA 1EHYA 1U2EA 4EHBA 3HYSA 1F0PA 3WZMA 1R9NA 3DKRA 5HQ3A 3BXPA 4ETWA 4HXGA 1XZIA 1ZJ5A 3M81A 3STWA 4WJLA 2Z8ZA 5ALJA 4FKBA 4U2BA 1YAHA 1DT5A 3C8HA 1U8EA 4K2AA 3QMWA 5HK8A 2HHAA 1VXRA 2V97A 2O7VA 3QYJA 3C70A 4UHBA 5AKYA 5DTIA 3WWOA 2I03A 2ZJFA 5D3ZA 3QMVA 1L7QA 4MEAA 3S8YA 1H22A 2XMGA 5AKXA 2QZPA 3HLKA 1UXOA 1Q0RA 2ROQA 3KWJA 4HS9A 1MO2A 2GBCA 5C8XA 2QRUA 4KE8A 3GROA 5K3DA 3GUUA 3O95A 1LGYA 1N5MA 3M82A 4OYLA 3BJMA 1G66A 1BU8A 5A7HA 3HZOA 4H77A 2WTNA 4P92A 2XT0A 4B84A 1O6FA 3JW8A 1AKNA 1TAHA 3O4HA 3MGAA 1B6GA 1CIJA 3T52A 3H2IA 4M0FA 3O9MA 5YASA 1CUAA 5FLKA 2OPHA 5ALXA 1XZFA 3QITA 5CT5A 3PF9A 1UKBA 3E4DA 1IUPA 1BN6A 1ODSA 4J0HA 2XDWA 5T4HA 2VT6A 4K6HA 4BE9A 2D0DA 4J0IA 1TCCA 4BAZA 2WHPA 1C4XA 5ALFA 1WB6A 4OB6A 1ORWA 1XFDA 5LYYA 3WWPA 2PVSA 2WHQA 4U2CA 1BRTA 5AKHA 1R4ZA 3K2IA 2Y6VA 1EB9A 3KOOA 5HKAA 1AQLA 3N0TA 2R8BA 3L1JA 4P08A 5ALSA 1GT6A 3O4IA 3R41A 3HC7A 2HA2A 3L1IA 4W63A 3C87A 3EQ7A 4QDTA 3HJUA 1VA5A 1CUCA 2DHEA 4BP9A 1OCEA 1WHTA 1VKHA 2ORYA 1N5RA 3QZUA 4BVKA 5F4ZA 1QIHA 1EVEA 2PUJA 4DIUA 1EK1A 5CBKA 1NU6A 1BCRA 1VXOA 4Y2JA 2YYSA 3DOHA 5DNVA 3G0CA 1DTEA 1ODCA 2PSFA 2XMBA 2ONCA 1CUBA 3JWEA 2XUGA 5AK6A 1SOMA 4BTVA 1CUFA 4Q82A 1WPXA 3WIOA 3ED1A 2C7BA 1Y7IA 3WK5A 1ISPA 2X76A 3WA6A 3FYUC 2O7RA 1JU4A 3C6XA 4X71A 3VJLA 4GWLA 3W2TA 4DMHA 1CVLA 3HABA 3PFBA 5CT6A 3PI6A 3FVTA 3HSSA 1S8OA 4D9JA 3WKAA 2JGFA 1IUOA 5JAOA 2CEKA 4BP8A 1HL7A 5D7BA 4A16A 3IUNA 3DCNA 3TGLA 4G1FA 5SYMA 2NW6A 2VJAA 3RARA 1DX4A 4ZGBA 1FJ2A 5ALOA 1QTIA 3OURA 3HEAA 2HA6A 4QEKA 3WWEA 4DM7A 1IZ8A 2WU3A 4J0KA 4FBMA 2PUHA 1WHSA 1XRRA 2B61A 4BAUA 4EY7A 5I7UA 5JZ9A 2ACEA 5AOBA 2XMSA 2BJHA 3A2NA 2LIPA 5ALZA 3OG9A 1UK8A 3WJ1A 1DT3A 2RIPA 3STVA 4AXBA 1LBSA 4X90A 1T2NA 3D59A 1XRQA 4OUKX 2IIVA 3QBJA 1AZWA 1CUWA 2R11A 1U65A 4M0EA 1AX9A 1VZ3A 2K2QB 5AKIA 5FPQA 3FYUA 4M0MA 5CW2A 4Q34A 1FFBA 4IH4A 4J03A 4LIPD 5AKLA 4FLEA 1THGA 4LHEA 1YSCA 1MAAA 2PM8A 1OILA 2EEPA 2VATA 2QVBA 3AUKA 1OXMA 4N8SA 4QDXA 1BS9A 2WUDA 1EB8A 2XQGA 5ALLA 4MWTA 1UFOA 1LPNA 1QIIA 4RNCA 4X93A 3RK4A 4L72A 3H2KA 1LLFA 4GDMA 1RWQA 5JIBA 4KJXA 5T4BA 3CCCA 1XZBA 3E1GA 4UBKA 1QIGA 2W22A 4XJVA 4UBNA 1XZLA 3CXUA 3QPAA 4TVKA 2D5LA 3AZPA 3SC2A 3DJYA 1PJAA 1WOMA 2P8SA 4FNGA 2HADA 5A2GA 4QWWA 3AIOA 5AIBA 3IVMA 1VOTA 4EZIA 1W52X 1VA4A 1C7IA 2PSDA 3B12A 5ALNA 3WJ2A 3FNBA 1XZHA 5JYCA 5BOVA 3BWXA 4HZGA 1KU0A 3FSGD 4MQMA 3RM3A 5FV4A 4OU5A 5JANA 4TPKA 1J06A 2WG2A 3FCYA 4H35A 2WFLB 2GYWA 4OPMA 1FFCA 4B7ZA 3NWOA 5AK4A 4DSZA 4Z49A 1SCKA 4UBIA 2ZYSA 1DINA 1ZGBA 2HU7A 4IQ4A 2ECFA 1CQWA 3C45A 3OOSA 2VA9A 2XQKA 3SX4A 2HIHA 1O6GA 2XUQA 1J1IA 4DTCA 1XQVA 1YS2X 4B6GA 4BCCA 3BIXA 1LZLA 4J0CA 3QPDA 1FFEA 2QXTA 2C0PA 3ANTA 4UHFA 4GXNA 2YXPX 3GELA 4G8BA 5DLPA 2PBLA 1FSSA 1UOPA 4X00A 4UFNA 4YX9A 1H2YA 5JADA 4DGQA 2JEZA 4H7IA 5CXUA 1BE0A 2JGIA 2XMCA 3VVMA 2HFKA 5AP9A 1LPOA 5T4EA 3D7RA 2WJ3A 3NGMA 5CT9A 7YASA 2CZQA 1MX1A 1LBTA 2DCMA 5LZ7A 2C4HA 1MX9A 4HRYA 1KU6A 3H2HA 3WQHA 3WK4A 3H04A 3RKSA 2GYUA 1L7RA 4MYDA 4Y2UA 3WL7A 5C7YA 5FXMA 2XQFA 2ZVDA 2VT7A 3WYNA 3IBTA 1W1IA 4BYMA 2DHDA 1M33A 4K6KA 1CUGA 4AO6A 4NZZA 4PSDA 1HDEA 2XMZA 3G9XA 4AZ3A 1XQWA 1CLEA 2HDWA 4ZI5A 4GEGA 1ZI9A 1A88A 2ZYHA 2E3JA 3D2BA 1P0PA 4AMZA 1N8SA 5AK3A 1SC9A 3VXKA 1ODTC 5A7FA 4F5ZA 1QFSA 4FNMA 1VE6A 4OB8A 4GW3A 5CT4A 4KE6A 4ZV7A 2VAVA 2WIDA 4EUSA 3PF8A 1LNSA 1JJFA 1E66A 5EIHA 1NX9A 1QGED 5H3HA 1JT2A 3KD2A 2DQZA 3EBLA 1USWA 3D5EA 4FMPA 5HF9A 3DLTA 2C5GA 5AICA 1GPLA 5ALGA 1QIKA 1HLGA 2XQJA 2B20A 4E46A 1ZIYA 4UBJA 4MXDA 5FPPA 1HQDA 1RP1A 5JD6A 1PV1A 2QMQA 4B9EA 5IVDA 2QM0A 4WDQA 4XWGA 3QH4A 5JAUA 3WL6A 4XX1A 1DQYA 4EB0A 3W05A 2BUAA 5ALYA 4MYSA 4G9EA 1UKCA 3U1TA 1X2BA 3IULA 1AMNA 5A71A 5AJHA 4LXHA 4QLOA 2HA5A 2HRRA 5LIPA 5HCUA 3EF3A 1TKRA 2XUOA 5HQ3B 3C5WP 1AC5A 1GXSA 1W4LA 3E3AA 2XMQA 1XZJA 3LS2A 4X91A 1P0QA 2G5PA 4Q3LA 1ZJ4A 1MAHA 4PNZA 1DWQA 4C87A 5EFZA 5FDFA 3OM8A 3K9BA 4AQDA 4B80A 2WUEA 3NUZA 1CEXA 1K6EA 1QOZA 5C81A 4BDTA 3GZJA 4ZWNA 3D0KA 5JASA 3AIKA 5EHNA 5LKRA 5AI8A 2FJPA 3R3WA 4UHEA 3I6MA 1YAJA 5KREA 2EDCA 3QMMA 1DX6A 4HVTA 4Y2SA 1IMJA 5BWCA 1F0NA 2JGLA 3IURA 3ICWA 4UUQA 4U2EA 5LZ9A 4BVJA 3F98A 2JGJA 3IUJA 2WM2A 1ZI8A 2G5TA 2JF0A 4BVLA 1F8UA 1FFAA 1YS1X 3DKKA 4C4ZA 4DMFA 4CG2A 5HF6A 1GPNA 2OGSA 4W1RA 3Q8WA 2VJBA 4ARBA 4UFOA 4F21A 4J3JA 2I3DA 3STXA 5IVHA 2XI4A 3WI7A 1UK7A 5ALTA 1MX5A 3V48A 2OGTA 1GZ7A 4P9NA 1CPYA 2J3DA 4N8DA 1VE7A 3H19A 2XUHA 2VEOA 3AZQA 3WYDA 3UUEA 4QE3A 3WIBA 1VZ2A 5JD4A 1I6WA 1P0IA 3DNMA 4DNPA 2FUKA 1PFQA 4Y7DA 4HTAA 2WJ6A 4JH0A 4F60A 5DYTA 1CUVA 5HKBA 1EDDA 1GKKA 1QZ3A 3VDXA 2JBWA 1K63A 4FLMA 2J4CA 1QE3A 3H1BA 1R50A 5ALWA 4BRZA 3K6KA 4JUIA 3NOXA 2H7XA 2JEYA 1EI9A 2QJRA 1W76A 3WKCA 4FFVA 4AMYA 2XUPA 1MNAA 2CUTA 1D07A 4KAAA 2PX6A 2WHPB 2X5XA 3ZPXA 3FLAA 5AO9A 3WMRA 2DFPA 3VJKA 1LPPA 1CUZA 4ROTA 1E8DA 4PW0A 3I2GA 4B85A 1TCBA 4BCDA 1HKHA 5JARA 4K5QA 1BROA 1UKAA 3TEJA 4B82A 4NS4A 2BUBA 4QZVA 4WY5A 5AKJA 3HI4A 4HXEB 4Q3KA 3ICVA 1ZD2P 3ILSA 4XIIA 3JYHA 4WFKA 4ITVA 4UBOA 1G4HA 4KE7A 1LPBB 4CCYB 3C43A 3HRHA 4GI1A
chains in the Genus database with same CATH superfamily
3AFIA 3PLAE 1CZUA 3PHIA 3NM6B 4Y1RB 2G5GX 5GJWC 5U9CA 3B5EA 4PG8A 3VNBA 1UKZA 1J24A 4Q7KA 1XZEA 2ECQA 1A2KC 1QMPA 4M7RA 4XPIA 2OCGA 4ZKDA 1CF4A 2XDAA 1U1IA 4BWYA 4CNQA 2EW2A 1ONPA 2B4TO 3LOQA 1PZHA 3RS8A 2CNKA 2G7MC 5E9JA 3S8MA 4F4HA 1YCDA 3PNBA 4J0JA 3PTZA 3V4PB 1WDLA 2BMWA 5A9TA 2A9VA 5DMHA 3TFWA 2JL1A 1KH1A 3L77A 5L4SA 2PLWA 3GP8A 3TFQA 3TNFA 3MPOA 3PC2A 1Y5NA 6ADHA 4KI7A 3VKHA 2O1SA 2GARA 3UHJA 2G28A 3WRWA 4OMUA 4M1EA 4ZRNA 5KQMA 3G88A 4PSUA 2JLZA 3B1WA 1PL8A 1PEYA 2NQTA 3AP3A 4REOA 3M4NA 1UZLA 2W6IA 2VJQA 4D57A 4KQHA 1ID8A 2Y1CA 3BILA 4W9MC 5AI5A 4PLZA 2DC1A 4KH0A 4C78A 4OX9B 4PZ0A 3HADA 3ZU3A 2YWHA 3HCWA 3M0EA 3B1KA 4C7OA 1I2AA 2C1EA 3GAAA 4AU1A 1CUXA 2VDJA 5BXQC 4QECA 1M6VB 1R66A 1XTPA 5GPBA 3BJZA 4KUGA 1UJ4A 1YZUA 1CJCA 3E35A 1VIDA 3WK7A 3GGOA 5KYWA 5AM1A 1H2BA 3CUKA 4H9GA 2RDMA 5LKAA 1ZICA 1CDEA 1RD4A 3DPIA 1V8BA 2Y6UA 2YQ5A 3NTLA 3OPVA 4ZJZA 4L2IA 4QG3A 5JBIA 3R9XA 1Q0SA 3HB1A 3HUDA 5DN9A 2REXB 1C2TA 1H65A 1IRXA 2C84A 2IZ1A 4QYIB 1X0XA 1JLKA 5FR2A 4ZEWA 3B9BA 1B2LA 1DJNA 2PXCA 3N2IA 1JHQA 3JD1A 3BFKA 3I23A 1JX6A 1LVUA 2WHXA 4NESA 4XVRA 3QK7A 5LDHA 3VI4B 1Z82A 5CB4F 1ATIA 3G2HA 4I4LA 2BBSA 4NE9A 2I4IA 2IW1A 3O21A 5CLIA 4KXLA 5JALA 1IN7A 1G55A 2KQUA 1T2AA 1KIFA 3BWCA 1R5NA 3NBZC 3OMXA 3DOEA 2N47A 3M1AA 1XCLA 4LCJA 5JTTA 4LC9A 2HCFA 2F3TA 1D1TA 3C3PA 5IAOA 5THXA 3VNUA 3KWLA 4S0ZA 1OGIA 1P9RA 4NK4A 1JYEA 2FPKA 3N2GB 3D1LA 4BE4A 4GYWA 1V41E 3H3JA 1SIOA 2I34A 1DLJA 1GGVA 5L40A 4LJRA 1Y1PA 1NVVQ 4MX8A 4MB6A 1UDAA 3S4YA 4POOA 1I1HA 2NVOA 3CLUC 2IEAA 4RH0A 4S12A 3EPKA 3RJZA 3M5CA 2XCLA 3C3WA 5FRDA 2BY4A 4MW0A 4TTQA 3GT3A 1V16A 4OYHA 1S8FA 4OP3A 3EVDA 3SMVA 4O4HF 2XUIA 2V58A 1YI8A 2XTJA 4MYHA 2EZ4A 3EXEB 3NDIA 4P3OA 3S7TA 4C1BA 2FUG1 5HZMA 2AYYA 1CNMA 1Y1RA 3HXKA 2C9MA 3JVIA 1RQXA 3I6YA 4B81A 3IS3A 4ZO6A 5I9NA 2XOKD 3FVVA 1QVZA 1E7SA 1ULUA 3GFRA 5JJCA 4NMMA 3VZDA 1H9BA 2XRFA 3FYUB 2EVWX 3IP1A 3CN7A 3PJDA 4RMIA 4A4DA 2QRJA 3IPLA 4Q7JB 1KYWA 5AIAA 3W5IA 2GCEA 4U4AA 4KACA 3TK1A 3KKPA 3LUKA 4QT0A 3O8OB 1Y0BA 3SHQA 4JSRA 2CF6A 5EMMA 4IZIA 1E2BA 2PGXA 1DBIA 1IVYA 1JIUA 4CT4B 3BH7A 4N7MA 5IKXA 1H8HD 4H6VA 1U0FA 2WFZA 4X63A 3SXJA 2Z8XA 1ZR2A 2X6QA 1SFRA 2W6JA 1AQYA 3LSYA 1ZU5A 2FHSA 2P4HX 3G8BA 5IT0A 1CY4A 2W6ZA 1YB2A 3K2QA 4XUDA 2HK8A 2VPWA 5DJ5A 1KHHA 1V1RA 2JIPA 3ZHZA 5DEIA 1OYYA 1CDDA 4PLTA 3OCCA 3KQKA 3P71T 3ZGVA 3U17A 3MA0A 1WCV1 4QQKA 4R8LA 1ZRSA 4GOKA 1CCWA 3UBTA 4GXTA 5FI5A 2CVQA 3KDAA 4EG3A 4KWEA 3T7TA 1ZM9A 3UJAA 1SUEA 2J5QA 5H1YA 4BZXA 3R74A 5ED4A 2AQIA 4BIMA 5KNCA 1NVUQ 1RSZA 4QBTA 4JVNA 2XYRA 3BK2A 1JEQA 3KUKA 3BE8A 5CB4A 2QQ5A 1LW7A 4YAOA 3LWZA 1DIAA 1HK7A 5LDDC 2YJ3A 2LDXA 1FA9A 1X7DA 3MWKA 4G85A 3U1VA 5D5QA 3VHXB 1P2TA 1ECCA 3KQTA 1ZCAA 3HNPA 3VR6H 4HAUA 1P1IA 1JAXA 4HDRA 3HJBA 2FV8A 5AMXA 3UJ9A 5FP0A 1X7ZA 1YBAA 2RSLA 1ODLA 2W4MA 3FLEA 1SGWA 2I7CA 3U5ZB 4HN2A 1ZGHA 3H83A 3I4LA 4CR6A 2OY0A 1AA6A 2BMAA 3KOYA 1P5JA 5LDGA 4HD8A 4MSUA 4IG9A 4RGYA 3ND6A 2ZIVB 3Q10A 4W9RA 1BG6A 2QORA 4R81A 5LQUA 4D3YA 1QONA 1Q5PA 4OUDA 1PO7A 2XD9A 1TAGA 1NT4A 1VYUA 1JG4A 3B1VA 4Z7QB 2SKDA 3RC8A 3OEEA 1YOBA 3UXYA 3F4LA 1TO2E 2FZCA 2ZBGA 3ZHXA 2ERCA 3T1YB 4M99A 4ZCTA 3I9NA 3IPRA 4JENA 4B0OA 1MVLA 1RRFA 2W9XA 3JQ7A 3H8JA 4OI0A 3ZDZB 3U09A 2CKMA 2WSYB 3LG2A 1M1YE 5AXCA 4R6XA 1VLHA 3CUVA 2HX1A 2HDNB 1UP7A 3PGJA 1BD4A 1HPLA 2JLQA 3QEOA 4GPZA 4WA8A 4N49A 3UCXA 1KWGA 2YZGA 1WCIA 4YDHB 3HA7A 4L7VA 2GO7A 4B80A 3CRRA 4CODB 1FW8A 2C31A 1UBKS 2ZWPA 4IPTA 1YB6A 2COEA 2VO1A 4NHOA 4S1NA 4B6SA 5JD5A 4D26A 4INZA 4RVCA 2ZETA 4RZHA 4GC9A 3TOVA 4G81A 3S28A 4Z4CA 2ZROA 1OB2A 2HMWA 3NALA 3C39A 4B44A 5JAHA 1E9SA 3U3MA 3I9FA 2P79A 4OQPA 4FVTA 5LZ5A 3RYFA 4EGJA 4F0JA 2VDPB 2FK7A 1CUUA 2RHBA 1UBMS 2AN5A 2BKEA 3KV3O 2YWBA 3IA2A 4FFNA 5A62A 4GL2A 2NXEA 1P1HA 1WETA 1M2NA 2E87A 2J3QA 3FKQA 3ZUGA 5EHZA 3VYVA 3VKGA 3VSBA 4E15A 1GGFA 4PCUA 4N0QA 4Q7QA 3G82C 2BMJA 2EWWA 2YUTA 3ANYB 4Y6PA 5BN1A 1GGMA 5K20A 4J4HA 2Q41A 1SKYB 5C8YA 1RXEA 3L3BA 4DOMA 5JXWA 1FP6A 2F90A 2XUDA 4XYEA 1RWXA 1W9MA 4YRDA 3T5TA 4A5SA 1POXA 1KEKA 4PRZA 1X7WA 3KCNA 3O94A 4MQ6A 2WQ7A 1R5BA 4FMDF 3K6SA 1P7WA 5JH7B 2HF7A 4KYIB 2J3KA 3NIWA 4DSNA 1NOIA 1V6CA 5FBHA 1C8LA 4TXLA 2DP4E 2F48A 5T4FA 5E3HA 2ANCA 1E18A 1Y98A 2E37A 2ASEA 3BQNB 4MAMA 1M8GA 4QDKA 3TCXB 1WLYA 1YZFA 3CC8A 4LY0A 4P22A 5TMPA 3I3OA 3MW8A 2X0JA 3E48A 5F1KA 4ZZ1A 1YL6A 3AEXA 3M6MD 3ORFA 4P38A 4URZR 4DCTA 4K40A 3WE7A 4C5AA 4WGGA 4CM4A 4IDFA 5EP3A 4C3VA 1CBUA 4PAMA 4Z4FA 1PRYA 4E5MA 2UYQA 2QQFA 1O5OA 3ADDA 1PNVA 2SKEA 4NG4A 2CW5A 4Q05A 4AN4A 3CB4A 5AM2A 4YMTA 3WB0A 4FHGA 4BGUA 4ERNA 1BCSA 2X3UA 3LUCA 3TZ6A 4TKVB 4BEWA 2OCKA 3KSRA 2FPLA 4B6EA 1H42A 2O6LA 4CV0A 4YRGA 1T9CA 3NAZA 1KI3A 1GV1A 4Z0NA 1I36A 1YQQA 4RDIA 6PFKA 1NHGA 1SM4A 3U37A 4Y6OA 2TMYA 4BJ5A 3EYAA 4ZI2A 4XX0B 4ZYWA 3EBOA 5AVWA 1UQTA 3GLHB 1PTKA 2VK1A 3IXQA 2JFXA 3ABSB 4XE5A 3GO4A 3IVGA 3DMPA 5EXEA 2A0WA 4QPDA 3A37A 4H18A 2CNWA 1VB3A 1Q0UA 1E2DA 1WXGA 1X1DA 3C6MA 3KKEA 4N40A 1NV8A 4RZSA 5J43A 1UQRA 1L7BA 2HSEA 4FFPA 4ZARA 2ZZNA 4LRYA 1II8B 2V7UA 5E7JA 3EULA 5KWIA 2DR3A 4Y2VA 10MHA 2FMHA 4JC8A 2IXTA 3R3XA 3B82A 2DUUA 1TK3A 2BMEA 4BBPA 5KVQA 4JI6B 4CM6A 1YOVB 3U5TA 4P0PB 1RHQA 4JOCA 4Q21A 1JHDA 1UFVA 4TZ6A 1B1CA 1N2ZA 1EX1A 1QYVA 4KQIA 1CZLA 2YIMA 3NETA 3GVIA 1AJEA 3VNAA 1R3DA 1RVDA 2UVQA 1DEHA 3DDZX 4Y2XA 2P9CA 1F20A 4PR0A 1DRWA 1XO1A 2JLYA 1M5RA 2MCFA 5JLJA 1INLA 4E11A 1E4EA 3FM9A 5DNYB 2G1KA 1A8UA 3EY9A 4TQAA 1S96A 1GG9A 4BC0A 3QI2A 4E3ZA 5JSQA 5CD1A 3QY9A 1JFSA 1MG0A 2AEFA 3H4TA 4CE6A 5LP6B 4QT4A 4QFMA 1UZNA 2YXNA 4AJJA 2R1VB 3ETHA 4QSMA 4FOTA 3AF6A 4CIAA 1W48A 2G4CA 2M6SA 2GZSA 1PU2A 2XNDA 2WIGA 4KLNA 4RSHA 1HSOA 1APBA 1EPUA 2PR2A 4HDSB 3U6KA 1AKWA 2WJZB 3ENWA 4NONA 4NFLA 2GBPA 4EF4A 2GJAA 4XDGA 3P0JA 1T8PA 4QPJC 1HE8B 4I7EA 5DHRA 1VSUA 3DE2X 5DTJA 5JATA 1KKMA 4OHVA 1C3OB 3GQVA 2C4UA 2P3LA 1L9KA 4CM8B 2PZBA 3CNLA 1G0NA 3KFLA 4W5WA 3NHZA 4OXIA 2RI0A 2P2NA 3RKUA 5JJBA 4ARCA 3AY7A 2XTZA 4WCDA 1FP7A 5JI3E 4M46A 1XEXA 2EF0A 1BQEA 1QAMA 1Z15A 1VKOA 3BH6A 3PWZA 4C6SA 1YBVA 1XT6A 1RMQA 4A2CA 1F14A 2G9NA 4KR0A 3I9LA 5HK9A 4O4LF 3BT7A 2ODEA 5EGSA 3NBFA 4BLOA 1LS6A 3TRFA 1SXPA 4C88A 3QPVA 1E7MA 2FQWA 2Z2XA 2BGLA 3KJQA 3L0DA 5D3KA 4R9UC 3Q85A 3R0QA 4GSLA 3V32A 2AMJA 4CEJB 1HY3A 4Q1AA 1L5MA 1QO9A 1GPYA 1VSQA 3DBRA 3KQNA 5IUNC 1G8HA 3O4JA 4HLQB 3GHYA 2EW1A 3ZBQA 1YRBA 4DHEA 2C5FA 5JFGA 3IMEA 3CX4A 3CVYA 1NR7A 1V2GA 1EK2A 3GA7A 2C8LA 1V96A 3H9UA 3EGOA 3OJ0A 5KCZA 2A5JA 2HD4A 3INNA 4OLBA 3HU5A 2WKQA 3L1KA 1T5OA 4XA8A 2B1IA 5K3CA 3TKYA 2YZKA 1Z2DA 1PFYA 4QUJA 4GMGA 4XCVA 3QHAA 1CP3A 1E6MA 1GO2A 1E2NA 1ZN8A 1TKBA 3EOBI 1CZKA 3GUYA 2BGRA 1PCXA 2WFMA 4IG4A 4YAUA 2DLCX 3AL3A 3M34A 4D9KA 4JXKA 3Q6IA 5HDBB 1N5KA 1ODIA 3M3HA 2E5FA 4G0UA 3DTVB 4D2IA 4B7CA 1RKVA 1XZAA 3HKDB 5I4KA 1TCUA 3NT5A 3R20A 4X3PA 2Z6UA 4L50A 4BE7B 3G2MA 2I6SA 3NUGA 3O4GA 2UVPA 4HEJA 1FB5A 1KY4A 5CHEA 5BT9A 5BQFA 2J0QA 1EXNA 1ZN9A 1V1MB 4L73A 3NWJA 1FSGA 4L78A 1PJ2A 1KERA 6AT1A 3Q3EA 2H1SA 3O5AA 4PIVA 1L3CA 5JO9A 1IXRC 2RK3A 1R00A 1ULSA 3RTDA 2C95A 3SHTA 1FVFA 3KAJA 4GL4A 4G5QA 4ZIRA 4ZT7A 2DVMA 4FHDA 3BKXA 3MWEB 1SPBS 2VHUA 4KQGA 5L7YA 4YUXA 2BTOA 5IRCD 4H17A 3EZ9A 4U8HA 4M88A 1ISIA 1P74A 3MJTA 4URVR 2YYAA 3KU4A 2X1MA 3D31A 4RGQA 3L4JA 3OIGA 1HT1E 4C6RA 3DMHA 1GGJA 3EPHA 5DH9A 2CVPA 2ZSEA 2C2GA 4ZEOA 2B82A 1PJSA 4A3SA 5J63A 2XRZA 5DWQA 3K9NA 4HFNA 4RX1A 1JFRA 1MB2A 2PUVA 4ZI3A 5EIFA 1JI3A 4LXTA 1E1MA 2QN3A 4HWTA 5KTYA 1G5HA 1N75A 2IEYA 1B4DA 4KQ6A 1OH8A 1IH8A 1NP6A 3B9QA 1EFVA 1C5KA 3HK2A 2JLCA 2NLOA 2X6RA 4QQNA 4JP5A 1KMIY 4ZVQA 3HACA 3E0QA 2AT1A 2B1GA 4I6JA 4MB0A 4O4LA 2BBTA 1P9NA 1P8JA 2R68A 4MS1A 1DV2A 4DNXA 4FFBB 2GETA 1ZI6A 3F5FA 3QPCA 3L7MA 5AW9A 4KHZA 2RGDA 2OA0A 3N70A 4JAVC 2VCEA 3W2IA 2B7BA 2ZBRA 3DWFA 1PJCA 4R8RA 3OF2A 1BHQ1 5IYZA 1PKXA 1E1RD 4OKIA 2YXEA 1US8B 3QWHA 3ZW8A 4QNNA 2O59A 3L84A 3ZDQA 1K88A 3V97A 2Y1XA 1L0BA 1DWPA 3AR8A 4KGXA 1I3CA 2CD7A 4GWKA 3FJ1A 1WBBA 2WILA 2P2SA 4TYQA 4WRRA 3D1JA 4HDQB 3IVRA 1GKLA 3DKIA 3MSCA 1BVRA 4BLWA 2H7CA 4OAOA 3Q8LA 4TXJA 3L82B 4YDQA 1UWCA 1YV9A 3PJGA 4MGEA 3H2GA 4RWZA 2Q5IA 4EKNB 1N2EA 1PLLA 5JSZA 3G7NA 3AVVA 2JVKA 2QMZA 3O2NA 5AH0A 3LQ1A 4PTYA 3ZNNA 1QU3A 3ZBUA 1QGAA 2WNSA 3V1NA 1GNRA 4P84A 1FFHA 1K5GA 4DR6B 5KNCH 5FH9A 1Z08A 3C5HA 2ZSBA 3PC4A 4DIKA 4HAOA 2I3GA 4AIRA 4BLTA 3SFTA 3HRIA 3V7WA 5HQJA 2NP7A 1J7KA 1B15A 4FYVA 2JGNA 4F84A 1JXQA 5JZMA 4AZVA 1IB0A 2XMDA 2LKDA 2O3QA 1XRNA 4DDWA 3TPZA 2ERXA 4TQGA 2HN9A 1QBGA 2DY0A 2EFJA 5EQTA 4N0DA 4N8EA 3TD9A 5ALIA 1UM9A 5BQOA 5CDTA 3J7TA 3CG0A 1JLMA 2M98A 4E1VA 5GY7A 4L5YA 3RS2A 1EZZA 4CVNA 2PQ2A 3S70A 4B4OA 4ZYTA 5KTOA 1T9AA 1F6BA 2KE5A 3GCWA 4EJSC 2WJ4A 2JAOA 3BGIA 4L4ZA 3R0VA 4UBLA 4HHEA 3G0BA 1PKEA 1QX4A 4PLFA 1Z8HA 2AUNA 4KH1A 3FWHA 3U4HA 5T6MA 4O1HA 1NMEA 1ZCZA 4BJ3A 1TADA 3T95A 1Y1KE 4ALJA 3ZLBA 2AI2A 3V8PA 3VH4A 1X39A 4Y67A 3TLZA 4PAOA 1RYFA 5FBRB 2IITA 4KQ9A 1TF5A 4ZZ2A 3INYA 4XOUA 3TVTA 2C98A 2VT2A 2FWRA 1ADBA 3ZLVA 2PJZA 3NIFB 1XYVA 1XDZA 2AYZA 3VZCA 1VFNA 1J1ZA 4PZAA 3PDHA 3NFRA 3KZOA 3NHLA 3LT0A 4ZOLB 2EDAA 3AHHA 4MP3A 2XNSA 3D6AA 1PFWA 3STYA 2A4KA 3EZ7A 3AUXA 3PDJA 3TJRA 1LLCA 2QTFA 5LBTA 2AI3A 4RF3A 3LVRE 1EWQA 2DPLA 4JJ8A 4OGFA 5JDIC 2C2MA 2XHZA 4P5PA 2WJWA 3S2ZA 1C1HA 1JQ5A 1BN7A 4TKZA 1OLXA 1OX6A 3PR1A 5DHQA 3JAMA 3ZU4A 4DJDC 3MWJA 5AM4A 4BO9A 2D6FA 4DE5A 5EUMA 2ZRCA 5F7ZA 3UQYS 4QGGA 4DMCA 4YJDA 3ZH2A 1D2EA 2WABA 1J5XA 1PW7A 2Y0BA 2F7SA 4Y1FA 1L7AA 2CMHA 3TLJA 2HRDA 1O3YA 4D02A 4J7AA 3AFGA 1E2FA 1ZJ6A 3PQ2A 4I81A 2B9EA 3PRYA 3B3QA 1L5GB 4PHGA 1EFPA 4V2IA 1DJOA 3V4ZA 5TF0A 1N77A 2XRMA 1M1ZA 2OO7A 4G8DA 3LZ6A 1JR3D 4DYVA 3T5CA 4JBGA 5DCYA 5KUTA 3I1IA 3WICA 3OTGA 4DV0B 3GRYA 1LV8A 2X0EA 3UMRA 3Q3IA 1T1GA 1FZQA 3RAJA 4ESVA 2Y05A 1B76A 3ESBA 4FDUA 1SC6A 1KFCB 1XLTC 5PGMA 4CFSA 1HQYE 1F9AA 2NZVG 4G5YA 4YMLA 2O0HA 1PJBA 2RJOA 3HWX1 4F9FA 4B6RA 1MQAA 4D6XA 4DG9A 3I2JA 4NCXA 4JR1A 4CQLB 4F9EA 4YT8A 1PQPA 3QM1A 1IG0A 4WT7A 2OG1A 2Z09A 3I58A 2H1WA 521PA 4G9GA 4XRGA 1Y9ZA 2PX0A 3CURA 1YO6A 2ZIGA 1AT1A 3FVQA 3HCDA 5CX1A 4ZDKA 4MYRA 1OAAA 5JJLA 1K27A 2PK3A 4UU0A 3AEQB 1U1GA 1CY2A 4XM2A 3UOWA 1LPMA 4QAQA 1WQ4A 4PXAA 3TZHA 3QX3A 4IINA 1QIMA 4K86A 1Q0LA 3BEOA 3NAQA 3NBXX 4MB2A 4ZOBA 3TSCA 2VF2A 1W0JD 1WW2A 2INGX 3BMXA 1WZ2A 1KJQA 1QR6A 1RNLA 3SOPA 1TM5E 1J6UA 1OJ7A 1VJ5A 4CMEA 5IS2A 3S3TA 2VAXA 4OMCA 4CQJA 2LVBA 4R1NA 4RIEA 1FEZA 3V7FA 3WHLA 1R0ZA 2OD9A 3CJQA 1BXZA 4KAFA 1GGEA 5AK0A 4JEMA 3R8FA 4O2AB 4Y1GA 3PHLA 1HWYA 4M53A 1T24A 3GJ3A 5ALQA 4DBZA 4HNTA 2QZ4A 3R5JA 3T54A 5ADHA 3RYCA 1QYDA 2ZSHA 5DGTA 2XJ4A 1BKYA 4I4TF 3PQEA 3WLIA 5CDSA 3BC1A 3TMKA 3W2HA 2V7PA 2Q4RA 5JDIA 1N1MA 2GCPA 5BV8A 1OLSA 1IPEA 1AQNA 1O6ZA 4I36A 1X86B 1NRJB 5CH5A 1EYZA 3EIFA 4XZ3A 3G5LA 1VLZA 4BU0A 2FEPA 2FZGA 4NU5A 4E08A 1NIJA 2VDUE 1EDOA 1R0RE 3JYNA 2DBVO 4MK4A 5F3RA 1FVOA 1QCCA 3CX8A 3EVAA 2UYYA 1OHHA 3N0RA 3NYIA 4NAVA 1Y33E 3VVBA 4KQFA 3EWSA 5KNBD 1A5AB 2DWCA 1N2CB 3E05A 3FDZB 2B8JA 5CNIA 4EDHA 1I7SB 3D3KA 3SQXA 3A3NA 1E8NA 1H3NA 3QBDA 5L7TA 2PS9A 4WFJA 4DV5B 2X86A 4JKOA 2FR0A 2C96A 3JWPA 5DXFA 1HG1A 5T8KC 1LSOA 3OZFA 1HBJA 2EG5A 2PMCA 3G9TA 1N1GA 3GEIA 3DBVO 2VZ8A 3OQJA 4K88A 1NF8A 1XLTA 3WOVA 2AC4A 3N87A 4IJQA 4I99A 4RLFA 4DV2B 1MF7A 1AXRA 2W2LA 2PX8A 4DEYA 5I7UA 1GT91 4WECA 1T3SA 5LWQA 1YR2A 1STOA 2PBRA 3NDPA 3ND9A 4V0RA 3SSAA 5DCLA 3O7MA 1KFEB 1I3MA 4YAGA 1P4SA 4YP7A 5K05A 2WAOA 3Q2IA 3GPBA 3WNVA 4QM7A 2HM7A 4O1MA 4F11A 2ZCVA 3HV0A 4AY5A 5KQSA 4PLHA 1QHXA 2D62A 3D9QX 4RPLA 1D2AA 3A1DA 2PS3A 3OUTA 4IRUB 2V65A 2KWIA 2JI6A 1DPGA 1M6EX 4Q9LA 4AY3A 5KWJA 2F9FA 1F4LA 1E3WA 4PHTA 2RHLA 3D7LA 5DRYA 3GFFA 2H7YA 1C4OA 1QVVA 4PGAA 4IUYA 5CEEA 4LKOA 5KYNA 4M76B 3EG9A 4AMVA 4TM8A 3L0OA 3C6BA 5IJ0A 1ZOOA 3JYPA 4TM7A 5JS2A 1NRXA 2G82A 4WCVA 2PO7A 3HGTA 2XE4A 2WNHA 1A8IA 3PNMA 4Z6KA 5IAGA 1MC8A 1E3EA 1QHSA 4Q9KA 4CLXA 3DM9B 5SZKB 4LC0A 4W6QA 1Y63A 1JA1A 1DC6A 1R6BX 1UBCA 1K5HA 3NOOA 1SZDA 2ZB2A 1ULAA 2GZ1A 1OKKA 4I4TA 3MIZA 4PSKA 2W2KB 4Q47A 2DERA 5H59A 2BEUA 1J2UA 4TSFD 4X3CA 5ARCA 2PFSA 4UAJA 5B3LA 4BNVA 5AM5A 4JSTA 2O2HA 4YP5A 1E60A 1JSCA 3KQSA 2IELA 3UKJA 4FE4A 2EBHX 1YUNA 2Z57A 5CJ2A 3QLEA 1N6PA 3LX4A 5BMVF 4EFMA 3QVGB 4CRWB 1R1DA 1T9HA 5CT8A 5KOJB 2EJWA 4LBWA 1SC4A 3FH0A 3B20A 4HQFA 4LHVA 1IZZA 2HRBA 2ZYVX 4L3WA 1BFDA 2VHCA 5ENDA 5ANRB 1JDVA 4RHTA 1NM5A 1HR0B 5LD2C 4V02A 3WV5A 2Q3EA 5T8KA 4GPTA 4CM7A 4JBNA 2H1VA 1ZVMA 1JBQA 1MOSA 4BRSA 1CUHA 1JR4A 1LD3A 2R1TA 2H1IA 1JZQA 3JASA 1JTFA 1JKIA 4DLNA 1XKLA 1RZRA 2EBUA 1RLOA 5K9ZA 1Y7HA 3MAJA 1Y8CA 5BWMA 2QE7D 3BD6A 3QPUA 1V95A 3OBBA 3AP1A 4IHJF 4D96A 4FMBB 4PN7A 3OO1A 2W5UA 1RYZA 1U90A 3SBDA 3SS8A 4V1CI 1W75A 2C29D 1FSPA 3WGJA 1T0UA 3KL4A 3C6YA 4HAIA 1UKVY 4ISCA 4HNQA 5C3UA 3SQMA 1SCQA 4ZCMA 4IFIA 1BQ4A 2FX5A 2VDMB 4XJXA 4Y3UA 1M1YA 1EJBA 2QD3A 3AEUB 4ODIA 3REQB 2ZDGA 3HCCA 2I29A 3RVNA 1QKIA 3CPEA 3DDCA 3LWBA 2RHGB 4U7HA 4C0JA 2DFNA 1ZL0A 5FPKA 4C7VA 1OT5A 1NYTA 3EMBA 5B36A 3ZY6A 1JJVA 1Z7EA 3PYLA 4NFYA 4DANA 2EP7A 3KKZA 4FI3C 5IN4A 2XA9A 3FTEA 3MOSA 2DPYA 2PVCA 1Y1QA 2J3HA 2QSUA 5BR4A 3LXRA 4BNYA 3P45A 3A2LA 1H23A 2P6PA 3MUOA 3IP8A 4FDVA 4GOJA 4KBYA 1N3LA 4ND3A 2H31A 3F7MA 1O77A 4MW2A 2J6HA 2QB5A 4GLBA 4KMOA 4PBSA 4QHSA 3VKVA 1HC7A 4TL9A 5CK5A 3UUFA 4R7TA 4EB3A 4YA6A 1PR5A 3RLIA 1AH2A 4YMVA 4DWWA 1N8KA 4BEJA 4BVFA 4B3GA 1VDZA 3V1LA 5J4KA 4HXYA 2X3FA 1RYMA 3NB0A 4PC7A 3WWZA 1LUAA 2OXRA 1Y37A 2WJPA 2H9AA 3OKPA 5DIZA 2D74A 5EYPA 5BN4B 4U6QA 2MR5A 3UG7A 4D4JA 2XCSB 5FO1A 1EWRA 2HFJA 2O0LA 4GH5A 2QUHA 1E9FA 3TNLA 1AO3A 1BW9B 2A3NA 4PPGA 3CSSA 3LTNC 5H82A 3GV0A 2Z95A 5BMVA 2I62A 3KVNA 1GAWA 5EJFA 1L4MA 2D54A 5CXXA 4ZT2A 2X2FA 1CUSA 3FROA 4PLGA 4MAAA 4U2FA 4XFJA 2FN3A 2I2AA 1UEJA 3H8SA 5DNUA 5LFAA 5EZ5A 1JH8A 1Y82A 3KL2A 1GIAA 5BNTA 3WYAA 1CR4A 1U3VA 4BFVA 2XGGA 4O8ZA 3E22A 3K5HA 1C8VB 1K7SN 1WDTA 2VSQA 2H1CA 1I7PA 1NW4A 3ZLTA 2BC9A 3IUYA 4RNDB 4YJ2F 1EEHA 3UAVA 4RLHA 2WTBA 3OVMA 3MUNA 2YMLA 5HUQA 4WW0A 1D0VA 4R8MA 1ZRHA 5HKOA 2XNCA 5JVDF 1YBFA 3UHAA 4LF4B 1GUAA 3V8EA 5P21A 3UYLA 2QRVA 4NU8X 1OWOA 3KB6A 1AGXA 2BFNA 2QF7A 2Z8YM 4J07A 5INTA 3STHA 3N86A 2PBFA 5M29A 1WAMA 1I4EB 2VBFA 1J2YA 2XECA 1KPIA 1QF6A 2MSEB 3L6OO 1XYGA 1WM1A 1P7VA 2PSEA 4PY2A 2P4SA 3E9EA 2M9MA 3QKUA 3MGCA 4EEXA 2Z9BA 3B7PA 3RIHA 3V1MA 1T6NA 1GLGA 1WWKA 2BAGA 2FJ0A 1N3YA 4O5OA 4YFVA 4BNWA 4EUHA 2PT9A 5GTDA 1Q0TA 2D0IA 3GLHE 5K3FB 1L3IA 1YDFA 2C3PA 1Z8FA 1PEDA 4B75A 1N6KA 1PL6A 2C94A 4M0DA 3U3RA 2KBFA 3IBYA 5HE8A 4AO8A 5LIRA 2WJJA 3BGSA 4MARA 4K9LA 2A8YA 2Q6TA 3LSTA 4GRIA 4FQ7A 5DWVA 1KIAA 2IYZA 4UVDA 1JWBB 4GWGA 3DOJA 5C8ZA 3L7BA 1P73A 4WAUA 5SYNA 4DTIA 1YZLA 1J00A 3F6RA 1EGVB 3PE3A 4KLAA 4OM7A 4ZRDA 3O38A 1NQUA 2LCIA 5MF6A 4QOEA 4RXUA 2BW0A 4GS5A 1BDHA 3IODA 2AWOA 2I9PA 3A4IA 4OHXA 3UWSA 2DTDA 4LV8B 4QYSA 1CY0A 5HZHA 3MXTA 1HNXB 3KEMA 3BJRA 3VU1A 3ZY5A 4JX9A 4R4JA 3Q72A 3QI7A 5F35A 1BSVA 3AR2A 5JR3A 3KXPA 1HA3A 1E5XA 3H5WA 1YR7A 4JNKA 1M5UA 4ZTUB 3OE7A 5F1YA 3OLXA 5HS4A 2WLSA 1A97A 1KEEA 3E18A 2FNAA 4N41A 1C3LA 1E1YA 3K6RA 2YC2C 2I6XA 3NTOA 4N48A 3AUAA 4NDZA 3U4IA 1Q83A 4F3KA 2W0MA 3HRKA 4N3AA 2ECPA 4R71A 1GZ3A 3GLQA 2XMRA 5J47A 4KR7A 2B2CA 2EG9A 1M3SA 4L0DA 4TLMB 5AHRA 4G4GA 1GPAA 1WKBA 1ARZA 4O59O 3RAPR 4I5IA 3RIEA 3YASA 1NXSA 4CLDA 1B8PA 1UM8A 4RTNA 4XWOA 1TZMA 1AKRA 3QEMB 1EAMA 2P8JA 3OPQA 5EHQA 2I6FA 1QOQB 4JJ6A 4MIEA 2G67A 2WD8A 2ZTMA 1BRMA 2PKCA 5JVDA 1HNNA 3LHDA 1S2DA 2PA3A 3P2EA 5ICFA 3W79A 4MW9A 2O8CB 2IYPA 1FQWA 1A7KA 3W4KA 3WZMA 5HX7A 2PRKA 1MDFA 5HQ3A 3CR7A 3IPCA 3SZOA 4YJGA 5LOVA 2QN8A 4CHTA 4CEHB 4HXGA 1KE1A 4DDUA 1GTZA 1RLJA 1Z5NA 3UOAB 3E53A 4FJ1A 2CJWA 4R9VA 2GN1A 3R5SA 1ZK4A 1Y5MA 3CEHA 3WSTA 2IYRA 3MTEA 1DJLA 3PNKA 2B4QA 1Y9EA 4MR9B 5K0LA 4EZBA 1EWTA 2PT5A 4Q0MA 4LE2A 2IUSA 3D3QA 1WO8A 2O2DA 1P4JA 2CMDA 3QMWA 4F1KA 4LUCA 1RC0A 5B6PA 1TOAA 2DCUA 3C7KA 5I3CA 3W6OA 3MQ4A 4ALIA 2BSQA 1OJLA 1ORIA 3NIGB 1R15A 2CN1A 4ZDIA 4UVEA 4RK4A 5ENZA 4TV9B 1XN1A 2VJOA 4PAQA 2I6UA 5D6NA 3TFOA 2JIBA 5F9FA 1PJZA 1ZUNB 1CIPA 3T1TA 4GOXA 3R9KA 4D41A 5E1DA 3NH9A 5F1PA 2EHJA 4OKSA 1IQUA 2DWOA 3A1VA 1XI2A 3ULKA 2O7VA 4C7JA 1JIIA 1QK3A 3WNBA 2YWCA 3RSQA 3PRKE 2HHLA 3AHIA 4UHBA 4D5GA 3HYRA 1KYYA 1ZLYA 1USUA 3H5VA 3KYCA 2NU9A 2FWPA 3CR3C 1MAVA 3ANNA 3DZ8A 3KV1A 1IYZA 3B6EA 5KZMB 3B6JA 4DLAA 1THZA 1JDUA 4E88A 3GPIA 1VJCA 2CBXA 2VAWA 3KKKA 3QPWA 4ROSA 4E5UA 1SD1A 3IEVA 3GLFB 1H1LB 1P44A 2B94A 2NSHA 2OORC 2FWAA 2QZPA 3AGPA 3HLKA 1UXOA 3RR2A 2IVFA 4CGYA 5CLQA 1EJ0A 1GNPA 1NW8A 2TMGA 4H59A 2LW7A 1QE0A 2FW9A 5CAEB 1L5WA 2B36A 1FYEA 3GJ0A 3K1ZA 4FGUA 2WMOB 3PR3A 2JFQA 4MV1A 3SZMA 3VU9A 2ZM6B 1GZSA 2G80A 3ZWNA 4YV0A 1NQXA 1VHWA 4UNPA 2ODNA 1DAOA 4WE3A 4ADSG 4AJLA 5EHXA 1CY8A 2MTBA 5AR1A 5HTOA 2F17A 4HYEA 3JQAA 1TYAE 3L0IB 3NTUA 3OF3A 3KJEA 2WWYA 4JQOA 3R23A 1DTSA 4G0MA 5J2TF 3GUUA 2F8LA 2GJSA 1JIXA 2OZEA 3Q7RA 4XWAA 3TYXA 1JEAA 3JQ9C 2PMKA 3M82A 3QFHA 2QLNA 4RVGA 4QGSA 3FPSA 1D6JA 4KXWA 3EDYA 1G66A 4B76A 3Q40A 2FQ1A 2M32A 1FYXA 1XXLA 3BB1A 1TUBB 2WTNA 2XT0A 1MQSA 3RRFA 3WLMA 3O75A 1XN4A 4EL5A 4CETA 5FJIA 3MJCA 1RMTA 4L75A 1FLAA 1ZHHA 3KUDA 4J91A 4HGRA 3DV9A 1U63A 1TECE 5IVKA 2MR6A 2QVCA 4UTXA 3BFXA 4KUEA 4WADA 5JAQA 3PYMA 1D0IA 2VRCA 1H5NA 4M0FA 4OXRA 2JJ1D 2MU1A 3W3AA 4U1RA 3WFJA 3D8SA 4II2A 3P26A 3O2SB 1IDN1 5KI6A 5JSHA 2OR3A 4Z4HA 3NBAA 3HBAA 3RFFA 1W6UA 3UT0A 2E49A 4L4RA 3ZKAA 5BPHA 4DBLE 3QITA 1QFZA 1Z6TA 2WM8A 2QNBA 5J5VA 1ULTA 1V48A 4MUYA 2QLJA 1UKBA 3HEBA 4RXTA 1Q1BA 4J6EA 5TX7A 1BN6A 4P2BA 4WESA 1Z17A 1WZNA 1FRZA 3QG5A 4TMVA 5T4HA 1PQUA 3BGVA 3AM5A 5ARBA 3T15A 1G8MA 4FW9A 5C4GB 1N7JA 1QVRA 4P4NA 4UTVA 3NUQA 4UCXA 5CCBA 1VI5A 1ZVJA 4GZMA 3TKAA 5JEDA 5KS2A 4FYJA 2JKVA 4YIKA 4KRGA 2JI4A 2GILA 1UCFA 4EG8A 4MKZA 3AKYA 4UZSA 2OORA 1ECFA 3GRPA 3NHRA 4DREA 5ALFA 1C4XA 1U0TA 2HTEA 4OB6A 3PJRA 2EFYA 1NXVA 1RVV1 5FOWA 5BSUA 2P6RA 4YJHB 1KJ9A 1XFDA 3O03A 2VQEB 1V5GA 2B30A 1COWA 3EFHA 3OT5A 3HCPA 1NY5A 2WHQA 3R09A 3ZDCA 2D59A 4U2CA 4M9SA 4OATA 1R4ZA 4DMFA 2ZREA 1ND6A 3SHWA 2CVOA 3GDWA 3MAAC 1PZMA 3LCJA 2Y6VA 1EB9A 2F6RA 3ONNA 4JLOA 3VBEA 4RS4A 4CKYA 5BYKA 3BK7A 5A3RA 1XA4A 3PT9A 4X7PA 1AQLA 2P65A 3HKBA 2JIMA 4Q9IA 2OILA 2P4EA 3L1JA 3N0TA 3NEJA 5ALSA 3SXUB 2VDWB 5B6IA 1SO8A 2A5GA 2QA5A 3R41A 4O2BB 2FZKA 1GPBA 2OAP1 3NW9A 3L1IA 2RKWA 4TWZA 3HP4A 5UKDA 3T1QA 3TM4A 3TR5A 3WRYA 3FGZA 1AS0A 2QEQA 3PUYA 3T3DA 2W6ID 1TL7C 1XTIA 2CDAA 2VYNA 4ZAWA 2BGWA 2CFSA 3VUEA 1RIFA 4KSCA 3E3OA 1U3FA 3BM5A 4IKPA 1W4RA 4K9PA 4HS4A 2LIVA 1MVOA 2TS1A 3K53A 2CJXA 4BP9A 5ESDA 1CETA 2QMOA 1NPYA 2OM6A 3QOXA 3WYCA 4K26A 3R44A 2XW6A 2VUTA 4BUCA 1KVRA 1JQEA 4LBYA 1GR1A 3NTRA 3QZUA 4BVKA 1QIHA 4DIUA 3CF4G 4HWKA 4KKXB 3S27A 1EK1A 5IDXA 2G6TA 4Y1RA 3U4GA 4QDJA 3PL1A 1U80A 1IY9A 4YBRA 3SKXA 3SOZA 1KTVA 2YDXA 1DP4A 1U2GC 2YYSA 1E4OA 1VMKA 3FCEA 3NWEA 4QYTA 5F2EA 4C4TA 4DABA 2I65A 4OJTA 4FZ5A 3IAXA 1XJCA 3USZA 2EBWA 3LC2O 4HH4A 4YAKA 1ODCA 3GGPA 1IL0A 2IQIA 3SF8B 3MJSA 1X8KA 2JJYA 1SD5A 2PSFA 2WC1A 4MH0R 4K87A 4R2MA 5KSYA 1KI7A 1WDWB 1I80A 1XL0A 2J9FB 2XMBA 1E2UA 3Q98A 5B3JC 2OO3A 1L4FA 1NXWA 2XUGA 1WVIA 4R2XA 1AY0A 2ANBA 3PUKA 1LQUA 1DKPA 3C4QA 2IGBA 4RK6A 4XR4A 1MZVA 4RK5A 2R7NA 4DYDA 4E7PA 2DH6A 1PGQA 4Y9DA 3GJXC 3SMQA 5K09A 3UJCA 2FK8A 5DBGA 3U40A 2Q9BA 4DSUA 4UQLA 5F5NA 3M1LA 4U00A 3UQZA 3N2LA 2X76A 5I7OA 4TMZA 5CFZA 1Q3TA 2ONZA 5KNDA 5H68A 2KW5A 3D6JA 3LYUA 1M2HA 2RAVA 4MUKA 5DTQA 4DRZA 2A0XA 3A25A 2O1EA 3FYUC 2O7RA 4JLNA 3UATA 1Y1TA 3ONVA 4X71A 2AWNA 4GWLA 3W2TA 1M6VA 3FWYA 2AZ4A 5EJMA 2RD2A 3E7FA 2OYRA 1CVLA 1N5JA 3HABA 5TPWB 1BDJA 4QELA 1VIAA 1ZHOA 2QROA 2HMYB 3A4LA 3IERA 3PI6A 5CT6A 1Z29A 2P2GA 1KC1A 3GARA 4OL0A 1FX0B 2DBRA 3UB4A 3HSSA 4AXXA 4EW3A 1OI4A 2ARKA 4KN9S 4RIFA 5FPHA 4D9JA 1G59A 3AJ8A 1PG5A 4UU7A 1KEUA 5JAOA 2IDJA 1MJNA 1J0XO 3T7RA 2RGRA 3MNFA 1VBMA 3TG2A 3DWGA 5D7BA 3NO4A 3NOVA 1JHVA 1YVRA 4QYIA 1M6NA 2G40A 3ICCA 3NHPA 1YZHA 5FHQA 4G1FA 1XVTA 2RB4A 4TVOA 5SYMA 1ZLXA 3V42A 3W4JA 4WBSA 2JAWA 2NW6A 4FNAA 3H05A 4ND4A 4Z4EA 3PGA1 2DUWA 3KZKA 4B2LA 1YIDA 3CIFA 3RARA 1Y7PA 1DX4A 2POCA 2GXUA 2MWMA 4MUFA 1YJ5A 3CG4A 1SXJE 1GPWB 1FJ2A 1QRRA 2W6JD 2YCLA 3K0CC 4IJ5A 4L16A 4Q93A 5ALOA 5A5VA 1IAQA 1U2GA 3ROPA 3OURA 4UNIA 1E32A 2C1XA 1SBTA 2ZDHA 721PA 1HE4A 4DM7A 5A0FA 4G5HA 4YT5A 2PUTA 5EPUA 3T5MA 5L51A 1M6HA 4JOQA 4AURA 3D54D 2E4XA 7ADHA 1H4SA 3N2GA 3V9PA 5B3JA 3RRNA 1NSTA 2HBYA 1O03A 2BJHA 1GLVA 4NYIQ 3I05A 4ENTA 2LIPA 2AG6A 3EIEA 2YOGA 1UKYA 1UK8A 3ME5A 3WJ1A 3HB9A 4KQKA 4AXBA 3GRKA 3DO6A 3OCWA 5DI9A 2GAOA 1B0PA 1WSDA 2R6DA 4CCAA 1UDCA 2W4QA 2C5HA 3ET4A 1C9EA 4LXXA 2X6TA 3CZRA 2CF5A 4FIZA 2OOSA 1SCNE 2QDXA 1Y6GA 1E7RA 1LI4A 1ML3A 1RRVA 2R11A 4GMHA 1T0BA 4O0MA 3A1EA 4NFSA 1M2WA 3AVXA 3EXEA 4M0EA 1P3JA 4U9UA 3PEWA 2EX1A 2K2QB 1RJEA 5AKIA 5LLTA 1WXDA 2JD0A 4M0LA 3W2EA 5FPQA 2ZI3A 1T5SA 3TQFA 3CLUD 1OTXA 3NNDA 1J33A 4NBSA 1KEPA 2BE9A 3FYUA 1ZA1A 1WIWA 4F3YA 3ZUPA 4F3NA 1G3MA 2SCUB 5BQXA 1RCTE 3SEAA 4ND2A 5F33A 3RJ5A 1C1YA 4IH4A 5DULA 4XIYA 4F8JA 3O8OA 1OVMA 2VF4X 1BA2A 3WGNA 4C14A 3KLOA 3ZTTA 2O8EB 2G9VA 5CIQA 2QTCA 3SN6A 3V2UA 1UJCA 1DFGA 1SKBA 3A27A 1XBTA 3T9FA 1QU2A 1XPOA 2Q7XA 2XTAA 1XDWA 4BEVA 2BR5A 4NH0A 4G1UC 1DO2A 2P69A 5F2KA 1AUXA 4YBZA 1UDBA 5K0JA 1KWKA 4NCKA 2H51A 3ONWA 4B47A 1I9CA 3O3MB 3V8MA 4HCJA 3FMVA 4RV4A 1BS9A 2CHEA 1E9EA 1EB8A 5FFNA 2XQGA 4BUJA 2C2XA 3DFMA 3FZQA 5D84A 1S2NA 3K0CA 1UFOA 4MWTA 4LX8A 4WOBA 5K3OA 4PNHA 1UJ5A 1H8EA 3QA9A 4X93A 1P45A 4PX9A 2J30A 2YYZA 3RK4A 3DMYA 4MJXA 1R7RA 2PHZA 2VUUA 3SJZA 2SBTA 1F2VA 2CLMB 2I9KA 5JH7F 4TMXA 3CUSA 1QYXA 4I5GA 5FIUA 3VHXA 5HGXA 5MDHA 4ON9A 1EUDB 3F4KA 1FU8A 1ZDMA 4HX5A 4KJXA 5T4BA 5TMDA 1JWLA 5GZ3A 3OLQA 4XIJA 1R8JA 4YMWA 3WWYA 3GXOA 2CL0X 1WABA 1QIGA 1RP7A 2JEOA 1DUIA 2JANA 4XJVA 3W2GA 1KI2A 4WBNB 5EJGA 3BFJA 2GDJA 4KN8A 4OSPA 1BOFA 3NM5A 4J1QA 4B4KA 5KTNA 1KDOA 2FG5A 2FUNB 3B36A 3RJ9A 3WYEA 3LGAA 3ABZA 5GWXA 3U7IA 5JUWA 3CBQA 5AJVB 4GQAA 1EQAA 3QPAA 2G6BA 4EYQA 1GOTA 3QVKA 1ZMBA 3DJYA 1YI0A 5L95A 1YE3A 1U98A 1WOMA 1ZMXA 3B2QA 3W5UA 2G9QA 4BMPB 5LMUB 4GRDA 4XYMA 3W77A 3P0RA 2FEXA 1BJKA 3ZCPA 4MWCA 4FNGA 1U0NA 3ZQJA 3OTIA 3FGPA 3B5IA 4B31A 1IFXA 2BHNA 2V54A 4OK6A 2ZVJA 1FX1A 5AIBA 2DT8A 2OCBA 1D8AA 4WK0B 2DUNA 3KBOA 2FMFA 5ULLA 5AW8A 4GI2A 4IO1A 2FWJA 5IN5A 2IEDA 2YQ4A 5M2QA 2PX3A 5JSKA 4XYLA 1AU9A 2P9YA 2J6IA 4HFRA 3VMFA 4BL5A 5ALNA 5K8UA 5KOYA 4P53A 3FNBA 4EK9A 3ID6C 5SICE 4UNRA 3IQWA 4MUMA 1XZHA 3ET5A 1K9VF 1YCFA 1DKRA 1RAEA 4WKPA 3SI7A 3O0TA 1QF9A 1WXIA 3BWXA 3QKWA 2IWRA 1FE8A 1OD6A 4HZGA 4IGEA 1KU0A 3GFVA 3SDBA 1K7EB 1WZEA 1Z33A 4TTPA 4HQLA 3PX3A 1DG1G 4XM0A 3RCBA 1Q21A 4IGAA 4UNNA 5JO0A 4HLUC 1T9GR 3C5EA 3VC3A 4D9NA 3U7RA 1QQ5A 2YW2A 1ETUA 2ZT7A 1IBKB 5EQJB 1W44A 4J43A 1V35A 2Q99A 3N07A 2CE2X 2H48A 5FI0B 1NF3A 4Z2AA 2WLTA 5CB6A 1QH9A 2AG8A 4D4IA 1E5VA 3ERCA 4PYJA 3PQ6A 3DBOB 1T5HX 4HVAA 5FLEX 2JGAA 4DSZA 2I7XA 3FNQA 2AC2A 2E6KA 4MUIA 1SCKA 5JXGA 2CNWD 1B00A 4HKTA 1Z7GA 2RAPA 4BFUA 1EWKA 3EXG1 3S1LA 2QR3A 1LCIA 3MSXA 1YQDA 5JHGB 2GJ9A 4KIUA 5JH7A 4M7WA 2CJFA 1PR2A 2YS6A 4UM9B 4NU0A 4LPSA 4LZOA 1AXGA 3ZD7A 1T3ZA 1T0IA 5L3ZA 3IR5A 5LP6C 3MB8A 3ZWDA 2QW1A 5FUWA 4MVJA 3KYDB 3A04A 2ZI7A 1IU9A 3AY0A 3KR0A 3SX4A 4BU1A 1KY2A 1MT0A 3MQFA 3S81A 2YN0A 1PT8A 2OAQ1 1B74A 1JPNA 1USKA 1N9ZA 2BSAA 3KQYA 4YRLA 4XQ0A 3WNDA 1KHTA 5JS6A 3OP1A 4F6CA 3OMWA 3L02A 1RM4A 2O1XA 2J3JA 4HPJB 1M0TA 4I4NA 1YS2X 1JSXA 2J3MA 4B6GA 4DQUA 2PH7A 4Y6SA 3BIXA 1LZLA 1JG1A 4G65A 2YICA 3IO3A 2JKZA 2VSXA 2BDUA 1ZH8A 3F49S 1T8UA 5LUBA 2QXTA 3KZ1E 2CFTA 5HJ5A 4TKVA 4OJNA 3CVOA 1ZKDA 3EZYA 4MS3B 1NASA 1RAGA 3M6AA 4M9QA 3TX6A 4UHFA 4DIBA 1WUYA 2XNDD 5CJPA 3DBHB 1OYOA 1N5DA 4CR7A 2DWUA 2E89A 4TV8F 3GELA 3IDSA 5DLPA 3H5NA 2ETVA 3RG8A 3VI3B 1U7OA 4XTCS 2IJGX 4NNOA 1KRXA 2EJCA 2LP4Y 4IS3A 1FSSA 1SZPA 4MRVA 4XX0A 4JBWA 2GXAA 3GLHA 4G1MB 3SIRA 1Q1AA 2X77A 4CN9A 1LJ8A 2G83A 4KFSA 5BYJA 1NNUA 1JA0A 1X1BA 1ONSA 1GRQA 3DMNA 4UFNA 1QHYA 5ECYA 1H2YA 3O2QB 1TJ3A 3PC7A 3O47A 2H3HA 3LCVB 3PK0A 4LZPA 2QE6A 1R4MB 4XEUA 4HLUA 4RTMA 1R16A 3LUJA 3U44B 5B37A 1II8A 3QLUC 1BKSB 3DP7A 1GILA 1ZU4A 1P1FA 1WKCA 1X1QA 1PNOA 5CXUA 3K20A 3PGKA 1XFAA 2JGIA 4WN9B 1VI2A 4YACA 4RKRA 2BFPA 3ITNA 4ECEA 2DLDA 3HJTA 1YOVA 2LUOA 4FK8A 4BNFA 4CTJA 4E5DA 2F8TA 4WOPA 5CW1A 4HNHA 4W82A 2FW6A 4X24A 3IXMA 5FWAA 3BMOB 1VTKA 4F3RA 1QTQA 4INPA 5CB0A 1Q77A 3CUTA 5IBQA 4XH9B 1TKAA 4LYFA 3WLEA 1O97C 3OOJA 4MW6A 3KOXA 4CT5A 1E69A 3HGMA 2DCMA 2PD4A 2V7QA 3LT5A 4TWBA 4AM8A 4WKGA 5IZ4A 4QYMA 3R5TA 4DXDA 4X65B 1FMJA 4LISA 4S1OA 1LLUA 1Z5PA 1QG6A 1VGRA 4JR2A 3GFSA 3WQHA 5LP6A 1PUJA 5BVHB 4NRDA 2ZSJA 4JJEA 2F62A 2R1VA 4BFYA 3SYLA 2A94A 4M1MA 2GSDA 1I0IA 1S9HA 1T1JA 4QRHA 5T64A 3IP9A 1SVIA 1W36C 3OIDA 1S01A 3Q9UA 4RCVA 4JT8A 2Q3LA 3THSA 3DO5A 2DHDA 1ZOLA 1XNJA 4HDSA 4D8UA 4K6KA 2ZUSA 4KTVE 5DHFA 4GR5A 2WJIA 1M72A 4GZ3A 1YZ3A 3QFSA 2B21A 4MVCA 4Z3OA 2KYRA 3QUSA 3W5BA 1RAIA 1XQ9A 3QXHA 3JZMA 5I8WA 3FPCA 5JJKA 2XAAA 4YREA 1EZ1A 3MB5A 2PBZA 3ZC3A 4CM8A 3BK1A 3T0GA 1I5OA 1QDLB 4TYYA 1IXSB 3PD0A 2C7QA 1BNCA 5KQLA 4R6WA 4JQSA 4P54A 1AO0A 1AMUA 1TU3A 3PFGA 1E9VA 3BIJA 4JROA 2FMIA 1SUFA 4DEVA 3ZU6A 5K0TA 1BU5A 2YZMA 3JQ8B 1AZTA 1XNGA 4NE7A 2IYWA 4M9UA 4LX0A 4RHCA 3A7DA 4LZLA 4EW6A 3OCUA 4GEGA 2VP5A 2O8DB 1PJ8A 1FNCA 3CQ9A 1A88A 2NTNA 4NQZA 4NYMR 4DQ0A 1KZ1A 2ZYHA 2B6HA 5CNMA 5JCZA 1TYCA 1UJ6A 4PC2A 4H4DA 2ZJAA 3CPJB 5WRFA 4AMZA 5LM3A 1QRSA 2PUWA 3UAYA 1P1RA 1KQFA 2IV3A 1L5VA 3N8NA 1OU0A 4XYGA 1UT8A 1YU6A 3QLUA 4L3OA 2GVZC 4JB3A 2JIZA 3VXKA 2VBIA 5DNAA 1QH1B 3HL0A 3QXCA 4F5ZA 2JFWA 5EPEA 3FFXA 1O7JA 4I1SA 1YU9A 3B7WA 4A6EA 2FE4A 3QSGA 1WUJS 2XKKA 1VB5A 2JS7A 3AT1A 1DFHA 3LQYA 4P7GA 5EKDA 5A4AA 4D9MA 1GKIA 4PZYA 4ZV7A 4MGYR 1HSZA 2IZ0A 2O05A 2R6R1 2FPSA 1TMKA 3DTVA 4WJKB 1NN3A 5BR7A 3HKDA 1IEQA 1O94C 2F2TA 2PGDA 1JJFA 1E66A 3C3CA 3L5KA 4DUYB 3BSYA 1YXMA 2BZ0A 4I1RA 5T3YA 2XQVA 2FRXA 4G86A 2P27A 1HMPA 4PLYA 4S3MA 3THOA 3TQTA 3BRSA 2ECKA 4MITA 4MHSA 3A4NA 3G2NA 4UHKA 1V1MA 3TZKA 1TQ4A 3CNOA 2WAAA 2BFBB 3TH5A 1CY1A 3F3MA 4MCIA 4RM3A 4LDZA 5JMTA 4NPAA 4QYXA 2WB4A 1XTQA 4ALNA 1USWA 1PR6A 3RTBA 2PQMA 3G9QA 3DD1A 3MWEA 4CL8A 1DQRA 1E2IA 3ZD6A 1P8AA 2X7JA 3WJAA 1YNSA 2ZRPA 4Z53A 1YMQA 5ESWA 5FADA 1MAWA 3ZDXB 5AJYA 4IIDA 4MV6A 3T35A 4KMRA 1HGXA 3E9NA 2ODAA 4A8TA 1DNPA 1HF3A 1HLGA 5ELMA 3ZGLA 3GLVA 1ZIYA 3KBBA 1U0OC 2ISQA 1DHRA 3BERA 4XUEA 4UBJA 4MXDA 5EUBA 5FPPA 3WLLA 2LRHA 3OTWA 2Q0SA 1HQDA 4DV6B 3N59A 3SR4A 2BDTA 3QUBA 1PV1A 2K7FA 4PGMA 1GN9A 2QM0A 2YY7A 2CMGA 3KU1A 1BE8A 3LKVA 3QH4A 4IEEA 1V7QA 2Q8PA 5COBA 5THQA 5JCOC 3WL6A 2EZTA 2HLHA 3JPYA 3NCTA 4DG5A 1GQ2A 5IDYA 2FX3A 3W05A 1FFYA 1Z4MA 5G2OA 1SOVA 1R9GA 5I5GA 3KZVA 4G9EA 4OQDA 1UKCA 2WAXA 2P9GA 4EX7A 4FFBA 5JZBA 1SKMA 3FOFC 4JDUA 3LFTA 1X2BA 2F3PA 1OXUA 2Q9CA 3IULA 1NULA 2BMDA 4C3OB 3L7DA 1AMNA 1QOPB 3WDSA 5HILA 1WUKS 1GSOA 3C1UA 2HA5A 4JSYA 3WJ7A 4JC0A 1EUCB 5HKKA 1ABEA 1XSEA 5LIPA 1US8A 5HCUA 2OBBA 3VPCA 3E5RA 4FC7A 1J0BA 5I4IA 3GFOA 2BH9A 3DE6X 2ZKLA 4OX9Y 2NVBA 3B8HA 4R69A 3C6QA 3IQHX 3C5WP 3RPEA 4EF5A 3Q9SA 3BIFA 5K8CA 1S02A 1DAMA 4DV4B 3LBHA 3ZWPA 5JJIA 2GPJA 4N6OA 4DLWA 3E3AA 3GUHA 4F6LA 4QBIA 5DW0A 4NNPA 3EIUA 3GL9A 2W6PA 3ZBPA 3W5AA 2HW8A 1ENOA 5I45A 2WYWA 1MPTA 1RQLA 1ZJ4A 3JYLA 1KZ4A 4D4KA 1SHZA 1FNDA 3EZFA 4EW2A 5IUJC 1H85A 1UKEA 3HR8A 2AK3A 1QWOA 2NPOA 2NU8B 5SV2A 1QTNA 2UZIR 4MO9A 1WMSA 4AQDA 1QG2A 1RYDA 2QUZA 3NUZA 3OHSX 4H3SA 4C05A 4BWFB 5IFLA 1ADYA 3MMPA 5DBEX 4BDTA 1NN5A 1ZBDA 4TLAA 3TQOA 4A8HA 1JI0A 1F7VA 4JCOA 1A4XA 1U3GA 5AJWA 5JMWA 1GTMA 4ZWNA 5C52B 1NQTA 3U19A 2AFIB 3L7NA 4GX5A 4YGXB 3R9WA 3GNQA 3E1KA 2ATXA 3T4EA 5LKRA 1VKRA 3SBEA 1Q92A 5A4DA 1NI3A 1G6HA 3KEFA 2RHJA 5F3DA 3W8DA 5FWNA 4M0UA 5F73A 3DPSA 4YHHB 3QOFA 4LJLA 3VOBA 2EDCA 2IS4A 4TYWA 4F96A 4MA4A 5G4KB 5KX5F 4NJMB 2HJGA 4OI4A 4D9IA 1XUOA 1U6IA 3RT1A 4R68A 4KVFA 3F5SA 3MT0A 5JCOA 4DS3A 2C92A 3HVKA 4HVTA 1KFJB 4U3JB 2JLVA 1IMJA 2ZB4A 4M54A 1GQFA 4JI5B 1TZBA 5CCXA 4ZTZB 2CXSA 1X38A 3COSA 3L79A 1CQJB 3AUYA 1WZUA 3AU9A 4C5CA 4L4UA 3ICWA 3UICA 4UUQA 3U7GA 3K05A 5H80A 5K0CA 2IUEA 1V4BA 1XVVA 3VTAA 2GN2A 2VHYA 3WVNA 3FHTA 1BX3A 3NC1C 4ZOLA 1BDMA 3D8TA 4CM1A 1KTIA 2G5TA 3NX4A 2VDVE 2WSBA 3HXTA 2XGJA 3GLTA 3DKKA 2A0YA 2J7PA 3OJFA 2Q5QA 3F6CA 1RPTA 5D51S 3OZEA 4P5DA 4PPNA 5FBZA 4EI8A 4MDFA 1WXXA 2AG1A 3RGWS 5F7OA 1N7IA 2ZZKA 3WGHA 3HY3A 3JTMA 2D1QA 4REQB 4TRJA 3FRJA 4L9SA 4RVFA 4F1JA 3LC1O 2ZUTA 1EFCA 4JJ7A 4RTLA 3BTVA 2VKQA 1ZCBA 1ZGGA 1CZNA 4R2WA 3FLMA 3W9YA 1KMHB 4YRSA 5KPJA 3GVCA 3V48A 5I4BA 2Q1TA 2J0VA 1GZ7A 4P9NA 1OZHA 1B6RA 3BZBA 5HKLA 1NNEA 3T3MB 5TY0A 2J3DA 3D0RA 4J94A 1XV5A 3FWKA 3LY8A 2IHBA 4G5GA 1YMUA 3AZQA 3WYDA 5LMCA 2H4FA 4QE3A 2CLKB 2FZ4A 3M6WA 2GPSA 4IVNA 3WIBA 5B6JA 3JWHA 4EABA 4W5NA 5CYPA 1V5WA 4B3TB 2ID4A 1GVHA 5IMBA 4TS9A 3RSHA 1PR4A 1YQWA 4YJ3B 3S2EA 1HLFA 4GLLA 1R4NB 3CRVA 2AW5A 2VP9A 4RFSB 5IJAA 2P5UA 5L3QB 4BV8A 4DNPA 2C7RA 4CQLA 1BGVA 2CWWA 2FUKA 1Q12A 3H9QA 1PG2A 3QE0A 1S6YA 4HTAA 5JNUA 1GPUA 3WGTA 4IYRA 4CU5A 4WCFB 4A92A 3DE3X 1YRQA 2BYTA 2XB2A 1PDOA 2BEJA 1QZ3A 3FCAA 4JLPA 4JBIA 4FU0A 1AGRA 3KJNA 4QXPA 1NVEA 1K63A 2DG2A 2RBEA 3LCUA 4HTFB 4IXWA 3QIAA 4LECA 2HUPA 4RW0A 2OD7A 5AVZA 2ZR9A 2YV3A 3DZKA 4E51A 3GPLA 4DDMA 5B2FA 2VBGA 3EDQA 3SJBA 3TBFA 4EHAA 2F1RA 2HO4A 2W2LD 2H2FA 5TPZA 2WTXA 4BS9A 3ZW9A 5JBQA 3Q11A 1IQRA 2R62A 3ASYA 3A6JA 5DM4A 3RSOA 1JFVA 3GNTA 1E7YA 2A5DA 3OZUA 5CYOA 2XUPA 1MNAA 2XCOA 4QTUB 1D07A 5CEFA 4O2AA 2PX6A 4LBVA 4IIFA 5EUCA 2C77A 3BJIC 2OHXA 3TLMA 1TZKA 3UV7A 3ZK9A 1ZCFA 3SSNA 4CLRB 1W4AA 3C41J 1DRKA 4OHCA 4JBXA 4C29A 5JFTA 4AY6A 4N03A 3K09C 1I51A 1P2VA 2ZJYA 3PUWA 4S1PA 3SQLA 1LPPA 1CUZA 4LRSB 1OIWA 1Y9JA 3VR2A 4B85A 1TCBA 4EI9A 2KHZA 3W5HA 4BVHA 4Q9HA 4AD8A 1HKHA 3Q2OA 2ZAMA 1SXJA 1NW9B 4K5QA 1DIRA 1JDJA 1G9TA 1YS7A 2A9RA 2C3UA 3GRVA 1OYWA 3NAGA 3Q0EA 3W7BA