2PX6A

Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
253
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQPTHNSLFLFDGSPTYAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Thioesterase domain
publication title Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 2px6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2px6A01
4A23A 2B4KA 3FBWA 2WHQA 3OOSA 4HVTA 5EGNA 5HF5A 3MGAA 2WHPB 2HA7A 5EHZA 4X00A 3G0CA 3ZLUA 1XKLA 5ESRA 3RM3A 2Y6VA 2BUCA 3E4DA 4N5HX 4U2EA 4BVKA 4H7EA 2VF2A 3SK0A 2WU3A 4LYEA 3ESCA 2DHDA 4X71A 2HA3A 5J3JA 4YASA 4CFSA 3AILA 2WJ3A 2RONA 4DM7A 2I3ZA 4QWMA 1ZGBA 3ILSA 4C87A 4LXGA 2WIJA 3H1AA 1HLGA 2VT7A 1G42A 1GPLA 1R50A 3PE6A 1AC5A 1T4MA 3FLEA 4KR0A 2QM0A 4FOLA 5HZGA 4UHHA 1CUHA 3PFCA 1YSCA 5A7HA 4KAAA 3WL8A 1XRRA 2AJCA 1NU8A 1QLWA 1XZGA 1K63A 2V98A 2PSHA 2XUAA 1QONA 5CRIA 2WILA 2P8SA 2XMRA 2VAVA 2ONCA 1CRLA 5AI4A 5AK3A 1SOMA 2XQKA 1QTIA 3VXKA 4B82A 3WYDA 1CUWA 4GI1A 4MQMA 4LXIA 4P08A 2FX5A 2VJAA 5JIBA 3QZUA 4BE9A 3QPCA 2UZ0A 3ANTA 5AM3A 4PSUA 5E4JA 2XUIA 3KXPA 3UUEA 4AZ3A 3AFIA 5HQ3A 4MQLA 3VKFA 3L1HA 2W22A 1CV2A 4GECA 3NWOA 2VJCA 3OC0A 4QNNA 1SFRA 4BCDA 2PU7A 3IB3A 1E8MA 3GROA 4CCYB 4L0CA 3QPDA 1QIFA 1T2NA 2B9VA 3G7NA 4CI9A 2XUQA 1XRMA 5ALHA 1CFJA 4WFIA 1QOZA 3B3QA 3V9AA 3C6BA 5EIHA 2VA9A 1WB4A 4J0DA 4BDTA 3G9TA 4B6GA 2HL6A 3U0VA 4UUQA 1N5MA 5HK8A 1DT3A 3W06A 3ICWA 5DNWA 2VJBA 1XQXA 4AO8A 3KWFA 1VZ3A 1R4ZA 1GPKA 5ALIA 1CQWA 4M0MA 5AICA 2IX9A 4MWSA 4X6XA 4A16A 2BAGA 1R88A 2G5TA 2G5PA 1YA8A 4XIIA 2J4FA 5AHXA 3H04A 2PM8A 1A88A 4KE6A 3C8DA 4B9EA 4G4GA 1BRTA 4DTCA 4U2DA 4BC0A 1R9MA 4OYLA 3WLAA 2WUEA 3WJ2A 5CXUA 5EHQA 1P0IA 3SX4A 1B41A 1JKMA 4H7IA 1JJBA 1CR6A 2RIPA 4QE3A 3EQ7A 4B7ZA 3FSGA 2GYWA 3Q8WA 4BDSA 4UHCA 4BVLA 3EF3A 2Y1KA 4EHBA 3FVTA 3U1TA 1QE3A 1U4NA 2Y2UA 5SYMA 5IVKA 1XLVA 3TJMA 4MXDA 1DTEA 1KEZA 3ESBA 1WHSA 3ESAA 2OGTA 3FVRA 4X97A 4BP8A 3C6XA 3WMRA 1SC9A 1I6WA 4Y7DA 1Y7IA 4KJXA 1UFOA 1H2WA 2BFNA 1BROA 4UFPA 2YH2A 4UHEA 1XKTA 1WHTA 1VE6A 3C6YA 4LYDA 1K5PA 1BEEA 4O08A 2C0PA 2B61A 4P93A 4Y9SA 1F6WA 1Z68A 5DTIA 3WIBA 5CTAA 3R3VA 2XT0A 3KSRA 1GKKA 3R40A 4TPKA 4FBLA 4OU4A 4UBIA 3WWEA 1NU6A 2XQJA 3C43A 4GXNA 1ORWA 3IBTA 3VDXA 1ZD4A 4EB0A 1XZKA 4AMZA 3W04A 4G8BA 3G9UA 2HU7A 4AX4A 1QIGA 4Q82A 4RE6A 4CG2A 4EA6A 3GFFA 3LS2A 4KRXA 4HXGA 5K3CA 2OCGA 1R9NA 5LZ4A 1IVYA 3F98A 4CIAA 5E4YA 4DIUA 2Y6UA 3I2KA 4IH9A 1FFEA 2J3DA 5AIBA 1BCRA 1LPPA 2WG2A 1W75A 1Q0RA 5EI5A 3DOHA 2QXUA 3H2HA 4AXBA 1VZ2A 4ROTA 2WJ6A 4G8DA 4Y2SA 1DWQA 1QIKA 5LKRA 5HK9A 5ALTA 4UPDA 2QTBA 1CUVA 3K9BA 4CG1A 5FOQA 5CXXA 3BIXA 1ZD5A 3RKSA 3LIPA 1LPSA 1AUOA 1UKAA 4CIBA 2ECFA 1IZ8A 1QO7A 5DLPA 3O0DA 1VE7A 3AZOA 3QITA 3WWDA 2PSJA 2OPHA 2FUKA 2QVBA 4ARAA 4PNZA 2QJWA 3IIIA 1HL7A 5ALMA 5DNUA 5I9IA 4W63A 1KU6A 4M0EA 5AK4A 4PO3X 4F60A 2QKYA 4J0KA 2HU5A 1EK2A 5T4BA 3H1BA 2QOEA 4B85A 3I2FA 2PSDA 1RP1A 3FSGD 2PSEA 1KU0A 1XRQA 5HF6A 1YCDA 5SYNA 1AZWA 4BAZA 2O2GA 3FAKA 3R3YA 1CUZA 3H2JA 1XQWA 4QA9A 4BTVA 2WHPA 4ZREA 3DD5A 4IHAA 1XZEA 1GZ7A 1BU8A 1FFDA 2XUGA 3R3XA 3V1LA 2H7YA 2CBGA 3BE8A 2XLBA 4EUSA 3PF9A 2DFPA 2H7XA 1W4LA 3VJKA 2RHTA 4L3WA 2PUJA 3OM8A 4Q3LA 1YB6A 4FDMA 1XZDA 3GZJA 3ZV7A 3M3DA 4G9EA 2JGIA 1MX1A 5ALNA 1WCYA 1IZ7A 5ALQA 2QXTA 5E2IA 1U65A 3RK4A 3IUJA 4KAFA 4I19A 4ARBA 1C4XA 3WKBA 2EDCA 4P92A 3G0GA 2Y2VA 4UBLA 3FYUB 3H2IA 5D7BA 4ITVA 4PW0A 3WK7A 3BF7A 1J07A 2DSNA 5JANA 4H7HA 1A8SA 3DL4A 1H23A 2J4CA 3WZLA 3PF8A 4EZIA 4F0JA 3VJLA 3N2ZB 4HXFB 4G9GA 5FP0A 3MUOA 3STWA 2XUOA 4RE5A 4BAGA 1GT6A 5LZ8A 4I3FA 4TVKA 3BIWA 4BP9A 4QEKA 3WL6A 5FLKA 1ZOIA 4UBMA 1TKRA 1YASA 2XMGA 2CMFA 4YPVA 1LLFA 5YASA 3VISA 4CCWA 3A70A 1H2ZA 1TIBA 1MAAA 3AZPA 5T4HA 2JGKA 4K2AA 4U2BA 5AIAA 5AKLA 3G0DA 3HEAA 3WWOA 4AN0A 4KE9A 1AQLA 4X93A 1E8NA 3PUIA 5FPPA 4MEAA 2WJ4A 2GBGA 4GBGA 3H18A 1BN6A 1E3QA 4KACA 1ZD2P 5ALYA 4W1SA 2XMDA 2ORYA 5AP9A 1ZI9A 2WTNA 3DLTA 4FBMA 2J3QA 4RGYA 2RGUA 1CVLA 2BGNA 3QMVA 1OCEA 2DHCA 1JMYA 3L1JA 4K6GA 1JT2A 5CT5A 4D9JA 2PUHA 4WFJA 5AM1A 2IIVA 2Z3ZA 4NVRA 3S2ZA 3HJUA 4B0PA 4BZZA 1AGYA 4WDRA 1MPXA 5ALJA 1DINA 2Z3WA 3MVEA 3I6MA 3AIMA 3O4HA 4WFKA 4Y2JA 2W6CX 3WK4A 1UT6A 3G0IA 5ISMA 3D4LA 4MWTA 2JEYA 5HF8A 4W9RA 4HZGA 5CH3A 3IVMA 3VVMA 5ALEA 4KYVA 3W9BA 1CUSA 2IITA 1TRHA 5K3FB 3M83A 4Y2PA 1UZAA 4AO7A 1ODCA 1GKLA 4OB7A 4QLOA 4ZXFA 4WJLA 2V97A 4QDZA 3FLBA 2I78A 2ZSIA 1CUCA 2EEPA 2WSLA 2XMQA 2C58A 4Y2VA 4X6UA 5E4TA 2D5LA 2WIFA 3G02A 5KBYA 1QIIA 5AI8A 4DMHA 2DQYA 4B80A 3WKAA 4FKBA 1XLUA 1DX6A 2WTMA 2X5XA 1QFMA 3HRHA 5JD4A 1YA4A 3V1KA 1DU4A 4Y2QA 1WB5A 2WIDA 4J0GA 3KDAA 1TAHA 1QGED 3JWEA 2GYUA 2ZYHA 2ZYRA 3V48A 5AM4A 1WB6A 2OAEA 1ZJ5A 2BUBA 1ORVA 3LLCA 1EDDA 5ALRA 1XZAA 2C4HA 1OILA 1EK1A 2GBFA 2HU8A 1UWCA 2ZJ7A 1Y7HA 1JJIA 2OGSA 4EY8A 6YASA 1AMNA 4F21A 4FFWA 1CUUA 2PSFA 3O95A 1UK7A 1JFRA 1W76A 2HA6A 4HXEB 1CUIA 1XZBA 5AO9A 3ED1A 2XUDA 3AIKA 4UBJA 1E5TA 3G9ZA 1CUAA 1N8SA 3D59A 3D5EA 2O7VA 4OPMA 2PKYX 5K5EA 4INZA 2JGFA 1AX9A 4XWGA 3S8YA 4BVJA 1XROA 1CUGA 1JU3A 2WUDA 1G5FA 3WKEA 1XZIA 1XZHA 3A2NA 2HRQA 3WL5A 4EY4A 3T4UA 1L7AA 4FHZA 4EY7A 2RHWA 4H7DA 4DNOA 1TK3A 2YYSA 3H2GA 7YASA 1IUNA 4X6YA 3G0BA 4G4JA 3STVA 4A5SA 4HAIA 4UBOA 4V2IA 4G5XA 5HKAA 1CUEA 2GZRA 3WA6A 1P0PA 5F4ZA 3DS8A 3UMJA 2OAGA 4DMFA 4OSEA 5IVDA 1MTZA 5D3KA 3EQ8A 4WY5A 5JATA 4S0XA 4XJVA 3IUMA 5DYWA 3A2LA 3C45A 3N0TA 1YAJA 1QIMA 5ALFA 1XZJA 5DNVA 4BTLA 3HZOA 5EHXA 1UK9A 3ANSA 2AJDA 1Q83A 5DYTA 3WYNA 1IUOA 4E11A 1VA5A 2XUFA 4E14A 5LZ9A 4L72A 3P2MA 2HM7A 4QLAA 2HA4A 3STYA 5HFAA 1QIDA 1XQYA 4L9AA 1LNSA 1SCQA 1ISPA 4BAUA 5AH0A 4X94A 4M0FA 2Q0XA 1MN6A 4GHWA 5HQ3B 4BRSA 5BWBA 5A62A 5CBKA 2AJBA 3K2IA 1LBTA 5JZSA 1AURA 4N8DA 1THTA 2X8BA 3NGMA 4WY8A 4H0CA 2JGJA 4N8SA 1CUYA 4ZI5A 2CUTA 1LBSA 5JARA 2OCKA 1Q84A 3ZPXA 1LPAB 5H3HA 1P0MA 1J06A 3L1IA 1UKBA 5AK5A 1CUFA 1N5RA 4CG3A 5C7YA 3IA2A 1EB8A 1A8QA 4NMWA 1VOTA 1CUJA 3FYUA 3FCXA 5FKJA 4MJ3A 1UOPA 4X91A 3LP5A 4J3JA 1EI9A 5EIAA 5C81A 5C8VA 4HRYA 1MX9A 1LZLA 3CN9A 3OTQA 1L7QA 1EVEA 4B83A 3C70A 4BC1A 4C4ZA 3F97A 4H7KA 3C5VA 2C7BA 2XQIA 1HBJA 2JGEA 1PFQA 2XE4A 4Z49A 5HKBA 2ZYSA 3NUZA 1LPNA 4J0HA 4DSZA 5FDFA 4OD0A 1LPMA 5BOVA 3IDAA 5JASA 3G8YA 4K5QA 2OCIA 4X7BA 4JH0A 4BBZA 3SC2A 2O2IA 2YXPX 2DR0A 3DYVA 1QO9A 4DNQA 3BF8A 3B5EA 3I2HA 2K2QB 3FCYA 2QR5A 3VJMA 5K3DA 4BZWA 1LPBB 1FFCA 1M33A 4J0CA 5AKJA 3WK8A 2JIDA 1QTRA 2H9YA 4FLFA 1XLWA 2AXEA 4X85A 3WA7A 1ZI8A 2WU4A 3DKKA 2XLCA 3IURA 5ALWA 5ALVA 4JYPA 1DQZA 2PPLA 3PFBA 1UK6A 3HABA 3C5WP 2RI6A 1XRPA 2WHRA 3M82A 5DYYA 4JUIA 3WWPA 1FSSA 1H2XA 4XX1A 2PVSA 3I2IA 3BL8A 3HC7A 2VAXA 2QT9A 1K4YA 2AJ8A 3D2CA 2O7RA 1WM1A 4C4YA 2HFJA 1E8DA 3V1MA 2V96A 2ZYIA 4ZV9A 5AKZA 5IVIA 1ZI6A 3BWXA 3D3NA 3RLIA 3KWJA 3WKCA 4Q34A 4ZWNA 5ALPA 1J1IA 3O4IA 1BS9A 1U2EA 5K3FA 2Z8XA 2JEZA 2OCLA 2WFZA 3DKRA 3GELA 4ZV7A 1EB9A 2C0QA 3D2BA 4UHDA 2RAUA 5CH5A 1WPRA 4Q05A 1YS2X 3WK5A 2WG1A 3QMMA 2WFLB 4YK7A 4J0JA 2BGRA 3IULA 1CEXA 1MNQA 4QWWA 3DDUA 1W6RA 3SWWA 5JAHA 1UXOA 4LXHA 4QDXA 3W9UA 2XDWA 4MYSA 3GBSA 1VKHA 3DJYA 4P9NA 4OUKX 4G8CA 1CUDA 5DJ5A 3STUA 1JU4A 4JYMA 2QZPA 1GXSA 5ALOA 4UHBA 3H19A 2XUJA 3OURA 4PQEA 2QUBA 3WJ1A 2WUGA 5CT4A 1H2YA 4CCYA 4BCCA 3ICVA 1ODSA 2C5GA 1DWOA 3QPAA 3I6YA 3D0KA 4MEBA 3AZQA 4QDTA 3QMWA 4FNGA 4ZGBA 2I3DA 4AZ0A 5CT9A 3I1IA 5JD6A 3JYHA 3O9MA 2CB9A 4KEAA 3C6ZA 2AJLI 2HADA 2Z5GA 1DWPA 5JYCA 3YASA 3NOXA 1YAHA 3ZLVA 5AOCA 3C87A 3WZMA 1EINA 1UK8A 3IUNA 4H77A 3F96A 5LLSA 1THGA 4W1QA 3CCCA 3DNMA 2C5FA 1EDEA 5AK6A 3HXKA 3VVLA 5KWIA 1F8UA 2HRRA 3I6ZA 2PU5A 3STXA 3HI4A 1HKHA 2GYVA 5AJHA 4KRYA 2XMZA 2BJHA 4KAJA 4H35A 3FNBA 4GWLA 2G63A 1HDEA 3FYUC 1ZICA 1TCCA 4RPCA 3QBJA 3JW8A 2HA0A 1Y37A 3V1NA 1BEZA 5LP1A 1HPLA 4J0IA 1IMJA 1GQSA 3F67A 4AB1A 3O4GA 3Q0TA 1U8EA 2HA2A 1TQHA 2BCEA 3WL7A 1VXOA 4EY6A 4X95A 1FFBA 1R3DA 4C6HA 3MUNA 4Y2TA 4EBBA 5ALDA 3WIOA 4N8EA 3CN7A 3BDVA 2ZJ6A 4X92A 2R11A 1G66A 3R3WA 2BKLA 4AO6A 3IUQA 1GPNA 4LKOA 1G4HA 4B81A 2XQFA 3LIIA 5JADA 5AI0A 2GZSA 4FTWA 2PX6A 5JAUA 5D3ZA 2CZQA 1LGYA 3H17A 1ZIYA 3DL7A 2QS9A 2LIPA 2WIKA 3BJMA 5FRDA 3D7RA 4J03A 5FPQA 4JNCA 3CXUA 4Q3OA 1XZMA 1MJ5A 2CEKA 2WFMA 2JBWA 4IH4A 1L7RA 3DYIA 1VXRA 2XMBA 2WLSA 5LZ2A 5BWCA 5AM5A 1EH5A 3QM1A 1J2EA 5AOBA 4YX9A 2VEOA 5HF9A 5K3AA 1X2EA 2HDWA 2OQIA 1F0NA 2WG0A 3TEJA 1JJFA 1EX9A 2HA5A 1UOOA 4BB0A 5ALUA 1XZFA 2X76A 2OLEA 3O9VA 2DCMA 1XZCA 2O2HA 2E3JA 1K8QA 4QZVA 2PBLA 3T52A 4N5IX 1XQVA 4F5ZA 1MT3A 5JZ9A 4W1RA 1FFAA 2OGZA 4KE7A 1O6GA 3GUUA 3I1YA 3ZLTA 3OPMA 2NW6A 3A2MA 3ZI7A 1EXWA 2YASA 1S8OA 5A7FA 1PV1A 1VJ5A 5A6VA 5DWDA 2BUAA 1GQRA 4PSDA 3R41A 5JZBA 2HIHA 2H1IA 4TGLA 1YR2A 3I2GA 4GLBA 5K3EA 4IO0A 5I7UA 3B12A 3UUFA 5AI5A 1USWA 2FJPA 1NX9A 5D6OA 1XRNA 2XUHA 4U2CA 4B9AA 2ZSHA 4OYYA 5AI6A 1X70A 3C8HA 5EFZA 4X90A 4B0OA 1EHYA 5A2GA 1MO2A 2R8BA 5CMLA 5DTJA 5IH7A 3PDCA 4FWBA 1WOMA 1CLEA 5FUMA 4U2GA 5JD5A 1E89A 1W1IA 2WKWA 5CW2A 5AKKA 1CPYA 3PI6A 3W2TA 1YS1X 3TGLA 3R0VA 1QJ4A 2VSQA 4U2FA 3WKDA 5AKGA 3WWCA 5LZ5A 3X3HA 3F8SA 4UFOA 3D2AA 4EY5A 2CKMA 5CURA 1QZ3A 5A71A 1RYYA 1PJAA 2B20A 2V9ZA 3DOIA 4FLMA 3PICA 1H22A 4DSAA 1MNAA 3KD2A 4K6HA 5AKEA 1IUPA 1B6GA 1GGVA 2FJ0A 5AM2A 5FXMA 5AKYA 4WDQA 4G1FA 3KOOA 4DLNA 1XFDA 2WIGA 1MX5A 4DYHA 2PL5A 1QFSA 2VTVA 4H18A 2EDAA 3WI7A 3BJRA 4GDMA 4UFNA 1CUXA 4Y2RA 1Q0ZA 2ROQA 3DEAA 3EBLA 3RARA 3HYSA 5T4FA 4BYMA 5JAOA 2ACEA 3R3UA 3F9CA 4C88A 5IVHA 3DQZA 1EA5A 5T4EA 3AINA 5LYYA 5AKHA 4KE8A 2JGMA 5EHNA 1D07A 1DX4A 4BATA 4OCZA 3WK6A 5AKIA 5LKAA 1C7JA 1BE0A 5FV4A 1TCBA 5ALGA 3W05A 4AMYA 5KREA 3QH4A 3FYTA 3HACA 1UKCA 2WFLA 4DNFA 1ACLA 2QMQA 1VA4A 2I03A 4UHFA 1QIHA 3AUKA 1XRLA 5AOAA 5LIPA 4PSCA 5K3BA 1HQDA 3E3AA 4FMPA 5AM0A 1E66A 1MAHA 3WK9A 4Y2YA 1N1MA 1ZGCA 4UBKA 2XI4A 5CT6A 4OB8A 2HHAA 4HTAA 1UOQA 4FLEA 5HCUA 1XZLA 1K6EA 4H7JA 1QIJA 2ES4A 3QVMA 5KWJA 4I4CA 4IH1A 4C4XA 2CJPA 3OG9A 1AKNA 1DQYA 5LZ7A 1VLQA 2ZJFA 5ALSA 2OG1A 3G9XA 4E15A 4AN1A 3STTA 2VT6A 2XUPA 5IKXA 1CIJA 1CUBA 4Q1VA 5ALXA 4MYDA 2GBCA 1CQZA 1SCKA 5EIEA 4FNMA 3I28A 4NS4A 4QDOA 3PUHA 2Z8ZA 5JALA 3GA7A 3BXPA 3I2JA 3EQ9A 1BCSA 5CH8A 4Q3KA 2WQZA 2GBIA 2VATA 4W1PA 1OXMA 2XMSA 4RNCA 1ACJA 4BRZA 3WQHA 4J7AA 1BN7A 4PV7A 4C01A 4H7FA 5BV7A 3LCRA 5JAPA 2HFKA 4JEIA 5I8PA 1RWQA 3CCBA 2WM2A 1JMKC 3ZWQA 1A8UA 1O6FA 4Y2XA 2JGLA 4DMCA 4Y2UA 4B84A 4NZZA 2VJDA 3HSSA 2VQ6A 5ALKA 2ACKA 2XQGA 3E1GA 1ZIXA 3FWHA 1R1DA 4LIPD 3TRDA 4X3CA 2OXEA 4AQDA 3A6ZA 4ZRDA 5A7GA 4G4IA 4BE4A 1YB7A 3R3ZA 1ETHA 4LHEA 1TCAA 4UBNA 3AJAA 4ETWA 1FJ2A 3H0CA 2XUKA 1ZD3A 4QDUA 1A7UA 4C89A 4IQ4A 5C8ZA 5CT8A 1WPXA 1LZKA 4PF1A 2H7CA 4OB6A 3QYJA 2XB6A 1MU0A 2G4LA 1SCIA 1ODTC 2ZVDA 2JF0A 2DQZA 4WCVA 4GW3A 5ALLA 3HLKA 2QUAA 4BCBA 2XMCA 4DNPA 1W52X 3H2KA 4XVCA 5AI9A 3BDIA 5C8XA 1QIEA 3K6KA 4GEGA 4FFVA 2D0DA 2WUFA 2DHEA 3FOBA 1C7IA 4HRXA 1JI3A 3AIOA 4DGQA 3ESDA 1EDBA 4K6KA 2OQVA 5AKXA 3EIOA 2QJRA 3O4JA 1P0QA 1DT5A 5HFNA 1F0PA 4HS9A 4DMKA 3DCNA 1EVQA 2QRUA 1X2BA 4OU5A 1LPOA 3M81A 3E0XA 4E46A 3FLAA 1ZJ4A 5ALZA
chains in the Genus database with same CATH superfamily
2AG1A 2WAYA 1A9YA 4A92A 5JS1A 1W5TA 3OOSA 4B6PA 4JBHA 3CPSA 3FCAA 2QZSA 5EJFA 1MB9A 1ZESA 4N5MA 5C34B 5E6SA 3NHJA 2F90A 2HSZA 3M7IA 4HLDA 2J33A 3SHOA 2WHPB 2X4LA 2HA7A 2HMAA 1HYQA 3L0SA 3LAWA 3OPVA 4M83A 5BN4B 4AJLA 1WO8A 2DC1A 3PUJA 4KXUA 1EJ0A 5EMKA 5T67A 1SXJD 1F12A 1VE5A 2QTHA 3JATA 5FL3A 2ZJ3A 4BLUA 4Z1MD 1WZEA 3GDFA 1U1CA 3M4XA 5FOVA 4IHQA 4NFHA 4U2EA 2G3YA 3KK0A 2IBSA 2JIBA 3RIHA 9ATCA 4H7EA 2J7PD 4MW5A 2VHYA 3PI7A 3CSUA 3AETB 2HSEA 1JV2B 1Z74A 3SK0A 3AM4A 4LYEA 1RWOA 5AVVA 2J6CA 2R8YA 1YKFA 3C4VA 2HA3A 2VNIA 3PWKA 3REQB 3REGA 3ZR4B 2WMOB 2WJ3A 2RONA 4Z7OB 2AX4A 5SICE 1TUEA 2I3ZA 1Q1BA 5FULA 2EGGA 3ILSA 4XDHA 4F5DA 1JHDA 4TM7A 4D8YA 2CK3D 2H2AA 2WIJA 4P4TA 5HKKA 2ZSDA 3DVAA 3QUSA 2FEMA 4LHWA 1OLSB 3CRZA 2I0FA 4XGRA 3CVWA 1GPLA 4RDHA 4U02A 3VPCA 1TVMA 1R50A 1YJ8A 5IAKA 2WK1A 1GUBA 1AC5A 2GJ8A 3HVJA 4PC7A 3V80A 2BGIA 4OMUA 4FOLA 1PG5A 4KR7A 5LOVA 4BNIA 1FNDA 3T7TA 2P1ZA 1FTWA 1RAFA 3GBPA 1E3WA 1D5WA 2AYYA 4YAEA 1I36A 3I9V1 4OYHA 2YZ2A 1DJPA 2B2NA 3ZGYA 3HP4A 1GAJA 4GRAA 4X1KB 5A7HA 1SXQA 3ZDAA 1SG9A 2XUZA 3KQOA 1SBYA 4KAAA 3ROEA 1EQUA 3ONEA 1JPUA 1SJ9A 4JK3A 2AJCA 1Z56C 1UPTA 3CE9A 4X64B 4JXZA 1MB2A 2ILTA 3R74A 1XZGA 3FNHA 2V98A 3S2IA 5JT1A 2QW1A 4NAHA 3NB0A 4D25A 3A4LA 3Q15C 1VE3A 2OESA 4BBJA 4L8YA 3D7MA 2IYVA 2XUAA 5IUNC 4HDCA 5CRIA 5G41A 4LX8A 2C4WA 5JMOA 2XMRA 6GPBA 1B8NA 3HUTA 2VYQA 3M3PA 3GIDA 2FW7A 1T8TA 1PZNA 3EOBI 5FV7A 4ZZ3A 1K7FB 3GVIA 2DH6A 1GOTA 1IIBA 3MA0A 5EMJA 3PXGA 2PUFA 3KEOA 2XJ4A 4W7HA 1C81A 2JJ1A 4TVBA 4FGJA 4DG8A 4LMAA 3AI1A 1IL0A 1PJCA 1FDOA 3GRCA 2C2KA 1OXBB 3NBQA 4P7KA 4X20B 1MENA 2HLNA 4ER5A 3UHFA 3ET4A 2BFBA 2B25A 1T6ZA 1TOAA 2CFRA 1EBBA 2P2ZA 3ZE2B 1DIRA 1ZA1A 2J5KA 2AMVA 3CX4A 5F76A 3THRA 2WKPA 5EXXA 3GOHA 1VI2A 4MW9A 5L3SB 1OYYA 3QPCA 4YR9A 4WRRA 4YPOA 4IDDA 4J4HA 5CLLA 4HX9A 1DDOA 3GFSA 4AF7A 4WPGA 2XUIA 3H16A 4YCSA 5J2UF 4QFBA 3KXPA 5IM5A 5JCXA 2W8ZA 5A0VA 3EH2A 2Y92A 1BRMA 1WU8A 4FU0A 2QPOA 1J7JA 3IV7A 1DX9A 3I3OA 4I0WB 3WNCA 4ZMSA 2CVFA 5EIBD 1JP7A 1M0WA 3VKFA 1EIZA 1DHTA 3OOHA 2A78A 3C98A 2HWXA 1CV2A 1JIIA 1QFZA 2VJCA 3J80A 4MV6A 1SQ6A 2DPMA 4QNNA 4CHGA 3PT5A 4NABA 5JRZA 3IB6A 4RZSA 1C0KA 4AMBA 1QGUA 4V0NA 4HFMA 1LX6A 5HBGA 3KSBC 2DFKB 3IB3A 1LDYA 2H3EA 3LP8A 1EP2B 4BXOB 1NYQA 1X8XA 3SYRA 1RCFA 2FWBA 2I55A 3KQWA 3OF2A 4IXMA 4Q37A 2XOEA 5LYJA 3VSCA 1T2NA 1D2CA 2O8DB 2XUQA 1P9LA 4BMNA 4EKIA 2XNHA 3ONDA 1LS6A 4ENWA 1FC0A 5ALHA 5B3AA 3H9QA 3DMPA 3DEKA 4KMSA 5BSVA 3OJXA 1C9DB 3VTFA 3N2NA 2XZOA 5F7JA 2C4MA 4EI8A 3COVA 4U7GA 4D4MA 2UUCB 1MT0A 1Q0UA 1KZ9A 2DBZA 3A1CA 2WEKA 4R98A 5TVKA 3AESA 3GAAA 4C1BA 1WB4A 2O8VA 4OHFA 3TAUA 4BDTA 4B44A 5HXAA 2AQIA 1SB8A 4B6GA 1Y1KE 1F38A 4ZC1A 3WGMA 4C3OB 1FP4A 1LRJA 2NZUG 3KOXA 2WF6A 4NJOA 1E4EB 1HFJA 5IZ4A 1OTYA 3MNFA 1KDPA 3W06A 4KQFA 4V1CA 5DLEA 4PC3A 4Y3UA 4OOFA 1N0HA 1V35A 2HRZA 1WUTA 3EA4A 4EY3A 4XM0A 3ICWA 1JQLB 2G36A 2M32A 5FTLA 2BGJA 5I7RA 5ICGA 3DTVA 3W5DA 5JHGB 2P40A 2P2SA 1K9VF 5ALIA 4ZMRA 2YC2C 1TVKB 4XE5A 3KQVA 2G0TA 1Z07A 4HAWA 3BD8A 1SKBA 4HQOA 4OP2A 3D4NA 5HNKA 2BAGA 2G5TA 4I4TF 2AZDA 1NXXA 2XBLA 4FYPA 5IVPA 3UA3A 5LSAA 2LCQA 1GAEO 3LLVA 3ETNA 1KK3A 3PJFA 3LVFO 2PM8A 4JBYA 4M0CA 3ZTYA 4KE6A 4A91A 2QTVB 3UJAA 2G07A 1E1CA 4KU4A 1Z0IA 5CW1A 3LUJA 2QX8A 1G6HA 3O91A 4ZN6A 2GEDA 2F9FA 3FB4A 4BC0A 4XM1A 3SYMA 2OV6A 1V4NA 1OIXA 2WUEA 3WJ2A 2VH1A 3EE6A 3BGOS 1SD1A 2Y1FA 1M74A 2G80A 3IEXA 5CD1A 2G88A 1B41A 5LVAA 2C7PA 4NI5A 2FSUA 2HEGA 2O4CA 1YULA 1Z6GA 4GD3Q 3L9WA 4OYRA 5LQSA 2AJTA 2KPOA 2W0SA 3Q7QA 2QL5A 4FJ1A 1CR6A 3DW3X 1XMJA 3WJ7A 1IM8A 2BEUB 5K6AC 3IDQA 3DB2A 4A27A 3TG8A 2X0RA 1GGJA 2P79A 3TTTA 4GKAA 2J0UB 2XZLA 4CM5A 3WWYA 2PT9A 3EF3A 5KYUB 3L8CA 5G02A 4KMOA 1HK7A 3NVMB 2A92A 4XTCS 4ZCLA 1EK0A 1O57A 4C5BA 2IYNA 1QE3A 4CLOB 4JIGA 4OQMA 3ANMA 3PL1A 1U4NA 4DYDA 2ZJ5A 5CCBA 4WBNF 1YFKA 1Q20A 4F91B 5EG5A 4RZ3A 3TLZA 5CD9A 1FQOA 3R7NA 4MYUA 3FVWA 4WUVA 2DLCX 3GGCA 1ENYA 2C0CA 4MIEA 4CE6A 4R71A 4MUIA 1FL9A 1XLTC 1WHSA 1W2HA 2OGTA 3C7DB 2H18A 3KZOA 2R2AA 3WL4A 3C6XA 1RZ3A 1SC9A 1UKVY 3GPIA 3SZOA 1NXVA 3EW9A 1I6WA 2ZPTX 3QRWA 4BX8A 1Y7IA 1K9SA 1XU7A 2HREA 4KJXA 2VLIA 3N8HA 2BPOA 2QROA 4I4TB 2JDIA 5DIFA 3U7FB 2CNWD 3K73O 3K5PA 1HYHA 4G1CA 3KR2A 3OFND 2HCTA 3DMRA 4M8LA 4ZDWA 3UEOA 4E2WA 3W9SA 1OIVA 2Z6QA 3H05A 2ZBEA 4UHEA 5L51A 3FA2A 4BKPA 1ISHA 3DDZX 1VE6A 1SC1A 4FDUA 2B3TA 2FVXA 3BB4A 3RYCB 3T5TA 1BEEA 1U28A 3I6QA 4GOOD 5DYGA 1ORHA 4HUTA 5TS2A 1FX0B 4Z7QB 2QVXX 1NI4A 4JX8A 3GJZA 3LPDA 3I0NA 3ZK7A 3WVNA 4ZOLA 1U7TA 2QUKA 1R6VA 3OX3A 1NZDA 4KN9S 3KSRA 4QC2A 1FS4A 1DPFA 2C84A 5IJ0A 5FUQA 1VHDA 2Z5LA 3EWAA 4TPKA 4CTNA 5SY6A 2W70A 3FTNA 4FBLA 4LMRA 2C2BA 2E4UA 2X2EA 4CU5A 1XXHA 2E6UX 3P96A 4NICA 4OLBA 1ECJA 4QOJA 2ERCA 3PEYA 1NU6A 1N0WA 4MINA 4I4NA 4K9QA 1U04A 3IBTA 3VDXA 1F1BA 4EB0A 4TWAA 4GLOA 4UNRA 3DE6X 1XZKA 3ZTWA 1AF4A 3UHAA 3RS0A 2XVZA 3OCVA 3UB2A 5I5GA 3BMQA 2IEDA 3THYB 4XQ9A 2KS6A 2ILVA 4IL5A 3FZYA 4F9FA 1CY6A 3E9MA 4N01A 4WBNB 2H31A 3EMBA 1QIGA 1UPBA 2ZIXA 1XL1A 2O3SA 3DBHA 4MCAA 4N0PA 4EVSA 2I8LA 2JCXA 2AGVA 3DMHA 4EUEA 1FP6A 1G8JA 4XWOA 4EI9A 2H4ZA 4TZ6A 1G6Q1 2NYAA 3L7YA 3Q88A 2EGHA 3B36A 3LE8A 3GYBA 4UUOA 1TJNA 2GSWA 4WZBB 5FBQB 3O75A 3RRBA 3WDLA 5AW4A 1TJ4A 1H9CA 3AB8A 3COJA 4XCXA 1P5FA 1EYZA 1IVYA 4P98A 4L3OA 3TFOA 3T54A 5DX1A 3FM9A 3L41A 2QBYA 1RZVA 4AICA 3A04A 2F3QA 2P5YA 5JNVA 4QPZA 5E4YA 3DZIA 3HR7A 3ZJYA 3RS2A 2F1IA 1GRRA 1SVKA 3GEBA 3I9V6 5EPUA 5DCUA 5SV2A 5MHTA 3TNLA 5FJJA 2F17A 4K9MA 2WY2D 3CT6A 4JMLA 2LKCA 1IHDA 5AIBA 1L1RA 3A6LA 3Q6MA 5BMVA 3KJFA 1BYUA 1F3LA 1R66A 4LJKA 4RZ2A 4CMIA 4DQLA 1LPPA 2WG2A 5FEMA 5AW6A 5ICMA 4I1VA 4E2YA 2C78A 5EI5A 4DSTA 4C7VA 5AUNB 1EBUA 4AXBA 4GMHA 4A6DA 1HLPA 4C0KA 2D6FA 1Y4DE 4Q47A 5K2MA 4G8DA 5DASA 2ZWVA 3QX8A 3ZHRA 4KR6A 2VNSA 1U02A 4ZK6A 5LKRA 4W5RA 4CNQA 3CEJA 1YTUA 2XVYA 3CH4B 4TV8F 2OVBA 4B74A 3FHTA 2AQHA 4IEIA 3ZNPA 5LBUA 2Z56A 2DLNA 1N2BA 3K9BA 3UAZA 3UXYA 4P5DA 1YDMA 8OHMA 4ZVKA 4CG1A 5CXXA 1YBFA 3KYCB 1DB3A 1YVDA 2QI9F 4C7BA 3HJFA 2OSBA 5FA5A 3BJZA 3TR5A 3TPCA 3KKEA 2GSDA 2VLBA 1XOIA 4JLAA 4JR0A 4KXVA 4C3VA 3K9GA 3TECE 1P2FA 3VR2D 3P94A 4PNEA 2P9CA 4E1VA 3AJDA 4CIBA 1M7BA 1XVLA 3N2IA 4YRNA 5WRFA 4PZDA 4H16A 3OZ7A 4TVOA 4YJGA 4JVNA 2KW5A 5F4BA 4Y6QA 1O5TA 4ID9A 3SIWA 1VE7A 3QITA 4DCVA 3HYNA 1RZUA 4JYCA 3CINA 4OHUA 3U7RA 4Y1GA 3N3AC 1F2VA 3QWAA 3IAM1 4FC6A 2GARA 2PSJA 5DCLA 1MW9X 3HR4A 4NYJR 3G82C 1V5FA 1Z83A 2GTPA 4KCGA 2P6UA 1IN7A 2J6BA 1Y5IA 4LXXA 5TPZD 2H11A 2B34A 4DIBA 1Z3CA 1RYMA 2EJCA 3IIIA 4NDAA 4EF4A 5ALMA 5JI3E 2I1WA 5DNUA 2WKSA 4RF2A 1C5KA 3KZ1E 4BN0A 1XD2A 1TA0A 4JOCA 2PGJA 2FP4A 4BGIA 5BQOA 4L95C 3NEAA 3RS7A 3ZWAA 3V1YA 5AK4A 4MITA 1TA4A 2GRJA 1HA3A 3M6WA 3R0IA 2VHXA 3OVMA 4X1IA 2C1XA 4X3OA 5E9JA 3RJZA 3E5MA 4V0KA 2A9JA 2V0CA 2OXTA 3I39X 4Q7QA 4U6NA 1T91A 2CNDA 4YONB 1K4MA 5LN1A 3P2YA 5T4BA 3H1BA 3WB1A 1U3CA 4C06A 1XDZA 3E9QA 4AL4A 5FPKA 5BYJA 1EJBA 5JVDF 4D43A 4B76A 3K15A 1W19A 1UQUA 2INGX 3I2FA 3UG7A 5EQJB 3FSGD 1KU0A 5HF6A 3EZNA 3GCXA 1KYXA 3PD1A 4DLXA 1FLVA 5SZIA 3Q8LA 5DP2A 4DA6A 3B70A 4YMVA 3R3YA 4ZAGA 2JI6A 1ZRNA 4G1MB 4BJHB 3AB7A 4J9VA 5DOVA 1E6CA 1K5DA 1CY2A 3TE7A 3SKVA 1KZ6A 4AP9A 1TL7C 1T2DA 1CFZA 1JHXA 1A95A 1NIPA 1D0VA 2AMFA 4BTVA 4C7JA 4E12A 1HE3A 1V1RB 1ZCFA 2BFOA 1XZEA 1N3BA 4JDUA 2BGTA 3W2IA 4KI7A 4FSHA 5M3BA 4RENA 2H16A 1BU8A 5CITA 1FFDA 2XUGA 4H1UA 3R3XA 4IDBA 3DT6A 4PPQA 1NP3A 4QBTA 3QVUA 4Q4HB 1NW7A 1NATA 1C0PA 3PF9A 2AG6A 2WT8A 1PR3A 3N0XA 1X0XA 4RCYA 1W59A 3VJKA 4CM7A 4IFEA 2VCHA 1Z0DA 1T36A 1ZUIA 3UFBA 5DH9A 3WY9A 5A4AA 5DNAA 4CKYA 2CMGA 2WINI 2PUJA 3AHFA 1J09A 3A6HA 5AJXA 4UCQA 2F55A 5JH7F 3MWJA 3WBFA 4KQGA 1IPHA 4NCAA 5I5EA 4EO4A 1TD9A 3GZJA 3I73A 2O07A 4B7CA 1W5BA 4X84A 4HBGA 3ZZ0A 2WWGA 3TE6A 1ZXBA 4E4TA 2VPWA 2JGIA 2FR8A 4HDNA 3OZXA 3ZG6A 3SF8B 4Q4CA 1RJDA 1KS2A 5ALQA 1Z15A 5LCXA 2VP4A 3A4IA 1E63A 2XODA 3EGXB 1U65A 3HCFA 3MSCA 4PRYA 1VBMA 4UUAA 5E4FA 5EQDA 1E7MA 1WQ4A 1Q0QA 3JQFC 3NHBA 1L1QA 2IS6A 3EZ2A 4LJ4A 2JFXA 1NXQA 3W5JA 1A5BB 1C4XA 3CRVA 2YW2A 1E2UA 1FRZA 2H8KA 3E9ZA 4NESA 2EW2A 4AWAA 3THWA 2O0KA 2BMWA 1PD1A 2FWAA 4IVPA 4Q1EA 3D6JA 5G4LA 2JG3A 2D1FA 4UBLA 3LM8A 2MMGA 3RSFA 3R77A 5D85A 3H2IA 3IQXA 3L82B 1ZM9A 3LDUA 2CUZA 3GI1A 3ZE7A 5B64A 1I8TA 2A0WA 4YRJA 4BFUA 3LT5A 2UZ1B 4D8UA 3IS3A 3SNHA 1Q7EA 4PN3A 1IE3A 2GETA 3THOA 3L6OO 3HB4X 3O8RA 1HDRA 2O57A 1GUZA 2NUPB 2UXCB 4F3TA 3CNLA 3UT5B 2QX7A 4LOAA 4R01A 3CF0A 4PTZA 2IXFA 3R7WB 2AC2A 1W9MA 4LRXA 3TW8B 1MQ9A 1XTVA 1WZNA 3L8ZA 4F0JA 1H8ED 4RHEA 3RSOA 3N2ZB 3P2IA 3QEKA 3SX0A 3U4DA 5BQPA 5GPBA 3D6AA 1O03A 1GKUB 2GK3A 4UMEA 5CLFA 4WNCA 1WLYA 4BZPA 1XCMA 2ORED 2QK4A 3AMVA 1KRXA 3ZOKA 2NLOA 2ZUWA 3MUOA 4MS1B 1U80A 4BEBA 3BT7A 4I1RA 4JL6A 1CEYA 5CFLA 2XUOA 3LDFA 5DEOA 1DKLA 1VRCA 2VUTA 3CFYA 1WMFA 6PFKA 2P27A 3D1JA 5LZ8A 4FT2A 4EHNA 3QJGA 5IT4A 1BKDR 4BP9A 2FN7A 2P6MA 2W37A 1FCJA 1OT5A 1Q16A 3BGDA 5FLKA 1ZOIA 2R1TB 2VG8A 4B6JA 1HTWA 1TKRA 1YASA 1VIAA 3T8YA 3AVUA 2PX2A 5YASA 2L0XA 1N3YA 4F6LA 3E9EA 5KU7A 4KTTE 7MHTA 3OI7A 4LMBA 2CEAA 4YMSA 1MAWA 1IJBA 3FUXA 4XJTA 5DISB 2RCNA 1CQXA 4JQZA 1JG4A 4CKWB 1HQYE 1O96A 2VI5A 1WDLA 1P9OA 4U1RA 5BW8A 4PZLA 2BZ1A 1O0SA 1ILEA 4UU1A 5KQRA 2QTFA 1WQ3A 3X2FA 1GN9A 3GPBA 2VDPB 1ZCBA 2H2DA 3QIAA 5AMXA 2PYDA 2JJMA 4R2LA 1ZMBA 2GN6A 4EYQA 4KDFA 2Y3IA 2JFYA 2LXNA 2O2JA 5AKLA 2GQ0A 5DHRA 1MZPA 3UQYS 2RE8A 1DDIA 4BLTA 2POCA 4ZO7A 2P11A 4MHOA 4ZARA 4TKVA 3D3EA 1GSOA 3H9UA 4X93A 2ERXA 1E64A 5FPPA 1CS0B 4XFJA 3IAUA 4HXYA 2Q62A 3HMQA 1G8HA 2GBGA 2BLLA 4FI3F 5DFAA 4F7DA 1Z2NX 2YFYA 2DKOA 1DAFA 2PZGA 4FONA 1BN6A 3M3HA 3ZQ6A 1KBOA 2VNJA 4EVQA 4E1AA 4HEA1 1Q19A 4C2UA 2ZANA 3FWKA 3KPWA 5AVOA 3SXUB 5KOJA 2OG2A 3PUXA 2X0JA 3VV3A 1I1NA 1KGSA 3AHCA 3D0QA 1ZI9A 3JS5A 3L0ZA 4TLEA 2FWRA 3KJXA 3ZE9A 4C6SA 2QP3A 4OQPA 2IPOA 4RGYA 4C07A 2DSTA 3EB9A 1WULS 3ZGLA 1CVLA 3QMVA 3O8BA 1ZOLA 2EZTA 1BMTA 1QHHB 3EVAA 1X3SA 1N92A 3KFXA 3O1IC 3BE4A 4HNGA 4NCXA 2WSYB 1WDWB 1KARA 1ULAA 1E2NA 4CMEA 5AM1A 3WV4A 3JAWB 5HS4A 1SAYA 1WZUA 2PGDA 5DBHX 1OLUB 4ML3A 3MRVA 2UKDA 5B58C 1TECE 4JZYA 4XIGS 2JFOA 4XCVA 3LBYA 5KWVA 1HM5A 5IS2A 4NVRA 3V4OA 1OB2A 2IPMA 1MPTA 1EG7A 1MHPA 3S2ZA 5TRTA 1U1GA 3OIGA 2AEMA 4US0R 4BNUA 1EWQA 4M87A 4M1MA 4LSWA 2IVZA 2IZ0A 5IJAA 3UMBA 4Z0TA 2Q7OE 3GPLA 3TOCA 3VOAA 3FTEA 2NAPA 4S1WA 1U0TA 1KMQA 3VU0A 3GFGA 4R8LA 5ALJA 5EWLB 2Z3WA 3W6ZA 4BBAA 4CJXA 1V1MA 5J59A 3U7EB 4G56A 1K98A 4UDOA 3O4HA 3WYEA 4UM9B 1YE8A 4YRIA 2VH2A 3RK0A 5FEUA 1NW4A 3K9CA 5C31A 3VNBA 1MQSA 2AEFA 3SE0A 2GA9A 5ISMA 3D4LA 3BJEA 3AF6A 2C1ZA 3KKMA 5BSRA 1I4DD 1DCMA 4MWTA 1JPJA 1RD4A 4YJ2A 1E9BA 3OZCA 4W9RA 5CHYA 5A1TA 5BSTA 1Y8AA 4M21A 5CH3A 2QTMA 3ZE8A 3SLRA 4L5YA 3LKDA 4FIZA 4FZVA 4EZBA 1V71A 1XA4A 4RULA 1Z0JA 5FLEX 2ZRDA 4AZTA 2ZJ2A 2YS7A 3W5BA 4NJMB 1C80A 3M83A 1M1YE 4CWAA 3HSYA 1J8VA 1GKLA 4OAQA 3OFJA 4ZO6A 4FCVA 4QLOA 4UOZA 4QDZA 3WG9A 4YV2A 4Z9FA 2GF0A 5CM8B 5AYVA 3VNSA 4ZDKA 4XCQA 4MI6A 1TB4A 4WXMA 2R7AA 4YACA 2D8MA 1CUCA 2YWBA 2ZYWX 3LZDA 5CFMA 1Z08A 1QB8A 4AF6A 2DQSA 1SWWA 2VDMB 3AM1A 3PNKA 4AG3A 3U61B 4EMSA 3IAM6 4X6UA 1GPYA 3ZCVA 4UM9D 5H59A 2GEBA 5E4TA 2NO6A 1M1ZA 5BURA 3RVBA 3L7BA 3JQCA 1QBKC 3R76A 3L7KA 5LMCA 4ATNA 2CFSA 3PL5A 1QG2A 1RXCA 1JNXX 1JEOA 2DQYA 4LN1A 3GV0A 1W1WA 2CXRA 2LCFA 4ZC8A 4B80A 1RLJA 3KOYA 3QE3A 2WPDA 3F6PA 2RHBA 2XKBA 3IMCA 4NE2A 4H0NA 4Z2YA 2FQWA 5BSEA 1KIAA 3L0DA 3UV7A 4FKBA 3NMUF 1BVYF 2EP8A 3CZMA 5B2ZA 3IPXA 4IIJA 4GWGA 2CYCA 4G36A 5BRJA 3PPVA 2RHRA 2O48X 1QFMA 2PWPA 2B8WA 2WHEA 1KDVA 4YMUA 1I94B 1JXQA 3PVCA 5JD4A 1QR6A 1U2TA 2RHHA 2D4AA 2Q3MA 4FEGA 1G8FA 4FYYA 4JU9A 2GZAA 5AHWA 1WB5A 1XZQA 2ZR9A 2WIDA 4YI3A 1Y7TA 2CXUA 4PLTA 3NVDA 2ATVA 1AUVA 1HE8B 2OFFA 4B71A 1IWOA 1U0SY 2DHRA 3F8TA 1JR2A 3H6HA 1GCOA 1Z34A 2IOYA 3SHTA 4BB6A 2ODWA 4BQSA 1OHHD 1PR5A 2CXXA 4P86A 3DTYA 1T5LA 1GR1A 5ALRA 1P91A 2V65A 2PX0A 4WACA 4EJSC 2C4HA 3C7CB 3QTBA 5LQMA 1TM3E 2DMRA 3IALA 4KX5A 1KO1A 1I5OA 2HU8A 4GI7A 2CLMB 5I9BA 5B7QA 1P39A 3HKDA 3HZHA 2ZKLA 4NK4A 1ZM2A 2C2OA 3O3CA 4PYMA 2DZDA 3EXHB 2J9XB 4ENSA 5KYNA 1S4QA 1GHTA 1WD5A 5DMHA 3DLPX 3SVTA 2ZE6A 5EJ2A 4ZQHA 4JQSA 1JJIA 2OGSA 5GVRA 4C20A 2BMVA 1XWFA 1L0BA 2AFIB 1L7EA 3KXIA 4UATA 4HB4A 3A1NA 1QGZA 3AWIA 1ONBA 1TJ5A 5B53A 1HX7A 4KVAA 1OW3B 4JNKA 3PZBA 3R3HA 3VHXA 2AX3A 1G8YA 1JBKA 2W2OA 2XCTB 1N2OA 2A6PA 4FFWA 4MGIR 4AS2A 4D4GA 3OD5A 1GN8A 1ILWA 1PGOA 1T29A 2QRGA 2AFHB 3KKOA 4W6QA 5IEBA 3RAPR 3SR4A 1T1EA 4C4TA 4D9KA 1JFRA 1OWPA 4XQCA 3LK6A 3WLHA 5L4SA 3IAS6 2HA6A 2JBAA 1AQYA 4DC0A 1SK8A 2HGSA 4FDVA 4O4LA 2HMSA 1P31A 2B1JA 1FOEB 1GG9A 1KFBB 4JGBA 1P74A 2HMVA 1ECPA 1Y8RB 2NVUA 3AIKA 5BVHA 1QFJA 1GPUA 3G9ZA 3FGOA 2FI1A 4IP0A 2A59A 2OTCA 4EJ0A 2ZUVA 2H1RA 5DHSA 1I14A 2QIPA 3HDTA 4L7QA 2FSGA 4S1OA 2P9JA 2BKVA 2VH5R 2CJWA 1X87A 2O8EB 2Z2ZA 1E1DA 1YJBA 1Z6TA 3D59A 3SD7A 4C5CA 4D99A 4ZJUA 3C5EA 3NWEA 1I1HA 4WNIA 4JN6B 4ZYZA 2A58A 3SP1A 1U1FA 5JFGA 3FCCA 1AX9A 1P5ZB 1Y4AE 4XWGA 4Y98A 5CHEA 3H9EO 4F93B 4GT1A 1CUGA 2W9XA 1G5FA 2NU8B 1KWGA 4JASB 3DLHA 3IPYA 2J45A 4EY4A 1T15A 3T4UA 3RYHA 4EY7A 2HHHB 3A6KA 5EERA 4H7DA 2VRBA 3D3WA 2NU9A 4DNOA 1A4RA 2DETA 3H9BA 3ZDQA 4PZUA 3VZDA 1N75A 4E94A 3H2GA 4X6YA 2O0LA 1SVWA 1U8TA 1GVNB 3B53X 4RA6A 4MYRA 1YDHA 2JANA 4HAIA 3AERB 1I2ZA 1UJBA 1XO1A 4R31A 5HKAA 4FYXA 1P0PA 1NR7A 2I6XA 2NAFA 2ZU6A 3FUWA 5F4ZA 5GONB 4CTOA 1UC9A 2A0KA 1AMUA 4DR2B 1W0KD 3AUSA 3GBVA 2UYQA 3HG7A 1UBCA 4YVFA 3P9PA 4M37A 3WLJA 4AUEA 3CUYA 1GM5A 3EZLA 3GVPA 3KKKA 1DRJA 1B8PA 3IP7A 3N28A 3CO5A 1W0JD 3IKLA 3MWKA 4WY5A 2HIMA 2OWEA 1N5OX 4MKRA 3MGGA 5LC1A 4BLPA 5HDBB 4D80A 1JFLA 3BMNB 1F2UB 1H2AS 2JIZA 4CF6A 2FWJA 3A2LA 3A26A 3C45A 1L4FA 4WK0B 3RCBA 3CA8A 1RABA 3KR1A 5KINB 5IW8A 4LTMA 4I1PA 1R0XA 4E5NA 4XSHA 3KOWA 2Y77A 3MJDA 3AVOA 3MOIA 3IBFA 4QXRA 4JX9A 3MK31 3C6QA 2AJDA 1ZGZA 2EFEB 2BFFA 3ROTA 3TRIA 2XWBF 2ZI4A 3M6XA 2RK3A 5ECWA 3T5BA 5SZJA 3E27A 1TX4B 2Q5EA 3T34A 4C76A 4HN9A 3EUAA 1QQ6A 5IUJC 1EEXB 2V55B 4CT5A 3HCRA 5BWMA 1VA5A 2XUFA 3A7DA 1W581 3X2EA 1U94A 1WL8A 3KV1A 1F51E 3P2MA 4II2A 4QLAA 3SOZA 4BO1A 4BEJA 2VJOA 5JXIA 2FGKA 3SIRA 3STYA 3EGEA 2AI3A 4HEA6 1FTNA 3OH8A 2VXYA 3ORYA 4BMXA 1XQYA 3NYWA 5J9FA 5I4BA 4DZRA 1K1EA 2CFTA 2PBZA 5MDHA 4OG2A 2ZXUA 4KLAA 5LP6C 1XBTA 5CLJA 1Z6XA 4B7AA 5AVXA 3PR2B 1YVPA 1TW2A 5J2TF 4XM2A 1AGNA 5FI1B 5AH0A 4AKGA 3KQLA 3NC4A 4QLBA 2Q0XA 1KVUA 4FFNA 5B1YA 1K0FA 3DQQA 5CB4B 1JEDA 1MN6A 2D3WA 3KTOA 4Z4CA 2CN1A 1T9GS 2IODA 2R6JA 1QYRA 2XB4A 5HQ3B 2BM1A 5BWBA 5JROA 2AKYA 2BFDA 2ZREA 2CL6X 3AEYA 3DEYX 4DRYA 5KKCA 2JFVA 3MRTA 2Q4TA 4I2VA 3W77A 3ZDRA 4W5NA 3H83A 3JVUA 3UMYA 2EZ4A 1NUSA 4V02A 2YZ7A 1Y8QA 4NBRA 4NBKA 3ZDZB 5BQXA 3AUXA 3EFHA 4PBSA 1RADA 1RI1A 4N8DA 3CH6A 4A2PA 1DFHA 4LECA 3KYBA 1Z6AA 4RMGA 4H0CA 2HK9A 2JGJA 3AIIA 1I0IA 2GRUA 1X80B 3EG5A 4JKYA 2ZAMA 4F2PA 1ZC4A 3RNOA 4AJIA 1FVOA 4HGYA 1GYQA 4OA5A 1VSTA 1CUYA 5JHHB 3KXKA 1MTOA 3MPOA 1VDMA 4P35A 3TMKA 1LBSA 2P0AA 4XYGA 1DBIA 3EUEA 3TNJA 5B6PA 3MWEB 4M9CA 3VSAA 1G3RA 1WXFA 3H86A 4DLSA 3MELA 1RXIA 2RAVA 1J06A 2HOQA 2YCBA 3DLBA 1UMBA 3L1IA 1H8HD 4AY5A 1YZNA 1N5RA 2VJNA 5C4IA 5C7YA 5K8CA 1KNXA 4DBLE 4KIWA 8LDHA 1EB8A 1LRKA 3ZY6A 4NXMB 3G68A 3TAHA 4Q4AA 1KFEB 1ZZEA 4OLJA 1ZD9A 1BH6A 1CUJA 1D4AA 1ZISA 3LQ4A 4KXLA 1M8KA 4DJTA 1JAYA 3PEFA 1FMLA 1II9A 2G70A 2X23A 4U0KA 2P3SA 1A72A 3FYUA 3PGJA 3PXDA 2C99A 1PTJC 4YP1A 5FKJA 5KVSA 4DJDC 4P1ZA 4EYOA 3M6MD 1H5NA 2J3KA 5FB3A 4IIBA 5F5NA 3ZX4A 4MICA 3MT8A 3DVRX 2LD4A 3JV7A 2MINA 1L8XA 2G8LA 4HWPA 1M5TA 2IEGA 2OBNA 3IE2A 4Y18A 3UGQA 4AX8A 4DRXA 1UMCA 5L7WA 5ILOA 2NV0A 3R9WA 1E9EA 5C8VA 4E5PA 3S55A 1KO5A 5EEHA 1SXHA 1X7YA 5D86A 3N07A 4LZJA 1YMUA 2I8AA 1LV7A 4MVJA 5J2TB 4P2GA 5G4KA 2GJSA 4DWVA 5FTNA 3AWDA 3CVYA 2BMEA 2PKWA 4JI3B 1NMYA 3CN9A 3P9IA 2VRCA 1T0UA 3M5DA 3ZYCA 1DJLA 1EVEA 3H75A 3RSSA 3KPUA 4R8KA 3UOGA 2QD5A 3EEIA 1PD0A 4O4HF 4C4ZA 1E2BA 3Q5GA 1BXGB 4WTOA 1QO0D 4OA8A 3ICQB 1PLJA 1OKKD 5AJZA 4CU2A 2AG8A 4PLFA 1QXSA 2C7BA 1H1DA 1SIUA 2VP3A 1E5QA 2AFVA 2FQQA 3GJRA 4YALA 1Q1NA 5TQVA 4G6ZA 1PFQA 5JQGA 5LM3A 5TVGA 1Q91A 3BDAA 4MO2A 3CPEA 1RJWA 3NUZA 5FLYA 2LE0A 5IDVA 1FZTA 4J0HA 4FE4A 1AKTA 4DSZA 1OAOC 2O52A 3CRNA 3SGLA 5FDFA 5LQJA 4R7GA 4XD7D 3LCCA 4FDTA 2VK4A 2FRDC 3TQRA 4ECEA 2COUA 3HP7A 2W6ID 4MVCA 5ITSA 1G20B 2EHDA 3A4YA 3I9MA 4K5QA 4MHSA 5TJ9A 3T7IA 4B3XA 4D4JA 2WNIA 3AXTA 3OJWA 4TM8A 2PLFA 1R8YA 1CERA 1RLOA 3L06A 3WGYA 3G1TA 3HDYA 1F8GA 2BZ0A 4HX5A 3O03A 5DHUA 3SC2A 2VK8A 4KPEC 2YXPX 1J22A 1F4VA 1H1LB 1E2FA 2DR0A 3EXG1 3N2KA 3WLMA 4WA7A 3UBTA 3SDBA 1JHUA 2V7VA 4I08A 4QPPA 1NY6A 1JE0A 2HBRA 3R7FA 5A04A 5LD2C 1PW7A 2TSYB 3F6CA 3GPCA 1SKQA 4KGXA 3BF8A 2C92A 4G63A 1YIOA 4GBMA 3RUFA 4R0VA 1ZNYA 1V7QA 3FCYA 2ON6A 5AVSA 2OXRA 4KFRA 4ZI7A 4OFWA 4BECA 2Q21A 1IZ9A 1LPBB 2FPWA 2PT5A 3OWOA 4K2HA 4KHZA 4GSKA 1X1TA 4JLPA 4KVFA 4PRLA 3LC0A 2TS1A 4EKYA 4L57A 3HDHA 4U9IS 3UAWA 5LMNB 1IK6A 2F3SA 1KMMA 1AUPA 1WUJS 2CLKB 2FA9A 1KVTA 2BHTA 3S7TA 3TW6A 4QUIA 4N7BA 3UWKA 1RHRA 1X1BA 1OQAA 1XLWA 3GLQA 3VYUB 3VZRA 3WTBA 2H65A 1MF7A 1HL3A 1ZDMA 1VJDA 2RGEA 3CG4A 1A76A 1BXZA 1VFPA 3MJSA 3TFQA 3UK2A 1PT6A 3HDQA 3OLYA 4GR9A 3BFVA 1Q0LA 4FDAA 4KQXA 4KW7A 1HTBA 2CT8A 1IU9A 1XYGA 1ZW6A 1OLXB 2VR1A 1B00A 3KVRA 3ZUGA 2WU4A 4RSRA 3HCWA 1T6BY 1X13A 3H8WA 3DKKA 3PGXA 4IXTA 1G16A 2C03A 4JBNA 3DSRA 3AFOA 3IURA 3JQBC 5HGXA 1DQZA 1CJUC 4O4HB 4H0FA 4JV5B 3CEMA 4NZOA 2BD0A 3HABA 5K0BA 3P4UA 3IPLA 2QRPA 4WKPA 2AZ4A 4I5GA 4M4SA 1EFCA 3C7KA 1BJTA 1XRPA 2DLDA 2EFCB 1L5QA 4LYAA 4OIMA 5EP1A 3IHKA 5TMPA 3CNNA 4YP6A 4JA2A 1SVMA 3ZQKA 1P4GA 3GFVA 3RTAA 4JUIA 2EEZA 2QORA 121PA 3ZE6A 4A2QA 5KYGA 4HAYA 2ZVPX 3HDGA 1BJRE 3OE7A 4IQGA 4CTKA 3N2GB 4URUR 1NG9A 1JR3D 2Q6KA 4RK1A 3QLJA 4ZAFA 1YJQA 2FMFA 2PVSA 3HVIA 4IUDS 2R1VA 4K9NA 3EXEB 4HQRA 4O1IA 1IONA 4QOSA 3HC7A 3AEZA 5KJEA 2EGUA 1DKOA 1N78A 2AJ8A 4AG5A 1Z2CA 3B48A 3U7HB 1QH9A 4EB6A 4P3XA 2YQ5A 5BY2A 2REQB 5FHRA 1V47A 4ENUA 1AKEA 1E8DA 2IY7A 5E1OA 3V1MA 3LBFA 2HSGA 3AJRA 2WAMA 2QQGA 3VPHA 3SVLA 2B69A 4NYMR 3KJNA 4ZV9A 1I2BA 1OC2A 4EARA 2QMUA 3KWJA 3NPAA 3ENVA 3RLIA 3ZY2A 2E7ZA 2D7JA 2IUSA 2CCGA 2QAIA 3ENQA 3JQAB 5CXQA 3ZU6A 3F90A 4RPGA 5COQA 3K3PA 3PDIB 1WVMA 1T8SA 4ZWNA 2WJGA 3ZX5A 4OJMX 3O4IA 1X7ZB 2A94A 2ONKA 4JCCA 2Z5FA 4IDAA 2X9VA 4JUDX 2FY8A 3MJVA 5ENZA 3OSUA 3GLGB 4QT0A 3MMPA 4GICA 1H4TA 2GMWA 5FPHA 5K3FA 2HMTA 2NZYA 2PDAA 4LOJA 3DKRA 4BQFA 4IRMA 3BA6A 2IL1A 3D2BA 4L27A 1ULHA 1R0RE 3A27A 2K5UA 3FJ1A 3Q87B 3MJEA 1VCNA 4F72A 2O6HA 2A8YA 5ES3A 4OJKA 4EIWA 4C0HA 2YYZA 4MPPA 2IYOA 2WFLB 4YK7A 4M60A 4RH1A 4ND8A 1ABFA 2DF8A 1ZWLA 2ZBDA 3GH1A 4HH4A 4J7UA 1EWVA 2YC4C 1E2EA 3FDZA 1OFIA 4ED9A 1MRSA 1S2GA 1QZUA 2ZT8A 3QWIA 5DYNA 3UK1A 1XMSA 3OE1A 4NG5A 1UXOA 3BTOA 2V3VA 3WNVA 2NZ8A 4CQMD 4NFYA 3GBSA 3W6NA 3KU1A 4J43A 2GF9A 3DJYA 1Q14A 2FB9A 1Z29A 3V4RA 1CX9B 2YXNA 1Q0TA 2CFIA 4ZZ1A 3DR3A 4JFAA 1KEKA 4UNPA 1KI1A 3JQAD 1CUDA 4G8CA 1C2TA 3ZS8A 5CTJA 5ECGC 1XDDA 4XEHA 4E5SA 1RFLA 3Q7TA 4ZHQF 2IV3A 4TV9F 3OECA 4QT4A 1JU4A 1IBSA 2OLJA 3HVRA 3H0EA 1PT5A 1WZCA 5B55A 2PPVA 1N5DA 1VJRA 3AOEA 4YTEA 5C1DA 1QYWA 3EIFA 3TLAA 1XVVA 1K06A 3NTOA 5IDYA 4KQJA 2ZUEA 1H5UA 2IJGX 3Q8XB 4FNAA 4HEJA 1NP6A 1SUBA 2E18A 3KCQA 1GPAA 4LBVA 4EG1A 3TJRA 4YA6A 3OPNA 1XCGB 2F3PA 3FMVA 3OURA 5FYQA 5A06A 3M4ZA 3OCZA 1FBNA 3OWHA 4JSTA 2VA8A 2L42A 2O8BB 1RT9A 3ONWA 1E1YA 1TIKA 1UXGA 2VPQA 3C6KA 5E7IA 1PT8A 1RP7A 1GZ4A 1H3NA 2Q5FA 1DFGA 4CV0A 1XMQB 1M2OB 3CPHA 1CEQA 1OH8A 3ICVA 1GA1A 2BTOA 1ODSA 3GG2A 1RLTA 2A9QA 1OX5A 2HWYA 3CIFA 3IEVA 4IRUB 3ZBUA 2ZUBA 1GYPA 3GLIA 3PWSA 3EOZA 1YCFA 4EHDA 3N0VA 3QV1A 2WD7B 4HPXB 1XJ0A 3HV2A 2I34A 5HKLA 3QMWA 3RUPA 5BVGA 5EKDA 3CEPB 1N7HA 3VX3A 2PO5A 3AR2A 3HB0A 4FE7A 2BC9A 5FI3A 4PYRA 2CNOA 4PZPA 2F1HA 4BO3A 3GAZA 4YAGA 2BR4A 3WFZA 4ND4A 3EEFA 1C8LA 5K0CA 1QP7A 3I1IA 1AV6A 1ZH4A 1C0EA 4F3CA 4QYMA 1EAMA 1SVUA 2J6HA 4DCCA 1NI3A 1NUAA 3BZWA 5FBZA 1IBMB 2GCOA 2ARKA 1JIVA 2AJLI 4M1SA 4NU0A 1DWPA 1WRBA 3ZDBA 2ZBQA 3UHOA 2PUEA 2B5OA 4FR0A 1A7JA 4G0VA 4F45A 2VDNB 3OJLA 5DTEA 1D1TA 1U2RA 3C87A 4K26A 2DY0A 4RD3A 4PAQA 4UARA 2XGGA 2DFVA 4KV7A 4M1YA 3SS9X 1ZW1A 4BU0A 3HR8A 3U7GA 1W5SA 4X6LA 3WGZA 3D8TA 4ZHQB 4F46A 3B5IA 1ZD8A 1K8RA 2H57A 5KCZA 4J2OA 1HC7A 2B8NA 2LR0A 1P7VA 1ONNA 3CF6R 3OQVA 5AK6A 3V4LA 4CTJA 4YCLA 1PTJA 2XRMA 2R84A 3S44A 3PZRA 3PTAA 2ST1A 3OOJA 3S2GA 5EUMA 4ANFA 1JEJA 1USVA 1B0AA 3R0ZA 3K2BA 1QNLA 3ORRA 4E4RA 1EFKA 2H1CA 1HFWA 1EUCA 4RXMA 1QDUA 1WD7A 1CP3A 4L0QA 2NZ2A 2Q4OA 5TARA 4M1OA 3A1TA 2XMZA 2Y1LA 4L75A 1OOEA 2PGAA 2LDBA 2GN8A 1XVUA 3HBMA 3ISJA 4YLYA 4U7JA 4KAJA 3NWPA 1Y5LA 4N54A 1O54A 3FNBA 4S24A 1COZA 2Q49A 5DZSA 4C2AA 1W5AA 2J30A 4MEJA 3L4BA 2C7QA 4WX2B 2QIOA 1QP8A 3G6WA 4QOEA 1RIIA 3PXAA 4JJFA 1SKYB 3OETA 1RWKA 3QBJA 2KLHA 4XARA 3TBHA 4BL5A 1LCIA 2K87A 2BGWA 4NCBA 2FSHA 3VR3D 3J7AC 2BFMA 1Y37A 1BEZA 1Q2XA 2WZBA 1FUIA 1FFXB 1HPLA 1PR4A 1UMDA 1GQSA 3F67A 3HWWA 4G4SO 2BGGA 5E95A 3PV0A 2PIAA 4QREA 3P27A 2IHNA 1U8EA 3I5XA 4Y1RA 3ZK8A 3E84A 2HMYB 4G25A 4CKEB 1E60A 2FXVA 2WP0A 2FZLA 3NOOA 3BXFA 1D2MA 2BP7A 1GUAA 3TZQA 4D82A 1FFBA 1H65A 3H2BA 3MCZA 3L01A 1T8YA 3Q11A 5CVJA 4LK2A 4C6HA 3MTBA 4GM1A 5DCWA 4EQ6A 4Y2GA 4DMHA 2G1KA 2X9QA 1CWUA 1JT9A 3A37A 4FS8A 4ZMBA 4EBBA 2BJVA 2VNHA 5DRYA 4CMHA 4NENB 5ALDA 1JSLA 5KSWB 3SI7A 1TTPB 2WBLC 3CN7A 3EGCA 1UBLS 2COKA 3R9IA 4ALNA 4C6RA 2ZJ6A 2HQRA 4HDRA 3IT3A 1KPHA 3ASVA 3DC7A 4EFNA 4B09A 1G66A 2YJGA 4F12A 2BRUC 2EBFX 5ADUS 1J56A 1P60A 1GPNA 4WGFA 1QHEA 4B2PA 1BTOA 2XQFA 1IUKA 4S1PA 4B33A 1I9GA 3TSOA 2IVFA 3LIIA 5JADA 3RVJA 4BZQA 2J08A 4GNRA 3QFSA 3RFXA 4JVSB 4ZEVA 5KNBD 3OZIA 2PX6A 1N33B 1EZZA 3O4FA 2GKGA 3QVXA 5JAUA 1UP4A 3PITA 2CZQA 3WHKA 1GAXA 1NUTA 4EDFA 4K9PA 1LGYA 3CO0S 4LV8B 3CR8A 2Q5QA 4BGUA 5CFRA 2Q4RA 5ELLA 1FIUA 1FQJA 1RBZA 2YJ4A 3CGGA 2WIKA 4OKSA 5CLIA 2IDKA 2OO3A 3DE3X 3PA6A 1RHUA 3IIKA 3BJMA 1ORDA 3ORFA 4XYMA 1T24A 2IPLA 3IP3A 4GPBA 3OLWA 1WCIB 1K5HA 1SRRA 3N05A 4J03A 4C0QC 4LJRA 1L5GB 1JR4A 3BTVA 2GCPA 4L85A 4F97A 4LC9A 3NDJA 1NTRA 4QOGA 4BNTA 3CLSD 4IZHA 2G9VA 1TGVA 4PX5A 2JFNA 4QKQA 3PQ8A 2XVAA 3W90A 1N2CA 2OB1A 4PEVA 1SQSA 4CL3A 2O8CA 1VB3A 5AW1A 2Y1XA 3N0WA 1UT8A 1WPGA 3K8OE 4Q7LA 2ZTSA 5F51A 3S2EA 1KI4A 4QUDA 3T9EA 3WLTA 4DCOA 1PZFA 3GLFB 4HQNA 4JJ7A 2WFMA 2JBWA 1TKBA 2JFZA 2J4DA 5B1HA 1ESEA 1K8XB 1G21B 3AVYA 4J3FA 1WE2A 1WW8A 1YUMA 3DYIA 1VXRA 3OWXA 3WOHA 4F9GA 2CYAA 2PJRA 2XTNA 4TMZA 3I72A 2WLSA 1N4AA 4DMGA 4DBLC 5I7EA 5LZ2A 3GARA 5BWCA 3PU6A 1EJ2A 3QM1A 1AS2A 1YKSA 4YX9A 5HF9A 1AS0A 5K3AA 2HDWA 3BHJA 1CTQA 1EGHA 2O2ZA 2JASA 1RE1A 1Z17A 3HCNA 4P3NA 4AC9A 3RFCA 2A1TS 3CVXA 1FNNA 3NS7A 3DZKA 1R9JA 3LHDA 4ZVOA 1HMYA 1UOOA 2R9VA 5E6SB 4AS3A 5TSDA 4BB0A 2P35A 5KTNA 1JZQA 3GRVA 5ALUA 1NTOA 2BM9A 4BO0A 2P2YA 4WBXC 2X76A 4YH1A 4CIVA 4F8YA 3JATB 2N46A 3MW8A 2H29A 2PGOA 4RZIA 3QBTA 2OHXA 1XZCA 2O2HA 2WWVD 1MC8A 1K8QA 3ZHOA 2ORVA 5HUJA 1O0CA 1YDGA 2PBLA 3V1UA 1AXEA 4JT8A 2BR3A 5COBA 1XQVA 4KR3A 1NNI1 1O95C 3EXIA 3GCGA 3QENA 1ECCA 1V7ZA 2EJBA 3D1VA 4IJKA 1V3UA 1VE9A 4D92A 1QH0A 4CGZA 4UPVA 5JPIA 3TB4A 3PIRA 4INJA 3R6GA 1IVSA 2GAJA 2Y9MB 3RUDA 3G8CA 1M2VA 4W5HA 4KE7A 1D6SA 2LWIA 3PRJA 2XD9A 3RF6A 5HM6A 2PH7A 1M1UA 3I1YA 2ZYAA 3ZLTA 2BM8A 5E1MA 3SPXA 3QX7A 4DLKA 5LWQA 3MAGA 3B3JA 3FF1A 2I62A 2NW6A 2Y0BA 3AM3A 3OPMA 1CYEA 1RPNA 1S8OA 3DVAB 3P0EA 4P4GA 1PQUA 1VJ5A 2JI7A 3VPSA 3LHKA 4MW1A 3KQQA 2D5IA 2GWHA 3OZSA 3KQYA 4DV1B 4PSDA 5EZ6B 4HNTA 1RU3A 1U7ZA 3C8UA 4PYLA 3SU8A 2ZZKA 4GOMD 4R7ZA 5B37A 3ZGNA 5JZBA 3E0QA 3FPEA 2VBCA 5LOVB 1SHTX 3IX7A 3QUBA 5I8ZA 2ZTMA 4WE3A 5IXSA 1E3WB 3EFEA 3ZYZA 3DCJA 5HA5A 2CVPA 3I9KA 1YR2A 5ULLA 4JI6B 1W7AA 4G8JA 4DA4A 4PC1A 4CEHA 3GNSA 1F9AA 2C61A 3KB6A 1Z0KA 2YQ4A 1USUA 3ZWDA 1YT5A 2ZR8A 3B12A 3KL4A 4HMPA 4A8JC 2FJPA 3JSXA 3LL4A 4MW7A 2DBRA 3PX7A 2M9MA 2ZIGA 1XVAA 3KLMX 1N1DA 4B9AA 3RREA 4J0QA 3V2UA 1WXQA 3ACBA 3DFKA 1M72A 5AVUA 1XGKA 2PMKA 5HDQA 2CXQA 1X70A 4IOJA 3WLFA 4EG6A 5LYJF 4X90A 4D9CA 4TWZA 3GGGA 1EHYA 1KY2A 1CC1S 1MO2A 2R8BA 1N7GA 3K6RA 3MMNA 5IH7A 4KOAA 1TT7A 5IH3A 1UXKA 1KYTA 4OH1A 4Q00A 4DV6B 3O2SB 2ZRKA 2DB3A 2IHBA 2JGAA 3PDCA 2XWPA 3JVIA 5HKKD 5JO9A 3B51X 4NG4A 1HG0A 4BUJA 4BU1A 5E8JA 5IF3A 1U5CA 4BJ3A 1XZPA 3E03A 2HX1A 3SJCA 5JD5A 4W6ZA 1QE0A 2KI5A 2AHOA 1WKBA 3K9WA 5EMLA 5EUQB 2AI2A 5CW2A 5LUAA 2JGNA 4A6EA 5KX5A 2UAGA 2BFBB 1FYDA 1SEPA 1ODLA 2R8OA 3DCYA 2XEXA 3P7MA 2VTBA 1PWXA 3WKDA 5TIIA 4MQ4A 1V8ZA 1ZEJA 2NXJA 3SN6A 1Q1QA 4UFOA 4MUNA 1SBIA 1P2TA 1P2UA 2PZAA 5T7BA 3F9IA 2V4MA 3V8PA 2FKNA 3MWYW 3IQDB 4G0YA 4IIVA 1W6UA 5CURA 1SU4A 1RR6A 1WJGA 2NXCA 4BWGA 4CODB 1PJAA 1JSRA 1Z0FA 4DY4A 4Z7JA 5CYPA 3ROZA 3VMMA 2Y71A 3PICA 4QPDA 3OA0A 1MNAA 2HKIA 1ITZA 4ND3A 1KMIY 4CF7A 2P6PA 1QHGA 4MRPA 4Q7MB 1UKEA 4CT0A 3FHOA 5B3JC 1BU5A 2IS1A 3QF4A 4DY6A 2O3JA 1G6KA 1ECBA 1FNBA 1KI9A 1OXTA 3QNMA 4N18A 3DMTC 5AM2A 2Q3JA 2N47A 2OP0A 1GGKA 3G2KA 1USKA 3RRYA 4G1FA 2YZMA 3FOWA 3MCTA 5ADWA 1NY5A 1DIHA 4CG0A 1YR1A 2ZYDA 2C4TA 4GZ3A 1NWHA 4ICIA 5CLHA 3SBOA 1QGUB 3VX4A 2NO0A 4AJ2A 5KCMA 4DLNA 1Z8HA 3QLUC 4KZPA 3KU4A 2WIGA 5IAOA 3P2JA 2CLCX 5CR9A 2OCBA 4DYHA 3FLMA 4E0BA 3WRXC 4WAUA 3BHIA 4FOPA 3ND7A 1E5DA 3W2FA 1QFSA 1YK0A 1T5DX 2VTVA 2IOQA 3IGFA 4BX0A 1P6XA 5ENDA 4ZCPA 3CUKA 2J0VA 4H18A 4IINA 4JIMA 3G85A 3HVUA 3QW4B 1PR0A 3I04M 5DM2A 3WI7A 3ZTTA 5C1OA 1CUXA 3JR7A 3USZA 4Y2RA 3ML1A 1Q0ZA 4GOLD 1GLNA 5AWFC 1U8FO 3DEAA 1GUYA 3NCHA 3KQTA 2QN9A 5CVCA 1IY2A 3RC2A 1ZITA 3CV3A 4UUMA 1YR7A 1K75A 3C3PA 5FT9A 4JBLA 1IQPA 3AESB 3WSVA 3KHTA 2Q50A 4XB6B 3RYFA 3AX6A 3Q2KA 4JT4A 3ZWNA 4CDRA 2YW9A 3LTNC 3LHFA 5JS6A 5IT5A 2ESRA 1U8XX 3QSGA 3AVXA 1LJLA 3BMCA 1FP4B 4RSGA 4DCUA 4PQRA 2YHIA 2ALJA 5LMUB 3K70B 3K8QA 1E3SA 1NUUA 2WAAA 3CGWA 2FQXA 1QGDA 3GDGA 3E7XA 3HYLA 3P2KA 3KUDA 1V6CA 2KB0A 2GKOA 4RJLA 1VSVA 2YXDA 4TSKA 5T4EA 4RJ2A 5LNK1 1D07A 5ED4A 1DNPA 4ZQBA 3SBEA 3ME5A 2Q5CA 3DTVB 1JNYA 3N53A 4IHJF 3QX9A 2AI1A 3PE4A 3L0YA 3W05A 4AMYA 3FYTA 3MWFA 4LI0A 3FOEC 3PLRA 5E7QA 1LSOA 2QLTA 2R2GA 4KOEC 2DH5A 4FXOA 1YF3A 4MV1A 7REQA 3GNLA 2Y05A 1X1QA 5K4AA 4GR5A 4ZEWA 3LYUA 1QVRA 4US1R 5C2JB 2VUHB 2C9OA 4JWKA 3LECA 4PSCA 3MYRA 4RD6A 1WSDA 4FMPA 1O97D 5KQSA 1SURA 5EJAA 2ZRFA 4Y2YA 3C2QA 1ISMA 4C14A 2IYXA 3OLQA 3M6IA 1NVXQ 4LSGA 4AWBA 3H5TA 4N0EA 4C03A 3AEQA 2QE7A 3K70D 3E48A 4HTAA 5L3QA 5HILA 3K0CC 1HZZC 2AHRA 2C3YA 3A25A 1XZLA 4RU1A 4U7HA 3U56A 2DRIA 1QIJA 1XAGA 2CMKA 3GMTA 3GJYA 4MLCA 2ES4A 4MTCA 4NLLA 4F5WA 4B3SB 3QVMA 5KWJA 4LYHA 3HNPA 1Q1ZA 2ZBUA 3DTVD 1FXSA 3PFFA 1AVTA 1K7EB 2GPTA 5JW6A 5BXQC 4UU7A 4JGIA 1F9EA 2QGZA 3CZQA 2FSPA 3G2NA 5DM60 4C4XA 1LTQA 3TLYA 4RNDB 1CD5A 2CJPA 3CCFA 3V34A 4F4HA 1AKNA 1FNMA 1X0VA 2JI9A 3BG5A 2XY4A 2CMHA 1VLQA 3GN1A 4Z51A 2BZSA 1EESA 1DCKA 4O6VA 4EUNA 2OG1A 1SXJA 1OGJA 1C8BA 1LS1A 3WBJA 1JZSA 1PVDA 4GVXA 4BNYA 2GAFA 1NF2A 2H00A 2HN9A 3TVYA 3FG9A 3P5BA 3WYCA 5JSHA 5LQDA 4AY2A 1P4HA 5ALXA 2J7PA 3M0EA 2GCNA 2ZTHA 1WHSB 2YV5A 2VZLA 1WLSA 4X60A 1B6RA 1SCKA 1ZJZA 2VRWA 3CXRA 3QOWA 4YN3A 3EFBA 3VHRA 5EVCA 3ETJA 3I28A 3KTAA 2WWFA 5BR4A 3PUHA 1VPTA 2AH5A 1GU7A 2JFHA 2VHVA 3EISA 3L9XA 1JFVA 3OFSA 4HQ6A 3SJAA 1ZM4A 3GA7A 3CBGA 3BXPA 2H4JA 4O4JA 1CKEA 4UD2A 3I2JA 3EQ9A 3LUDA 3VFDA 4AM8A 4JWTA 3DXYA 4DMUB 2GBIA 4UDXX 3EH1A 1QCYA 1OXMA 4RNCA 1T0IA 4JOBA 2Q41A 2W2KA 5KVQA 3T1VA 1OZGA 4BMPB 5BMVF 1LJUA 4DIFA 1GAWA 1YR9A 3AHDA 3D4PA 5E2AA 2Q4DA 4CF5A 3S81A 1OIWA 2R1ZA 5C8DA 4NBSA 4DEYA 3KAKA 2Z30A 3K0BA 4JQOA 3CH5A 5DBEX 1NI4B 1J5XA 2EOAA 2HFKA 4IGFA 4PO1A 1C50A 2C31A 3E81A 2VYVD 4JOQA 4ZOLB 2WM2A 4FC7A 3MUFA 3P9YA 3SEFA 3D6HA 2HJRA 3DXXA 4MWBA 1KDTA 4QRDA 3HY3A 4RPKA 3UH1A 1PS8A 5IJ0B 1Z38A 4Y2XA 4D3YA 2QE6A 3TRKA 4AD8A 2ZBVA 3T3OA 4MPJA 1XXHB 1O95A 4AWXA 4MUJA 3LF1A 1QF9A 5EYPA 2IHJA 2NSHA 5J47A 3EA0A 3NRBA 4YDRA 2QJTA 5CP8A 3THXA 4RJJA 2A4KA 3ICEA 5EP4A 5DMXA 2GOYA 4Y2UA 1Z4PX 3JXEA 2AR7A 3ABQB 1YQ9A 3NJ8A 4YJKA 1KE1A 1E20A 1T3LA 3LX6A 3VNRA 1R0CA 3I34X 2V6IA 3QKRA 1P19A 1SG6A 3ZHVA 3BMQB 2HR1A 3I3SR 2H5IA 5LXTA 4KNWA 2JDID 3G2JA 4J90A 1G7CA 2JD0A 2W42A 1VMEA 2ZIXB 3DBHB 2UZ4A 1UDRA 3LT1A 4XUCA 4BPRA 3MQ4A 3E9NA 2HH9A 3GUCA 2V54A 1CR2A 1G17A 1SUCA 4BNMA 4P7FA 5BUZA 3HGMA 5I01A 2FU5C 3HSKA 4G07A 1G59A 4JUAA 4DPMA 3E1GA 1U2GA 1ZIXA 4AYWA 1EGMB 3RFTA 4AZWA 3HY6A 3VU9A 2IV2X 4POAA 4CLEA 2Z5VA 3LYHA 1GEGA 3G5MA 1ZPDA 2I71A 4X3CA 3SLKA 1QR2A 3VZQA 4QFDA 4LBWA 2WYIA 2QBYB 1SO8A 5IN4A 4HO1X 1IY0A 2IEIA 2P2CA 4I1UA 2M6LA 1DCTA 3R3ZA 2MSEB 4A8JA 2MSDB 1LVGA 4MAFA 3GEPA 2RIRA 4ETWA 3H0CA 1T9GR 3AF2A 2QENA 3UAXA 4ENTA 5JJ5A 1JEQA 1RNLA 1P17A 1WMDA 4U9UA 2F8LA 1M1NA 4WOPA 4D41A 5BMVB 5CT8A 1ZC3A 4CMIB 5C8ZA 2PGIA 1JSZA 1YI1A 3FD8A 4P4NA 1N36B 3DO5A 3SDZA 1Z4JA 3QYJA 1M8JA 2J59A 1RM5A 2JAWA 3LGAA 1U3WA 3BICA 3H1FA 3QKIA 3ZZUA 1A9ZA 2WJIA 5DGIA 3PGMA 1SOUA 3GUHA 1IOLA 1CULC 1ULZA 1ODTC 2FFHA 4I2NA 2V58A 4V24A 5TY0A 2I7VA 1BXKA 1PUJA 1ICIA 4FHEA 1YRYE 4CKCA 5CIQA 1ST3A 1E94E 4DSUA 4F2DA 3ZH2A 4AKHA 1AGRA 4WCVA 2I8CA 3TL3A 3UJ8A 1GDTA 2QZJA 4CLXA 3QI7A 1BQ3A 2IHKA 4BJ1A 3HLKA 3QTLA 4Q19A 2B3DA 3DFZA 1TA9A 2PTHA 2GN9A 3P4XA 3TWOA 2GUGA 1ZR4A 1PJ4A 3FSJX 3UO8B 4XAQA 1WETA 2H1SA 4HLUC 3HKBA 3KKZA 1PWEA 4CF3A 3VR6A 3CVVA 4FWTA 2GH1A 4F85A 4REOA 1ZH6A 3EVDA 5C8XA 3DVSX 4JLKA 2GN2A 2JHGA 2R7NA 3FZGA 2V6JA 4KPGA 4CHTA 2RGGA 1TVEA 4FFVA 3F74A 4GC9A 5B7PA 3HQ4O 3FOBA 1C7IA 4DYVA 3GYGA 1Q6ZA 1G5RA 3NBZC 5KTTA 3VPDA 3NOVA 3OOYA 4EB8A 2X14A 2NQ2C 5NLLA 1MOPA 3DDOA 3E7DA 3OIUA 4CEJA 3C1OA 4R9RA 3DMTA 1G7RA 1P4JA 4ACBA 3QKUA 1XD2B 3H5IA 3GRKA 4PLGA 2FP4B 3GQBA 4B3CA 1KYWA 3ADOA 2GERA 4YJHA 5EY5B 4D5EA 4GKJB 1RHQA 2P9GA 3GL9A 2AR9A 3BXHA 1GITA 3OTWA 2I7CA 3IMEA 4JYBA 4L3VA 2G71A 2IYTA 3CPJB 4QFCA 5B58T 2Q1YA 1XHLA 2R6DA 3HVKA 3ZGZA 3GAMA 4XRRA 1YONA 4QJ4A 3QNUA 5F5XA 2IZ5A 3RFFA 1JKJA 2JFUA 2WE7A 3CH7A 2ECQA 3Q85A 2VQEB 3AQ4A 4TYYA 1ZJ4A 2W6MA 3QGMA 1AS3A 3EDRA 4DBVO 2EJTA 5F1YA 3FBWA 2