2PX6A

Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
253
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQPTHNSLFLFDGSPTYAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Thioesterase domain
total genus 86
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 2px6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2px6A01
2WIGA 1MNQA 3LIPA 3KOOA 1SCKA 2HIHA 2XB6A 3DL4A 3WL8A 5AKJA 4OU5A 2FJPA 3I2JA 4ITVA 2VSQA 3FSGA 5AKLA 4PSCA 3GFFA 2JBWA 4BRZA 4XVCA 3WI7A 2W6CX 3QZUA 3LS2A 1MX1A 1RYYA 3V9AA 4B81A 1BCSA 5JIBA 1SFRA 1IVYA 5CMLA 4EZIA 4I3FA 3WK9A 1QIDA 3G02A 1QOZA 3HI4A 4WFIA 3BDIA 1E8MA 3WQHA 2XUJA 4I19A 3QVMA 4Y2YA 1AZWA 1QJ4A 5EHZA 2JGLA 2HA4A 3AZOA 3BWXA 4RNCA 1IZ7A 5DLPA 1PV1A 4B9AA 2WJ3A 2PSDA 4KE9A 4ZREA 1CQWA 2C7BA 3NWOA 1CUSA 4KRYA 2WM2A 1Q84A 4UFNA 3FYUB 1ODTC 3RM3A 5KWJA 3C6ZA 3STTA 5JAPA 4UHCA 3W2TA 3I2FA 5IVHA 3H2IA 4Y9SA 2ES4A 4DGQA 4X93A 4X97A 3AUKA 4FLMA 3O4JA 4Q82A 4B7ZA 5HKAA 2IX9A 1DINA 4AXBA 1CQZA 2JGMA 3UMJA 3R3WA 2YASA 3CCCA 5CXXA 4CFSA 4BCCA 3TEJA 3WK6A 3WZMA 2HA3A 4OUKX 5T4EA 3DS8A 5C8XA 4F21A 2XUHA 5DTIA 3KXPA 2WU4A 2C5GA 3IVMA 3G0BA 4M0FA 2PSHA 1YASA 2OLEA 2XQFA 5K3BA 2Z8XA 4HXEB 4PNZA 3N2ZB 2I3ZA 1VZ2A 3ANSA 2WFMA 3U1TA 1VXOA 3GUUA 4LYDA 4KAJA 3H2HA 5AI9A 1YCDA 2AJ8A 2X5XA 4KEAA 1O6GA 2XI4A 1ZD2P 5A7FA 1XZCA 1XZJA 3C8HA 4EUSA 2WUEA 3PF9A 4BAGA 3HABA 4OB7A 1MAAA 2PUJA 1WB5A 2QMQA 3IUJA 5ALJA 3WKCA 1BN6A 5AKIA 4MEAA 2G5PA 5JZSA 3O95A 5A71A 1DWOA 2E3JA 4JYPA 4MWSA 3WK8A 1TCAA 4FKBA 4CG1A 4BP8A 3B5EA 4EB0A 1CUHA 2Z3WA 4QNNA 3ILSA 1EDEA 2XMDA 1E66A 4U2DA 3FVTA 2WTNA 5HFNA 3FOBA 3ESAA 5AKYA 4B80A 2QRUA 4GHWA 3H1AA 4WY8A 3DD5A 3M3DA 1HBJA 3N0TA 1UOQA 4LXIA 1VE7A 3WYNA 3HZOA 4UBJA 1XRNA 2WLSA 1ZD5A 5ALPA 5HZGA 1UOPA 1QE3A 1GKKA 1XQWA 5I9IA 2VJBA 2OXEA 1XZHA 3G7NA 1WB6A 3DOHA 1LPBB 1XRQA 1QGED 4V2IA 4QDZA 2XMSA 3I6ZA 3V1KA 3DKKA 4P93A 4EBBA 3FLEA 4M0EA 3AZPA 4BCBA 4EY4A 4ZWNA 2AXEA 1ZJ5A 2JEYA 3IUQA 2WIFA 3BIWA 3E1GA 3ED1A 3HLKA 4LHEA 1QFSA 3BJRA 1HKHA 2J4CA 1DWPA 1N5RA 5BOVA 4UHDA 1VLQA 1B6GA 4M0MA 5DNWA 1H2WA 5AO9A 4BVJA 1ORWA 3DKRA 2GYUA 1DU4A 2GYVA 2JGFA 4G8DA 1GZ7A 4Y7DA 1BEZA 1OXMA 5LIPA 1L7AA 4J0JA 1EDDA 4IH1A 2HFKA 4K6GA 5K3DA 2HA5A 3BJMA 1ZJ4A 5HF9A 3AIMA 2J3DA 2XQGA 4Y2QA 2OGZA 5IH7A 4KACA 2DHCA 3I2KA 3L1JA 5ALWA 4W63A 3AIKA 2VQ6A 3P2MA 5AP9A 3WLAA 1XLVA 1GGVA 1BS9A 1N1MA 1QTRA 3BXPA 4X71A 3WKBA 7YASA 2WIKA 4H0CA 1QIFA 4BZZA 1T2NA 3FWHA 2ZYRA 1ORVA 4NMWA 1JU3A 4DNPA 3BF7A 2XLCA 1SC9A 4XWGA 1R9NA 4X92A 5FPQA 5K3CA 2JEZA 1EINA 3IIIA 3Q0TA 3D3NA 5DNUA 3FAKA 1ACJA 3WK4A 1R88A 1Y7IA 5ALMA 1F0PA 4QWWA 4WDQA 3I2GA 3CN7A 1AURA 4Z49A 3FYUC 4DLNA 5JYCA 2O2IA 3UUEA 5BWCA 5ALXA 5ALQA 5JASA 3OM8A 2DCMA 3D5EA 1Y7HA 2YXPX 4GWLA 2DQZA 3W06A 2Z8ZA 3FSGD 1CUVA 5HQ3A 4JNCA 3WWPA 2C5FA 4B6GA 3STVA 1P0MA 4ARAA 3I1YA 1WPRA 4C88A 4Y2XA 1H22A 4S0XA 3G9UA 1DX6A 4TGLA 1JU4A 1X2EA 2B9VA 2G4LA 1ZD4A 5LZ2A 2VEOA 2WUFA 3NUZA 5AK5A 1A88A 4DYHA 1EK1A 5CH3A 5E4JA 1CUEA 1XZIA 5EGNA 5EHNA 1UZAA 1XZDA 4ZV9A 1VZ3A 1ISPA 2BUCA 2B61A 1VKHA 2RONA 4DM7A 1UOOA 4K5QA 1FJ2A 1DQZA 3CXUA 1CUBA 3WWDA 2QXTA 5JAHA 4DMHA 1FFAA 2HRQA 4FTWA 3WWOA 5AKHA 1MJ5A 1BN7A 2JIDA 1XZFA 1K8QA 4FBLA 1XZEA 3OG9A 4BATA 4ZGBA 2Y2VA 2ZJ7A 2QKYA 5EIEA 1SOMA 2BKLA 1LPNA 3ESDA 4HRXA 5BWBA 1CRLA 1XLUA 4AZ3A 4BYMA 3WL6A 5AI8A 3WYDA 2OQIA 3H19A 1XZMA 3I1IA 3C5WP 4IQ4A 4EA6A 3LIIA 1MN6A 3FBWA 3O0DA 1C4XA 3ZLTA 4J0CA 4DNFA 4W1PA 1MX9A 5FUMA 4L0CA 4YX9A 2XUQA 3WKAA 1CUUA 1M33A 4BC1A 5LZ4A 1XFDA 4C4YA 2QTBA 3HJUA 5LKAA 1CR6A 1ODSA 1QTIA 2XQJA 1EVEA 1CVLA 5JATA 4KAFA 1P0PA 1J07A 3AIOA 3KD2A 3DCNA 1XRRA 5CT9A 3WIBA 3OURA 4XIIA 2H7YA 3C43A 1N5MA 2QJWA 4Q1VA 4KRXA 2XUAA 3VVMA 1YA8A 1AQLA 3S8YA 5LZ9A 5ALRA 4J3JA 1E89A 3G8YA 4FBMA 2O7RA 4OSEA 5ESRA 3BDVA 2PBLA 4QWMA 3I2IA 2OGTA 4QDUA 2Q0XA 5CT5A 4UUQA 2W22A 3NOXA 1MPXA 5ALIA 3ZWQA 2XMBA 3ICWA 6YASA 2VJCA 3JWEA 5A7GA 5E4YA 4A23A 4N8DA 4PSUA 3AJAA 3U0VA 2HHAA 1Q0ZA 2P8SA 1BU8A 4Y2SA 2IITA 2XMZA 1R50A 2XUKA 4UBKA 5SYNA 5FKJA 1U8EA 4NVRA 2J4FA 3O4HA 4A5SA 2ZJFA 2CEKA 2AJBA 5AK4A 1XRMA 3PFBA 3R3ZA 4UBNA 3PUIA 1DT5A 4HTAA 1RWQA 4H77A 3STXA 4UHHA 4J0DA 3VJKA 2VA9A 4UPDA 1LNSA 5CH8A 4DNQA 2XUFA 2WFZA 1EB9A 3BIXA 3T4UA 4P9NA 3A70A 4Y2JA 1LPOA 4B0PA 4DMFA 4E11A 5ALSA 2HRRA 2ORYA 1R1DA 3FNBA 4EY7A 1CIJA 4AQDA 1E5TA 5FDFA 1THGA 3H17A 1EVQA 3M82A 1QLWA 2OCLA 4X3CA 4OB6A 4PF1A 1N8SA 2RI6A 1E8DA 3O9MA 1LZLA 3LP5A 3HRHA 2XLBA 4ZI5A 2WFLB 4LIPD 2OQVA 5D6OA 4O08A 4PV7A 4H7DA 1YA4A 2R8BA 4H7KA 4AO8A 5CT4A 3H0CA 4MQLA 4OCZA 5AOCA 3EQ9A 1H2ZA 5AKGA 3D0KA 2JGIA 3LLCA 1ODCA 3F97A 3ANTA 3DDUA 4JH0A 5ALUA 3OPMA 3VISA 2UZ0A 5A2GA 4IH4A 2K2QB 1YB6A 5K5EA 2ONCA 2YYSA 1EK2A 4G5XA 4AMZA 1MX5A 3FCXA 4RPCA 4Q3OA 3R3XA 3OC0A 1X2BA 4UHEA 4MJ3A 2HA6A 4C6HA 4CIBA 1S8OA 3PF8A 4WJLA 4WFJA 1T4MA 4FMPA 4FFWA 4N8EA 2Y1KA 4CCYB 3MVEA 3ZPXA 1GKLA 1TCCA 3JW8A 3IDAA 2B20A 4TPKA 5IVIA 5AKXA 4XX1A 3V1LA 3VJLA 4BP9A 4NS4A 4UBOA 4BE4A 1XZKA 2QZPA 2V98A 2PSJA 2B4KA 2QUBA 1EA5A 3I2HA 4A16A 4GLBA 1LPPA 1YR2A 4AN1A 2XUDA 2EDCA 2C0QA 1WOMA 1CUXA 3MUNA 1AGYA 4K6KA 2RGUA 5A6VA 5AKEA 1D07A 2G5TA 5DYWA 1W76A 2LIPA 4JUIA 5K3FA 2O2HA 4QA9A 1HLGA 2AJLI 2WHPA 1PJAA 4C87A 4OB8A 4TVKA 1YAHA 4PQEA 3IULA 1MO2A 3H2JA 4DMKA 4BVLA 1XZLA 1BROA 2AJCA 3G9ZA 3G9TA 2PSFA 3WJ2A 2PU5A 3STYA 1UK9A 5ALLA 4FLFA 1G42A 1VA4A 1KU6A 3EIOA 1C7IA 2XUOA 3KWFA 4HRYA 3VXKA 4AO6A 2R11A 1TK3A 3D59A 3WJ1A 3STUA 4EY6A 4D9JA 4GEGA 3FLAA 1QIJA 3FLBA 5C8ZA 5C81A 4HVTA 2JF0A 3BL8A 4X6YA 5HF8A 2WHRA 2VTVA 1VOTA 4NZZA 5FLKA 3HXKA 4UBMA 3VKFA 1CUIA 2HDWA 5K3FB 4FDMA 1BEEA 3L1IA 4GDMA 4BAUA 5CURA 2PPLA 1ZI9A 3HACA 4WCVA 2WG1A 4HXGA 3QPCA 3R3VA 4CG3A 1XRPA 1Z68A 3DL7A 3D2BA 5LZ7A 2HU5A 3F98A 4FNMA 1XQYA 2EDAA 4U2GA 4JYMA 2O2GA 5JD6A 5HCUA 1P0QA 4HAIA 2QS9A 1ZGCA 1AKNA 3H2KA 4F0JA 5AICA 3O9VA 3R3YA 2CUTA 2H1IA 2WIDA 3SWWA 1TQHA 1CUDA 1JI3A 4H7FA 4J0IA 4H7HA 3QM1A 1CUAA 5FXMA 3G0CA 3PICA 2OAGA 3PFCA 3C70A 5AJHA 4B84A 4G9EA 2EEPA 3F67A 4ZXFA 1IUPA 1QFMA 3A2LA 1ZIYA 3IURA 4C01A 4X95A 4J03A 5LZ5A 5KBYA 2V9ZA 1FFEA 1VA5A 5FOQA 4Y2VA 2VATA 1GT6A 1J06A 1AUOA 1ZI6A 3C87A 3EQ7A 1VJ5A 4N5HX 1JT2A 5LP1A 2ROQA 1Q0RA 1W6RA 3QMWA 4QE3A 3YASA 4U2EA 5EHXA 1OCEA 2WQZA 1ACLA 4G8CA 5HF6A 2DSNA 3KWJA 2PKYX 4CG2A 4BTLA 2XT0A 4Y2TA 1ZIXA 5FRDA 1DX4A 2VAXA 5ALFA 3F9CA 4X00A 1NX9A 1R3DA 5DNVA 3SK0A 4K6HA 3RK4A 5ALVA 3DEAA 3WKDA 4KJXA 2Y6VA 1USWA 4LXHA 5J3JA 4ZV7A 5EIAA 1HDEA 3W9BA 3ZLUA 3H04A 1A7UA 1AC5A 1UK8A 4BAZA 5AH0A 4L9AA 2DQYA 4UBIA 2JGJA 4YPVA 3E0XA 2VAVA 3F96A 1U2EA 2CMFA 1ZICA 4YK7A 4BC0A 1GXSA 3A2MA 1WPXA 1NU6A 3HSSA 4ROTA 3STWA 3HC7A 2ZVDA 2ZYIA 2H7CA 5JAUA 5LYYA 4H35A 1TIBA 3QMVA 1UKAA 5DTJA 2QT9A 5LLSA 2XMGA 3DYVA 1KEZA 2C0PA 4AZ0A 2QM0A 4H7IA 2X8BA 2ZJ6A 1HPLA 2FJ0A 4YASA 2HU8A 4GXNA 1HL7A 1TRHA 3DNMA 5D7BA 2BGNA 3B3QA 1A8QA 4OU4A 5AM3A 1LPMA 4PW0A 1IZ8A 5T4FA 4G9GA 4OYYA 1XLWA 3QITA 4U2CA 5AHXA 1XKTA 3QH4A 3QYJA 4FFVA 5ALHA 3UUFA 3E4DA 5AI5A 1YB7A 1Y37A 4J0HA 2CBGA 1DTEA 5A7HA 4UHBA 1TAHA 2HU7A 1BE0A 4FHZA 1IMJA 2GYWA 3R0VA 3W9UA 1QIIA 3W04A 4QLOA 5CT8A 1H23A 3R41A 5AKKA 4CCWA 4AX4A 2RHTA 4E14A 1K63A 5AOBA 4AN0A 3GROA 1DQYA 3I6YA 4X6UA 1YAJA 1C7JA 4Q34A 5ALEA 1WM1A 1GQRA 4AMYA 4J0KA 4W1SA 4W1QA 1CEXA 2GBIA 4HXFB 1EXWA 2O7VA 1QIHA 1W52X 4OPMA 2DFPA 5K3EA 4DSZA 2XE4A 3WZLA 2WSLA 1E3QA 1RP1A 2WIJA 2NW6A 3BE8A 4KE8A 1QO9A 1PFQA 2FX5A 2WJ6A 3D4LA 5CH5A 5AI6A 1NU8A 4DIUA 1HQDA 2XMCA 5JARA 2VT6A 1DWQA 1LBSA 1G5FA 5AOAA 4UBLA 2ZYHA 2CZQA 4K2AA 1W1IA 1LGYA 4GW3A 2CKMA 4IO0A 4FOLA 1KU0A 3IUNA 4P08A 1YSCA 3X3HA 5K3AA 4X7BA 2PUHA 4B83A 1THTA 1B41A 1XZBA 5HF5A 3R40A 2ACEA 2BUBA 3QMMA 4X6XA 1QIKA 3ESBA 3G0GA 2WUDA 1EH5A 5D3ZA 5AIAA 4QDOA 3BF8A 4WY5A 2BFNA 3GELA 5FV4A 2GBCA 3W05A 5AM1A 1SCIA 5JZBA 4ZRDA 3C5VA 1K4YA 3QBJA 4H7JA 3M81A 1G66A 3R3UA 2PU7A 4MYDA 1X70A 5EI5A 4X90A 2AJDA 3IUMA 4FWBA 4Y2UA 3ZLVA 1O6FA 4KYVA 1BRTA 4BRSA 4Y2PA 4B9EA 4E15A 1YS1X 2D0DA 1CUCA 1BCRA 2RHWA 5SYMA 5ISMA 3WMRA 3G9XA 1LBTA 5CXUA 5HQ3B 4U2BA 1Q83A 5I8PA 5JD5A 3VVLA 1JJFA 3AILA 1CUWA 5JALA 3JYHA 2C58A 1EDBA 2WILA 5AIBA 1XZGA 4H7EA 5A62A 4LKOA 2QVBA 4I4CA 3CN9A 1W4LA 1CFJA 1A8SA 1LPAB 2PM8A 1QIMA 4WFKA 3TRDA 2HA0A 4H18A 1WB4A 5IVDA 1OILA 1P0IA 2Y2UA 2VT7A 1U4NA 3DQZA 3F8SA 1XZAA 1FFDA 3I6MA 4G4JA 3ZI7A 3FVRA 4C4ZA 4EY5A 1QIGA 3TJMA 2FUKA 5DJ5A 1QONA 1GPKA 2OGSA 2QJRA 5T4BA 4BBZA 2ZYSA 3VJMA 3S2ZA 3V1NA 3B12A 5AM0A 3PI6A 2VF2A 2HM7A 2ECFA 3KDAA 3QPAA 1ZGBA 5AI4A 2V97A 3ZV7A 3V1MA 2BJHA 1CUGA 3AINA 1XRLA 5ALNA 1WCYA 1F8UA 2JGEA 5JD4A 4C4XA 1SCQA 5AKZA 2Z5GA 1FSSA 1MTZA 1UWCA 3AFIA 3MUOA 2QXUA 5EFZA 1YS2X 2PVSA 5ALYA 3EQ8A 4FNGA 4X85A 4Q3KA 4RE5A 1JKMA 5DYTA 1FFBA 5HK9A 3PUHA 2OCKA 3ICVA 4C89A 5KWIA 4OD0A 1L7RA 1EB8A 3MGAA 3Q8WA 3WWEA 4JEIA 5LKRA 1UK6A 3A2NA 2PSEA 4GBGA 5DWDA 1G4HA 5AM2A 2QOEA 3K9BA 2DHEA 1CV2A 3RARA 2RAUA 1F6WA 1CLEA 4QEKA 2QR5A 3C8DA 4X94A 2ZSIA 2PX6A 3H1BA 3O4GA 2I3DA 1W75A 4ARBA 3D2CA 2XQIA 2YH2A 4OYLA 1IUOA 2CB9A 5ALOA 1ETHA 3PE6A 2DR0A 4BE9A 4BCDA 3IBTA 2I03A 1JJBA 3K2IA 2BUAA 5JAOA 1CUZA 4B0OA 5AM5A 2ZSHA 2XUGA 2VJAA 2JGKA 2G63A 2WG0A 5AK6A 5LZ8A 3K6KA 4B82A 3WA7A 3T52A 5E2IA 5AM4A 2OCIA 3RLIA 4F5ZA 4KE7A 3GBSA 1JMKC 4DSAA 3PDCA 3I28A 1E8NA 5BV7A 2BCEA 4UHFA 3M83A 4G4IA 4W9RA 2D5LA 2H7XA 4AB1A 1UT6A 4J7AA 3IB3A 3CCBA 5F4ZA 4UFPA 2C4HA 4KR0A 4DNOA 4MQMA 1J1IA 2BGRA 1MAHA 4FLEA 3D7RA 4BVKA 1R9MA 5AK3A 3G0IA 1A8UA 4J0GA 3GZJA 5FPPA 2HL6A 3HEAA 2WHQA 4WDRA 2VJDA 4CI9A 1TKRA 5ALKA 1H2YA 4F60A 4XJVA 2IIVA 3WKEA 3NGMA 1GPNA 2XMQA 5ALZA 1ZD3A 4KE6A 2GZRA 2WHPB 4N8SA 1GPLA 1R4ZA 2HA7A 5H3HA 1VE6A 1UK7A 5C8VA 3EF3A 5AI0A 5C7YA 3EBLA 1ZOIA 4HS9A 3HYSA 5JZ9A 4Q3LA 5JANA 5I7UA 3WIOA 1F0NA 1H2XA 4G4GA 4INZA 3FYTA 1TCBA 4QZVA 2I78A 3SX4A 4HZGA 5CRIA 3D2AA 3RKSA 1LPSA 2RIPA 3OTQA 4UFOA 2QUAA 4B85A 5YASA 4N5IX 4W1RA 1XROA 1JFRA 3LCRA 4BDTA 4X91A 2WUGA 1K5PA 2V96A 2WG2A 2H9YA 4IH9A 2Y6UA 2OAEA 2XUIA 2HADA 5CBKA 4PSDA 1J2EA 3WA6A 2OG1A 5IKXA 2WKWA 4CCYA 4LXGA 3WL7A 2GBGA 3ESCA 1AMNA 1L7QA 4RE6A 1FFCA 5HK8A 5CT6A 4Y2RA 4GI1A 2WJ4A 1IUNA 1UKBA 2DHDA 2Z3ZA 4EY8A 4MEBA 5FP0A 2HA2A 3FYUA 3H2GA 1JJIA 2J3QA 4QLAA 2GBFA 4DTCA 3DLTA 1EHYA 5DYYA 1UXOA 4L3WA 2XMRA 2XUPA 3GA7A 4G8BA 3A6ZA 3O4IA 1XKLA 3OOSA 1CUJA 3TGLA 1CUFA 3L1HA 4KAAA 1LZKA 1LLFA 2WTMA 1WHSA 4BTVA 3C6XA 3VDXA 4CIAA 4AO7A 3DYIA 4DMCA 3C45A 2GZSA 1U65A 3FCYA 2WFLA 3C6YA 1CUYA 3E3AA 5ALGA 2ACKA 1DT3A 3DOIA 3WWCA 1XQXA 1MT3A 1K6EA 5HFAA 2XDWA 4MWTA 2XQKA 1XQVA 3H18A 5JADA 1VXRA 1QZ3A 2HFJA 4MYSA 4L72A 4E46A 1JMYA 4IHAA 1ZI8A 4P92A 2BAGA 3C6BA 4PO3X 3WL5A 2PL5A 2CJPA 3QPDA 4EHBA 5HKBA 4BDSA 4LYEA 3IA2A 3DJYA 4QDTA 1MNAA 1MU0A 1QIEA 4U2FA 4ETWA 4QDXA 4RGYA 1QO7A 3KSRA 2OPHA 5ALDA 3WK7A 5EIHA 4Q05A 2X76A 2OCGA 1EX9A 1WHTA 1UKCA 1CPYA 2WU3A 4G1FA 5CW2A 1I6WA 3V48A 5E4TA 5T4HA 4MXDA 5KREA 1EI9A 4GECA 1GQSA 5ALTA 5IVKA 5D3KA 1UFOA 3SC2A 5EHQA 4BB0A 4BZWA 3G0DA 3WK5A 5CTAA 3AZQA 1AX9A
chains in the Genus database with same CATH superfamily
2DPMA 5EHGA 4HX5A 3DMYA 3KOOA 4S1PA 2ZSEA 4H7PA 4L8FA 3H4IA 4CMGA 1VRVA 2WD9A 1YTLA 3HH8A 3DL4A 4JQYA 3ENQA 1JLLA 5AKJA 4ITVA 2I7TA 2J31A 2OBXA 1FXUA 1ZCFA 2NPIA 3RRXA 3IRUA 2R87A 5ADHA 1FTWA 4PSCA 4BFTA 4BNUA 4N12A 4BRZA 2OO5A 4L75A 3AONB 4C5BA 2FSHA 2JGRA 1QH1B 4WLEA 3O8CA 2AFIA 4YRAA 2G0NA 4DQUA 2Q3FA 2FR0A 5SV2A 4HH4A 3D64A 4BNGA 3LW7A 5CCBA 1JG4A 3C3WA 3RVSA 1A9QA 1UP7A 4EGAA 4B81A 1TO6A 4EPXA 3MZ0A 3KSBC 3D6MA 1IBMB 3INNA 3ZCQA 5C80A 4EHHA 3AG5A 3EZXA 4PXSA 4JU8A 5CMLA 2ILTA 4IDCA 3OE7A 1M0TA 3OH8A 4FUQA 4TYQA 4K6CA 7MDHA 4NESA 3WK9A 5KYYA 4FFBA 3IEUA 4FDUA 3CPJB 2Q6LA 3A6LA 3D5QA 4DNXA 1QOZA 4Z4QA 2ZQ5A 4HDNB 4PINA 4FK8A 1AUVA 5JU6A 3N8NA 4I55F 3EPHA 1ISFA 1J2UA 5JXWA 4BNLA 3K0BA 4HPXB 3PD1A 2OCPA 4L0QA 3P9PA 4DHWA 3IXQA 4GWGA 3OJ0A 4HQKA 1KEVA 1R4NB 2O3RA 4ALIA 4CQMA 1M5RA 4D9HA 4EG0A 2GRJA 1BXKA 1XAIA 3E9ZA 4EW2A 3VYRB 3NUQA 4Y2YA 2G70A 4GRIA 2ATIA 1JPVA 3IBCA 3T1HB 3KZCA 4OSPA 2MSDB 2DQ4A 3GJXC 3UATA 1VCIA 4RTMA 5IC4A 4QRHA 5CLJA 2JGLA 2JW5A 2H57A 1PYDA 1P5FA 4AJJA 1BOFA 3BWXA 3I9KA 3QYAA 3GDFA 4GLLA 3ZDRA 1OZFA 4KDEA 4Q4HB 5DLPA 3GLVA 4PC2A 3AEXA 4QYIA 4YRFA 1FDSA 1PV1A 2WTXA 3BIFA 1A27A 1ULTA 5DFAA 2JZOA 2PSDA 4KE9A 3WDMA 3ZHOA 3IELA 4ZIRB 2PJZA 3TK1A 1ZRSA 3A32A 4KRYA 1Y6FA 2WM2A 1Q84A 2H4XA 2FGKA 3U7GA 1ZNWA 4UFNA 2VYCA 4JBXA 4F8YA 5KWJA 1X7YA 3GRAA 4XFDA 3VR5A 2VJPA 2HV8A 3M9XA 1AN0A 5SY9A 3FX2A 2F8TA 1WXWA 4UHCA 1P2UA 2Q07A 3E27A 3F71A 3FFWA 4O2BA 1A0OA 3CGWA 4Y1GA 2DETA 3I2FA 2DY1A 5JAMA 1D6MA 5IVHA 4NU5A 5EXEA 3RVLA 4F6LA 4J4TA 1V5EA 5ELLA 4P0PB 3N2GA 5HMLA 5L6LB 2QM8A 3OCYA 5B4TA 1SC1A 2PV7A 2YZNA 4UPVA 3AUFA 2VTEA 2G82A 2V6MA 1C0EA 1CRZA 2YJNA 1MV8A 3V3KA 1FMJA 3TR5A 1L7VC 4GOMD 3TXYA 2ZI9A 4Q82A 4B7ZA 3DL2A 2O1WA 4NYJR 2WA1A 1OAKA 1JJ7A 2NXNA 1TYCA 3LHDA 1R00A 1V47A 1N2IA 4MYRA 4FI3C 1YULA 3A4VA 4CMJA 5CDFE 1V7PC 3MSXA 4R9VA 1DKNA 4QVGA 2C95A 3V7WA 1E98A 2VIIA 5EJAA 4YC7A 4OXKA 1CC1S 5IN4A 4ZU3A 1Y42X 2JLAA 1YMVA 2NGRA 3MAGA 3TCKA 1H2FA 3CCCA 1EJBA 2Q3BA 3GARA 4JEHA 4CFSA 3UJ8A 4BCCA 2NV2B 3WWZA 1SCJA 4TTQA 2W2TA 821PA 4ZU6X 1V11B 4QGHA 4LXUA 1Z4OA 4OUKX 1TZJA 2PH1A 5B1EA 5C8XA 2UUCB 3DT8A 4QQ8A 1U9CA 1R5JA 3HB9A 3BGVA 4IIFA 4DJJA 4KITB 2V7BA 4ZO9A 1IJEA 1BKYA 4U9UA 1PL8A 2EX1A 2G17A 3I12A 4FT2A 2NUAB 2XUHA 2LZ0A 1TO1E 5DTIA 4PLHA 5F1KA 2DRIA 4R2JA 3KXPA 4GSLA 3QX9A 1G2PA 5JCZA 4Y6OA 3BB1A 3JQAA 4EVSA 4Q9AA 5LP6A 3JZIA 3DMHA 3G0BA 2QYTA 4P7KA 2CK3A 1EK6A 4HGOA 2Q7XA 1KDVA 1XNJA 4JCOA 5JSZA 1PU2A 4FGZA 1YASA 2I8AA 2OLEA 3OOYA 5K3BA 2G1KA 2Q3JA 4GX2A 1QQBA 3E3MA 1NXXA 2A78A 4BX3A 3DLBA 1QP0A 2UYQA 1G7TA 1JAIA 3MQ2A 1KA9H 2PY6A 3AUTA 5A03A 1AV7A 2QD5A 1FA9A 5IAAA 4YEDA 5JJKA 1EZ4A 2O8NA 3A05A 3MG9A 4PRZA 2OQRA 3WGOA 1AXEA 1VXOA 1QVVA 4GPEA 2HBYA 4KAJA 2GPYA 5D84A 3VVCA 2HTFA 4C7XA 3N8IA 3UCEA 3W79A 1E3SA 3DYBA 3H2HA 3S28A 3DEYX 3RADC 2EFHB 4IDHA 4MRVA 4UDOA 3SZGA 3VSBA 2X5XA 3C6QA 1J25A 5I48A 1O6GA 3GLFA 3EUAA 2Q46A 2PMDA 3FBGA 3SJAA 3WLSA 5L6MB 5F9HA 4JLJA 4BNVA 1ZCAA 2AMYA 3UFXA 4GC9A 4EUSA 4JC4A 3PF9A 4LFCB 4BAGA 1HEUA 3HABA 4G8JA 4BFUA 1DKOA 4CTJA 4DFDA 2OHVA 3NH6A 3HJRA 4LDZA 4JY7A 2C42A 1EG7A 1MAAA 1UBNA 1WB5A 4KSYA 4V3CA 1AS3A 4L08A 3WKCA 1RAAA 1FFYA 2JEOA 4MEAA 4MJ7A 4JLDA 4RSMA 4UXIA 1WDWB 5AJZA 3WTBA 2QGNA 3UAVA 2I9KA 3BWYA 3VZCA 3WB1A 4FZJA 1KAMA 2CCJA 3ZNQA 2CMGA 5EOVA 3U16A 3MD0A 3WK8A 2AUMA 2QTTA 3MJTA 4BXOB 5BSUA 4Q9DA 1Q50A 2W2MA 3QTTA 4AZ0B 4EA9A 3EF0A 3E9MA 3PNVA 1JU9A 2EIXA 1LB1B 3B5EA 3MLBA 5L3RA 5HSGA 2C2KA 2CHVA 3EZ2A 1M8GA 3ILSA 3V7UA 1EDEA 3LT2A 3PLAE 3DBHB 1NXQA 5CTJA 1YZ3A 4JUAA 4RUKA 1E66A 3L3BA 1C1XA 2Z98A 4KL8S 4MVWA 1N6KA 1T1SA 1U28A 2WTNA 4I6EA 2KBEA 4OLHA 4ZU1X 2HD4A 3VSCA 1LEHA 1PNVA 4MDYA 3NDIA 4X3OA 4QOEA 2V6JA 3FOBA 3FTNA 3U3OA 4B31A 1P7YA 2D1FA 4YCLA 4K9KA 5CXQA 3BCRA 4GHWA 4EHJA 5F98A 1OGYA 2WV9A 4PSKA 1XRSB 1SK8A 2BR4A 4KQ9A 1R64A 3WG9A 5TMPA 2GB4A 1HZZC 1FTSA 3NDJA 4WMLA 4RPGA 2UVPA 9ATCA 4J16A 5AXAA 1RFLA 2YIJA 5CLFA 3DEIA 3MCWA 4LXIA 3OT5A 4W5OA 3ZK9A 3IOMA 2HPZA 1YRBA 4KUGA 1XRNA 4CM1A 5HZGA 3CHYA 2XTNA 4R98A 1YJXA 3NFRA 1UOPA 3T3PB 2ODBA 2WWGA 2JLCA 4B3FX 2FKAA 1NW7A 4I5IA 3GJ4A 3VU0A 2G1JA 4XASA 3NKLA 4IJKA 3U26A 4D45A 5AW2A 1UAAA 1IVNA 3O8LA 5CVVA 1XEXA 2IYQA 4B2LA 1XZHA 3E9YA 3QU7A 3QU4A 1FTNA 4EPVA 1WB6A 3ROXA 3C98A 2QY9A 4X1KB 4CU5A 1HYBA 2YV2A 1KSJA 3MD9A 3UFBA 4OYHA 3SS9X 1SUDA 2Q49A 4MITA 4WERA 5EJMA 1FFHA 4J0QA 5FNZA 2ST1A 4D25A 3QEJA 1XP5A 3IHLA 3L82B 1XDGA 2E5FA 3BILA 1K7XB 1BJTA 2E9SA 4IFEA 1AF7A 2GK4A 2CE7A 4PLPA 4QDZA 4Y1FA 3OZCA 4Q4AA 1JAZA 1Q7RA 4JJ4A 1FDOA 1M1YB 3I8OA 3LK7A 3OPYI 4QSHA 1VGRA 1LVGA 3U60B 3DKKA 1NF9A 4HNAA 5KNBH 4E5VA 1ZW6A 3EPKA 4O4HA 3TZEA 1CY2A 4X8MA 4RJIA 3R8FA 3E84A 2F4VB 5HUHA 4GYJA 4EY4A 2AXEA 3A1NA 1ZJ5A 4ZWNA 3V8NA 2DWCA 3ZU2A 2WIFA 3NRBA 1HLDA 3AP1A 3PVCA 1GG9A 3SU8A 3S3TA 1XQ6A 4JVOA 4LHEA 4ITUA 4RH1A 4DRXA 1U80A 3UIEA 3BSSA 1T5LA 5K9ZA 2H2HA 4LTNA 3HA2A 4D4JA 4MPRA 1DO2A 1MEJA 4ZFNA 4HGQA 4Y30A 1OXXK 1RCTE 3WTCA 4GL2A 2D7CA 4K3VA 2J4CA 4CDMA 3VH3A 3DE1X 5KVVA 4IGFA 3QNMA 1JJVA 1J24A 3EH1A 4NE2A 5BOVA 3NXSA 1P44A 1NZDA 4UEJA 1C0PA 2JFFA 4L4ZA 3UG6A 4LJ9A 4BNZA 1ZN7A 5CJPA 2PS3A 1LH0A 5JE8A 2HZBA 1XTRA 3HKBB 5HW0A 1UPCA 1PFWA 3WNDA 3UGTA 2DY0A 1ZH2A 1NNSA 2IKQA 2VDWB 3DFKA 4L4UA 1L8OA 3SP1A 3UV7A 4ACAA 3SQXA 2A9JA 4AF7A 2BOVA 2JGFA 2FG5A 2AFVA 1PTKA 4TLEA 3RTDA 4D43A 2ZATA 2O8BB 4G0OA 3FPBA 4NCXA 5LIPA 3KK0A 3FSJX 1M2HA 1EDDA 1RWPA 3ESXA 2RHDA 4F3TA 1SCAA 1YXMA 1YR7A 2FY8A 2R6CA 3PA6A 3P5BA 1IIRA 1SQGA 5EVCA 4CE6A 4LOHA 4BTEA 3QP9A 1V5WA 4JC5A 3VZQA 2HA5A 5K3DA 2OORC 1PTJC 1UJBA 4HI0E 1XYYA 3IP8A 1ZO8A 1UWLA 2F67A 5DISB 1JBKA 3N7UA 2XGGA 5K0LA 4A10A 1Y6GA 4R2KA 4CDRA 5DX1A 1YUMA 1R5NA 5DZSA 3PQ6A 3MM4A 4EFDA 1VB5A 3HM2A 4BX2A 1JXMA 5A5DA 1FNNA 2YL2A 1D2HA 1BNCA 1VL5A 1SOAA 3D8UA 4JZYA 5TVGA 4EM6A 3L1JA 2DT5A 2A9OA 5ALWA 3K16A 1SJ9A 1T0BA 4JFRA 4ZCMA 1FPMA 3C1AA 1HDZA 3K1AA 2HK9A 3P2MA 1JF8A 1PBNA 4GOLD 4TUYA 5EEGA 3TB4A 3N2EA 1IM8A 1XLVA 1X74A 3V55A 5BPFA 1JNYA 4EIWA 1W6UA 1QTRA 1CB7A 1T13A 5TPZA 3WFZA 4N3AA 1D5WA 4IHQA 3JQRA 4X71A 1Q0HA 4O25A 1Z7BA 3CEHA 3PJGA 3QWHA 1PT9A 1IVSA 4KIUA 1NWHA 1G20E 2IHVA 4KJZA 2WIKA 5C2JB 1Z39A 2CD9A 1QIFA 2AF3C 2RC6A 3W5BA 4CODB 1FTGA 1OXVA 2OWDA 3X1DA 3L7KA 2PDAA 1QHEA 3N87A 5E3JA 4B75A 3ITNA 2JFYA 4HSGA 1I2MA 1AHHA 4OH1A 2C31A 5AHWA 2IU0A 3C3XA 1SC9A 4FSDA 2E82A 4CQNA 1R9NA 2GLUA 1LSSA 3I04M 3KALA 4MP6A 5EE1A 1IZZA 5FPQA 5IYZB 2QBYB 1BO6A 2ZYTX 2JEZA 1NLFA 1CZHA 1PSWA 3HDVA 4EUFA 3B53X 1WUTA 3Q11A 2P3OA 4QC2A 3ACDA 1YMQA 1DHTA 3NS7A 4MB6A 3D3NA 5CM8B 3ZV4A 1ADJA 4Q9HA 2JLUA 2GWHA 4ZI7A 2CWWA 4MP3A 1JKJA 3WK4A 4I5DA 1G8KA 1Z06A 4ZVRA 3WSTA 3DP7A 1TADA 3T54A 3GMTA 3OVMA 4GE0A 4HLUC 2JFZA 3TL3A 2R1TB 4W8OA 4J94A 4J7UA 2ACWA 4M0KA 4WOJA 3L41A 4RIFA 4WXEA 3DZBA 1XVTA 3H5VA 3E2IA 2D4HA 4HL6A 2C3OA 2GAJA 3H11B 3OTWA 2YHSA 4N0PA 4D9EA 3UK1A 1T1JA 3RGGA 1JAHA 1G9TA 2PLRA 2AMFA 4KZKA 2CXHA 2JARA 3Q6NA 3QFSA 1AGPA 3PJFA 4HPWA 4WOCA 2F48A 3SHTA 5BWCA 5KNDH 1WOYA 2VTBB 2OZLA 2EL7A 4WKNA 1Y4ZA 4HDKB 1FS4A 2A0XA 4LJ6A 3PEVA 1L7OA 3NNDA 1I4EB 1J8MF 1KTIA 1UM9B 1K2VN 3A9RA 5KKCA 1LBEA 2FEWB 1K6IA 4GWLA 1UMCA 4M21A 4CHGA 3D0OA 2DQZA 3OEHA 4M0UA 1L5VA 1LCIA 3EJWA 4KO2S 2Z8ZA 3W06A 1CB0A 1N5KA 1NW8A 3K96A 1GNPA 5HS6A 3I2YX 4M8IA 4F6CA 3DFFA 1LWOA 4DIBA 2R751 3VHLB 3DJFA 4AF8A 4YVFA 1JDJA 2C5FA 1O95A 3WWPA 1JG7A 2X1HA 1YWWA 1TX4B 1UP4A 2B83A 2Z0MA 2GF9A 3DG9A 3FWYA 2CDCA 3STVA 4P6VF 4B6GA 4E1AA 3QSYA 1NRJB 1IQUA 2HMVA 5CDHA 3IDZA 5CGQB 3HJGA 5I3ZA 5TB5A 3E22B 3B52X 3PEFA 5HOQA 1NZJA 3EULA 3LUBA 4C3OB 2IDJA 3WGVA 4S0XA 3LOUA 1DX6A 4PX2A 2YMLA 1E5LA 3NHWA 1Q0SA 2EFEB 2QRHA 2I6GA 2JATA 1T6ZA 3KHSA 3NLLA 2G4LA 5C32A 1ZD4A 2O3UA 4JOQA 4P36A 2DFTA 4EPYA 5LZ2A 3OOEA 5AK5A 2XF2A 2R5WA 3BREA 1S2NA 1ZRNA 1SXJA 4DYHA 1JR3D 5BN5B 5E4JA 2ZSJA 2CVOA 2O07A 3WNQA 1XZDA 3GXBA 4Z0TA 5KNCD 3AETA 1DV1A 1OI2A 2QZZA 3VPAA 1XELA 2QRQA 3WLEA 4WUVA 3MGKA 5BSVA 1HDXA 4JI5B 3R7BA 1KFCB 3MINA 1VKHA 3C3EA 2B6NA 4N39A 1PCXA 3VPDA 5BN3A 2LTAA 3UYKA 4R71A 1EGVB 2W6ZA 2H5IA 1FJ2A 4CUZA 3OAAD 1FFWA 3CXUA 1ZM3A 2XD4A 2AG1A 4PZCA 2X8WA 1G5QA 2QXTA 3WWDA 3U09A 2CVHA 1E2PA 1YGPA 3BVPA 5FLYA 4ZQCB 3NIFB 2AN5A 5C46F 2HRQA 4FTWA 1M6VB 4OL9A 1GCIA 1BX3A 2GXSA 4FHDA 5A0VA 2B82A 4OSOA 4XVQA 4WKGA 3ND7A 3VO2A 3H05A 1PDOA 2AH5A 3A6GA 4M9RA 2HQ1A 2D4AA 3MNFA 3A3YA 4TTIA 3JQ8B 1W36B 4LQ4A 5FWDA 4CM4A 1XVUA 3BRCA 3LZ6A 4BB5A 3MCTA 2VPIA 1YUNA 3JR7A 1XZEA 3LPDA 4QHTA 5F78A 2IUTA 1RC8A 2DWPA 4P54A 4BATA 4C03A 3I9V6 4BNFA 2NP7A 2GAFA 3WLJA 1V1RA 2VYVD 3B6ZA 3NP9A 3Q3HA 2A1IA 2FSFA 3QVLA 1SOMA 1C8LA 3OIWA 5JXJA 1K97A 1J39A 1XOIA 2GD1O 3GAZA 4DR6B 2GASA 4ME6A 3K1ZA 3TINA 1IH8A 3ES9A 5AQEA 4C3UA 2GZ3A 2GFHA 4MR8A 1TYEB 5K8TA 3EIHA 1BOOA 3HU5A 3FE2A 3PD7A 2AT1A 1WUYA 3SKYA 3DKPA 2RE8A 2R7KA 3MRXA 3I52A 4NBWA 4D3ZA 2E49A 4PBSA 2AZDA 4QATA 3ORHA 3PPVA 1UUFA 3LXRA 3AF2A 5FTJA 5EIBD 4F3NA 4YLYA 4ZVLA 3KYIB 3WYDA 5IHPA 2CL6X 4IJQA 4OAPA 5A4FS 3NU1A 4YDSA 1J6UA 4WASA 1YI1A 1SUWA 3GAFA 3I1IA 3KYDA 3BXOA 3C5WP 4GRAA 4PZAA 2ZAIA 1ESCA 5E1OA 4LWZA 4WY2A 3A7EA 3WIUA 4EA6A 1NTOA 2OBYA 1RYZA 2NTYC 3PK0A 5LA6A 3G82C 2BEUB 1HWYA 1XT6A 1O03A 1UXIA 4DNFA 4W1PA 1THZA 3TTUA 3BHMA 3F78A 4L0CA 1M75A 2R6GA 4YX9A 3AM1A 1M33A 4GRDA 2I2BA 4YJFA 5LZ4A 1P5RA 2AG0A 1IXZA 3ZWBA 3FKSA 4PLCA 2B9EA 2YY7A 1NIPA 4IVNA 5JS2A 4RK7A 3FPEA 3HNRA 3QNUA 1F0KA 4UMEA 1X1BA 3I5UA 3GBPA 3GUHA 1XVLA 5HGJA 1I80A 3G1WA 2IXGA 3ENWA 1QTIA 2W8BB 2G09A 3SIWA 3KQMA 4BMOB 2PT7A 1A3CA 3A3OA 1LV7A 2W98A 1MC5A 1NVWQ 2XJ4A 1HETA 3DQQA 3GWGA 5H82A 2C2MA 1K98A 1CEEA 3OUUA 1GPYA 1FP1D 5C53B 3IQIX 3KSZO 2AG5A 1ZHHA 2OVBA 2UUPA 4Q02A 4FOPA 4KAFA 1P0PA 3ZKAA 3T4PA 4ZTZB 4PRKA 3AIOA 1NVEA 3KEFA 4CW7A 3TR6A 3CINA 2H9AA 3B1XA 4IZOA 2OZPA 4OATA 2QNIA 3VDQA 4R9RA 2ZB4A 4JVNA 1OBHA 3U44A 4GS5A 5LQJA 1MGPA 2C78A 2G88A 4M88A 2E4WA 2JVJA 4LK3A 4LSWA 5HE9A 2H7YA 1PV4A 1C3XA 3WO0A 4S04A 2EP5A 3O5AA 4W7HA 1H94A 1N5MA 1KR5A 2P0YA 3C43A 4PU0A 4F4UA 4KRXA 2XUAA 1FCJA 2B1JA 3TB6A 3VVMA 1GL9B 1ZKMA 8ADHA 1YA8A 4KVAA 5IYZF 4HGYA 1F2UA 5LZ9A 2WYWA 3L8YA 3GP5A 4BMNA 1ICIA 4J3JA 4IJVA 1E89A 1KORA 5BUZA 3PXXA 3T3GA 2VDQB 2Y1GA 5BOSA 1HZZA 2XGSA 3ETDA 3M33A 3IP6A 3VV3A 5BRAA 5FEUA 4V02A 5EPUA 1TECE 1BCSB 4D6YA 2UVQA 2XCQA 2FPGA 2SBTA 2XODA 4D42A 4CLOB 5CT5A 5L4SA 1VG1A 5KVAA 2GI4A 1Z33A 1ID1A 3CR7A 2W22A 5ALIA 5ILGA 3ZWQA 1YVRA 4TWZA 4NICA 5E7QA 3BMXA 4KK3A 3OWXA 3L7OA 4JSTA 4DLSA 5CFOA 2LCQA 4JKIA 6YASA 2IW1A 5JSHA 1OW3B 3AOEC 1O6ZA 3CNHA 4B87A 5LMUB 5F1YA 1NDUA 2H4WA 5E4YA 3BSYA 3SEAA 1W5TA 1IY2A 4H4DA 2VJQA 2E4YA 5EL0A 4A23A 4PSUA 2EJVA 3AJAA 2HHAA 3SZMA 2JDIA 5LJIA 4OK5A 1E2KA 5EMKA 4DCGA 2QP3A 1R7RA 4UQPA 1Y7LA 1DBPA 5KOYA 4BUCA 2YWDA 3IE2A 4RSHA 3W3ZB 1XCBA 4HATA 4CKEB 4DIOA 3OAAA 4GMXA 4V1CI 2O8EA 3EA4A 5SYNA 1XPOA 1A82A 2FCRA 1HORA 1U8EA 5G0TA 4R5HA 3VHXB 1TYDE 4AY4A 3CB4A 3ST7A 3OLWA 4D74A 2MU1A 3QUBA 1Z4MA 2FEPA 2VKTA 2X7JA 2YN2A 3A1SA 4RVHA 5B1SA 2AJBA 2HGSA 2HO5A 5L95A 3CTPA 1NYLA 2RARA 1JFLA 2WWWA 4UBNA 1L7BA 1Y34E 4LZWA 3SMQA 4AS1A 4HTAA 5BR4A 5BSHA 1SVWA 3LC1O 1U2ZA 4KZPA 1ORDA 4H77A 1UMCB 1L8QA 2A1TS 3CF4G 4OFWA 4FI3F 3ZJYA 4AKGA 4TT3A 4P3PA 1X7ZA 3QF7A 3VJKA 4B35A 5J58A 4KNYA 3UWKA 4KUHA 3JZAA 1XV5A 4HDKA 4WZAE 1ODLA 1VL6A 2P1DA 2XSZD 4BO5A 4PO1A 3BE5A 4QPDA 3LFUA 2B92A 2WFZA 1L5WA 4AI6A 4LRSB 1EB9A 3H3FA 3BIXA 3OKCA 2O2SA 2OO3A 4OV6B 1N8TA 4YACA 3THXA 5GJBA 2VP0A 1INLA 1YZUA 1U4SA 2R8RA 3T8YA 4EEXA 1TW2A 1QTNA 2ZWVA 2F6RA 3FUCA 3KJIA 1LPOA 5L3ZA 3SZ3A 1TE2A 4H2DA 2ABWA 3THRA 3HDHA 2R1TA 5G4KB 1OXKB 5LP6C 4E11A 2JS7A 1QQ5A 4IUCS 1XNGA 1R1DA 2O50A 2RCYA 1K2WA 2RKWA 1XMQB 3DUWA 1RIIA 5TPZD 5COQA 3VPXA 5I4BA 3OQBA 1GTZA 2P5TB 1TYZA 2G5CA 2VZEA 3SIPA 4D8YA 4QRDA 2M98A 1E5TA 1S1CA 5CBPA 3O8NA 1GFWA 1PLLA 5FDFA 1I1OA 2XZTA 1NIJA 1THGA 2NUBA 4QDJA 3AVVA 4RGVA 3IUYA 3M82A 1XALA 5L3SB 1CY0A 3NASA 4XM1A 1S4QA 1A76A 4EB6B 3QU2A 4UE2A 1OOEA 2HQBA 3WAGA 4L8YA 1CQJB 2OHHA 1GSOA 1ZXBA 1UBLS 1ZCZA 1BJRE 5FNVF 3O9MA 4RX1A 5KNCH 1A9ZA 2HOQA 4DS3A 4I1VA 1Z0FA 3WSWA 3CSSA 1LF5A 1DIGA 2ZRGA 1XKXA 3NCHA 1F5NA 2VNIA 3UHJA 4NMXB 4FWTA 3FHLA 3ET4A 4CQLB 4HY3A 1YL6A 1DEHA 2OXTA 3AHGA 5PGMA 3KAPA 4KFUA 4RVGA 4PS0A 1OLXA 2PL1A 3IEXA 5D6OA 3A36A 4BIMA 4NARA 3ZDEA 1YRYE 2XEDA 3B7WA 5M29A 4OK6A 2JLVA 1RYFA 3D4OA 3GRYA 3E53A 3H0CA 1DL5A 1PFYA 2NADA 4N49A 5AOCA 1I7SB 2CNNA 3IPRA 4PNPA 2EWVA 4ZZIA 2HCFA 5AW0A 3T5GA 4QXRA 4MUAA 4PCUA 5EIBC 3UOAB 1OH8A 1KP3A 2I80A 5J1TB 3RVOA 1UQTA 1LD3A 1N2EA 1JEDA 2I6FA 2O4CA 1RE1A 3R6DA 4TWAA 2E7ZA 2BD0A 3LGAA 5JZVA 3SVLA 4UNIA 4ZZ0A 3W5UA 3ADBA 3JQGA 2UZ0A 3UT5B 3DCYA 5KOJB 3WRYA 2BHSA 1HK7A 3TRIA 1XTBA 1GRRA 1YB6A 2HEIA 2SICE 2ZVQX 2FNAA 3TLZA 2AB0A 3RUHA 1E3LA 2GTIA 5E8JA 4QVIA 1SA0A 1DAHA 4FSHA 1A2OA 4IGAA 1P4GA 2C96A 1ATZA 5M5BA 4P8RA 3M1LA 1W5BA 1SHUX 4OLFA 3U4HA 4AMZA 4B8WA 1RVV1 1T25A 5CAEA 4MULA 4PYRA 4RPCA 3HG7A 3HXQA 3ZK8A 3OC0A 3DMTC 5KTMA 4DXAA 5HKKA 2WZQA 3K0FB 1WB9A 1YR3A 2XNHA 3AR4A 4I2VA 3W8RA 3K9LA 1YZQA 2AQIA 4PSVA 4C6HA 2Y1WA 4KWTA 4MS3B 4B17A 1MDFA 2JFGA 3I05A 3KOYA 1SO8A 2QRGA 3DMPA 3KVOA 1TJNA 3OTGA 4N3GA 2C1ZA 3ZOKA 2BMEA 2PG3A 2QM7A 3BQMB 2R65A 3M5PA 1T6XA 1UBSB 3LVFO 4QDKA 3L40A 5JI3E 1HC7A 2DHQA 2Q3DA 4B8ZA 2GJSA 2YFYA 3OX4A 3IE1A 5H81A 3RTCA 1OPRA 4OTZA 5JVDF 3MGBA 3R9KA 2SECE 5CNJA 3T12A 4NY1A 3V6MA 5EJ5A 4WACA 1ZL2A 4ZEMA 1H69A 3CR3C 2ANCA 2FEOA 2FUG1 2F43B 3MWEB 4MW7A 4E13A 4GWKA 3CXRA 2HBZA 3K9WA 4R1UA 3CKLA 3GP8A 3DBLB 3SR4A 4OAOA 3FIJA 1MJHA 4L6CA 1QG0A 4BP9A 2Y0DA 3RJ5A 1JDBC 3A9UA 1J4AA 1WCXA 1TTQB 2MR6A 1RRVA 3EE6A 3HV2A 3QLUA 1UMDB 3MMPA 1RQGA 4INOA 3RT1A 3W0LB 4DAEA 5GTDA 4ESVA 5EZ5A 3TDKA 2QGZA 5HBGA 2V98A 4KXQA 1JE1A 3L7LA 2BRUA 3SHOA 2GTPA 2QQ5A 3IO3A 2YV3A 4YHBA 4ZQEA 1U2TA 3SIXA 4BNMA 4BB6A 1CU1A 3HCNA 3LUJA 2QUBA 3Q9NA 4Q7QA 1AMUA 2HRZA 1P31A 2WYIA 3RVRA 4F1KA 2DMRA 1W34A 4GLBA 4DPMA 1LPPA 1RAIA 2VSOA 3QFHA 1T9ZA 2CNBA 4PE5B 3CS3A 5I9SA 4HQNA 3T1TA 3CMCO 4R8SA 4G0WA 3D6FA 1AKVA 2Y1DA 3MLEA 5LMCA 2RGBA 3ZWDA 5IJ9B 5HRUA 2EDCA 2Q62A 2O1XA 5ERXA 3L8DA 3TTWA 1BA3A 2QR2A 4JEMA 1RS0A 1GTG1 4DZRA 2M6LA 1C30B 3S7ZA 3VAAA 5F7XA 2VRNA 2C54A 2CC2A 2GS9A 3GFRA 3MUNA 2XCLA 2KPOA 3CZCA 2RGUA 1VGVA 3LPLA 3N53A 3MT9A 4HAYA 4KO8A 4N9WA 3OZVA 4EA7A 4KIGA 2WTBA 3R6TA 4NONA 4UU1A 4B45A 4CMHA 1JHQA 3KKQA 3EGEA 1RQ7A 1J09A 4IDPA 4HT3B 4ZVPA 5FJIA 1TFRA 2I4OA 5BWNA 3DXYA 4B79A 4F4HA 3AEQA 3A4LA 2XF8A 3ZW7A 4JQZA 4CV3A 5CM9C 1MTOA 1Q0LA 4A36A 4QA9A 3NHLA 5AVOA 3ZH2A 5JDCA 1DO0A 1CS4C 4G01B 1JWAB 3DDCA 1XXHB 2ZSAA 3B82A 4Q7LA 4U02A 2WHPA 1MIOA 1S3FA 2W6NA 4O2AF 1G5HA 4S1NA 4FWIB 1CZNA 3SQOA 3U7QB 4RS3A 1YQTA 2P3QA 4TVKA 4I8DA 1NF8A 1G6KA 4C78A 3IULA 1KI6A 3VX4A 4EWLA 1MO2A 3PX3A 4MDEA 4MHSA 2GVNA 3TUJC 1OZHA 1DB3A 2QSJA 4BVLA 4RKQA 4FDTA 2ZT5A 1KJJA 3IVGA 2EJTA 1TZ2A 1VHDA 2WJAA 3MHPA 4K9RA 4DQKA 3JAWB 3ZDYB 4EVRA 1MMFB 3VZBA 4GOND 1L7NA 4PO8A 4RQUA 3DBHA 1SIWA 3IR7A 4I50B 1GUZA 3DDZX 3PLNA 3AL0C 1RHUA 3V00A 2N75A 2ZIWB 4XJXA 2FZKA 3DZJA 4F3CA 4YAUA 4GICA 1KGSA 3STYA 4EECA 1Z5UA 2AFRA 1JV2B 2XITA 1FRVA 3D3WA 4MUXA 4MW4A 2YR0A 2QJOA 5ALLA 4JI6B 4I81A 2VRCD 1KU6A 2D74A 2FN3A 2K6GA 3E2MA 2HQOA 1TQ8A 4KVGA 4ZOLF 1UP6A 2WF6A 3K5PA 2R11A 1GU7A 1LJUA 1YHYA 5LUAA 4W7IA 4ZOQI 1YIDA 4I9HA 2DKFA 4HXYA 1X15A 3KG2A 4MV9A 5KQRA 4Y6SA 3O8BA 5SY6A 3FR8A 1H2HA 5AMXA 5REQB 1OYYA 3BWVA 1G2OA 4BJ5A 4BEWA 4RTKA 2IHJA 2M6RA 4IMPA 2JF0A 3AIIA 1NVTA 1JEYA 1IWPB 1YBMA 4Z7OB 2HO4A 4NU6A 4Q18A 1W96A 2G3YA 2ZOSA 3VR2A 3L8HA 3ZJ4A 5A2QA 4YIHA 2ZDHA 4Q4CA 1GGKA 1MIOB 1RLJA 4Q3DA 4UUMA 3WYCA 3PDHA 4CM8A 3IQXA 3OT1B 4RIIA 1QANA 2ZUWA 1EFPA 1CUIA 1RKBA 1H9BA 1ZJ6A 1RRGA 2HDWA 2BWJA 3ZGOA 3FB4A 2ZZKA 3L7JA 3PXEA 2VHUA 2WTUA 3VPFA 2GCIA 1JFSA 3SX2A 2ZRDA 3WSVA 1C81A 2ZBUA 3DUFB 4QT0A 1BEEA 2R00A 1YE3A 1SCUB 3B3JA 4LXQA 4PFSA 1WE2A 4IDAA 3KZNA 4XJTA 1UPXA 3GEEA 4TT3D 4CMBA 1EIWA 1B2RA 1QHHB 4B3SB 4AW9A 4FEGA 6ABPA 3AI7A 4EMBA 3NR2A 1JPUA 1WD5A 1U5CA 2WG1A 3QNWA 2C0CA 4NU0A 1PAUA 2OAP1 3R3VA 5G53C 3SS7X 1XRPA 3D2BA 2ZE5A 1FMLA 1JXOA 5EJIA 5CEJA 5J23A 2WD8A 4DR2B 1A98A 3GL9A 3OZUA 3J81k 1QCDA 3R5FA 3F98A 3WB0A 5A02A 3C6KA 1U8FO 1P2GA 3K5IA 3ZV6A 1TZCA 2Q9BA 5DWQA 5TRTA 4CKXA 5CVUA 5B5SA 3RUPA 1G6HA 5JD6A 1TLLA 1P0QA 2H0AA 4HAIA 5DGIA 3VTFA 3AO0B 4JKOA 4WXRA 4MI9A 5I7WA 1ZGCA 4EI9A 3GGJA 3RK0A 3EDOA 2W8ZA 3N2YA 2ZU6A 3VQTA 1BU5A 3H2KA 1I6KA 4U39A 5C8YA 3KB6A 3RNOA 2R1VB 3T9DA 3R3YA 4DVGA 1YBVA 1O1YA 5HKOA 1T8TA 4MUBA 3GN2A 1U9JA 4C1BA 4F7DA 2X8AA 4ZCPA 6Q21A 3H97A 3FSEA 2Y68A 3X1MA 4DBZA 2NT3A 4J2HA 4M36A 3OQ1A 4ZCQA 4MDFA 1ZH8A 1DAKA 2BEVA 1LUAA 3G0CA 3O74A 3PQFA 4J1TC 4URZR 3UXHA 3EYAA 4IW3B 1KIMA 4NZMA 1MB4A 4FHFA 3ZZ0A 3B3FA 2VT3A 2Z56A 4BO2A 4ZDKA 3GLHA 2Q9AA 2H17A 3QVGB 3ZHYA 2G71A 1H8ED 4ZVTA 5GGXA 1BA2A 1OI3A 5KOHB 1S01A 1WXDA 2I6UA 4FD3A 1AF4A 4J4BA 3ZQUA 3MC1A 4J03A 5K6TA 2JCGA 3PJEA 3UA4A 3L4EA 2CJFA 4Y2VA 5KYTA 4IAOA 1PIWA 1SRQA 1AUOA 1ZI6A 5K45A 2ZZMA 3ZDQA 1WDTA 4TSFA 4Y67A 4H08A 2WNIA 4BBPA 2FRXA 3BH0A 3E3NA 1FLVA 1I0LA 4JDUA 5CAEB 2FYTA 4G1UC 1II8B 5IDYA 3MRVA 3I9V1 2V9CA 3BGDA 1Y6QA 2PXCA 1HDCA 1KH2A 1LQUA 1SA0B 2YZKA 3DZIA 4PFKA 2A1UA 4ZIRA 2XUZA 3QA9A 3RC7A 4NYIR 5AVTA 5LLTA 3IMCA 1LF0A 2H6EA 3RVBA 5FLEX 2QAGB 3PCRB 3QMWA 3AGQA 2PH3A 3LGXA 2ERCA 3IPLA 5FHRA 2WQZA 2VSFA 4HG2A 2VBIA 3KQWA 1X7GA 3DLPX 5IBPA 3ROMA 5T3YA 3UK2A 1TPZA 3RRJA 3NHSA 3WRXA 1WDMA 2JFNA 4ARIA 1QORA 1P1BA 2X4IA 3FG9A 1ACLA 3KTFA 5HF6A 4EG4A 3QEMB 5J5AA 4U4AA 1E7RA 1VJCA 4R8MA 2DPLA 1LDGA 1UDXA 2C83A 3VV2A 3LT5A 1Q92A 5CDFA 4X60A 4M1TA 3T9EA 3EXG2 4K9DA 2VAXA 1W0JD 3IIEA 2BPOA 3SYNA 2SKCA 1ZUNB 2O57A 1PGJA 3R8XA 3IVXA 5B2FA 3BMOB 2FSPA 5DNVA 3ZXUB 4GNRA 2P6MA 1DS6A 4RYLA 4CF4A 5KSWB 4NBNA 3E9NA 3VR6H 2DH6A 1PK8A 1I7QB 2Q1WA 3DEAA 3LX5A 3WKDA 1OFUA 5EGSA 4C3ZA 5J2UF 2Y6VA 4CMEC 4RD3A 3CR8A 4HRAA 4NDAA 5J3JA 4CN8A 3RG2A 1TCVA 1CKEA 5EIAA 3LX8A 2HF7A 5CB8A 5EZYF 4EAAA 1AUXA 4B7CA 1U99A 3FHJA 4WJZA 4TM8A 3FTEA 3Q6IA 2ETXA 3P2EA 2IHZA 4YXFA 3CH6A 1MAVA 2QG6A 4MQEA 1D3AA 4F86A 1KJ8A 5EJ2A 3O83A 1A7UA 2AA3A 5GONB 4RA9A 1K3TA 4EG8A 1AC5A 4X62B 4I5EA 2G7MC 1ENPA 1QH1A 4FEEA 5AH0A 1E6EA 2VPTA 2JIPA 4GR9A 1YR6A 1P7CA 4J07A 3U19A 1GG5A 4C05A 1Y8RB 2IOQA 1ZK4A 3PC3A 4BFXA 2CMFA 3RJMA 2IYXA 4CV0A 4B43A 4OI4A 5J4LA 1JLLB 4G0UA 2ZI7A 3KEMA 4EJSB 1P9WA 4ROTA 4Z8XA 3HC7A 3A10A 3UXEA 2BHRA 2P2LA 4IFIA 1X8KA 5JAUA 5LYYA 2QUJA 2GTHA 2YVKA 4IJ5A 3FRHA 3DMFA 1TIBA 4GZ5A 8GPBA 2QTHA 5A9RA 2A0FA 1ECGA 2PR7A 4G5SA 2R60A 5JJBA 1YTUA 2AQKA 2AYXA 3IJRA 3DOUA 1IEXA 3BIOA 5DRTA 5FULA 5HX7A 3FUUA 1E59A 1STOA 2XMGA 3HBFA 4II7A 4CM3A 5DN6A 3EUFA 3ORFA 4URHA 1Y8ZA 4LZOA 1U7UA 4Y9UA 4ZJUA 5F2OA 1D2AA 1YZNA 2GZAA 4K87A 3SHFA 1KEZA 1YC2A 3S8EA 5ICFA 2A5YB 1X42A 2J9YB 2QM0A 3W6NA 1Q1GA 2P1RA 4DE5A 3ELYA 2TS1A 4L9RA 2YMMA 4GR4A 2JKZA 1HPLA 1WHTB 3LCCA 1S1MA 4G2NA 3C3KA 1PO7A 2AG8A 1SC3A 1KZYC 2XWPA 1VIVA 1M8KA 3AERA 3D54D 4FYIA 3DNMA 4KN5A 1KMQA 4N0DA 3C39A 1HDGO 2HK6A 3UH0A 3W7BA 5F7OA 4TYNA 1X1AA 1EVZA 3GHYA 2VPQA 1P1IA 4LK2A 3H1FA 3KLOA 1C3LA 3IQFA 3QE4A 3C7KA 3G1UA 1MBZA 2O52A 4BO6A 4EHDA 1C7EA 4B6SA 1WMSA 3ZVKA 5A0FA 1XMIA 1WU7A 1DUSA 1QRRA 2RMKA 3OX1A 2M9MA 3BSFA 3JVVA 3RRMA 1SIUA 3Q2KA 4WZAA 3W4IA 9ABPA 3P7MA 5COAA 421PA 5L53A 5I9NA 3RH0A 1XLWA 4LOKA 4B4OA 4YRDA 2PUWA 1K4KA 4J1TA 2K7FA 1JR3E 2BGMA 3QITA 4KQKA 1YKGA 1K86A 4JD5A 4RQTA 1KEEA 2WAAA 1QHSA 4L3OA 1FNCA 1ZY2A 4FD2A 1MC4A 4H1UA 4F04A 1YS9A 3V8RA 3H3JA 1L5ZA 2RHBA 1UZLA 1WSBA 3CF6R 1WP9A 3QLVA 4GIBA 5EESA 5AW8A 4US1R 2CBGA 1IB6A 3NBXX 1OLSA 2CUKA 1OFVA 1ZOPA 5B12A 1O95D 1BAPA 2J46A 2X13A 1Y9ZA 2HPHA 3E2PA 3M4JA 4TXNA 1KPHA 4FHZA 4NV3A 1DMRA 3C74A 3TVTA 4EB8A 2IQIA 1E1RA 4LF9B 4NAVA 4QLOA 5CT8A 4JI3B 3R4CA 1JJAA 1OQAA 5AKKA 2CXUA 3WLKX 3ID6C 3R77A 4ILEA 2AXQA 1M2GA 1H6BA 1PGPA 3SSNA 4YV2A 1UF9A 3HB5X 5JNRA 4C08A 3RREA 5AXBA 3I30X 2RHTA 1NYQA 3O7MA 1HGXA 3HS3A 3QVTA 3W2HA 1ONOA 4N6GA 1QAMA 2R7LA 2II6A 3QYFA 4ZI7F 3I6YA 1YAJA 1KO1A 2WABA 3GG9A 1XU9A 2KSQA 4KXXA 4WZ6A 1L3IA 4CIYA 3FCUB 4Q34A 2B1RA 2MSWA 5JCPA 4UQLA 1QGYA 2GA9A 1V96A 2CT8A 1OSNA 4FJ2A 2P1ZA 3HEMA 3K15A 2EOAA 1BDIA 3PGXA 4R9UC 3KRTA 1U6JA 1HV8A 4ND1A 2Z09A 3EF1A 3REOA 3VAZA 4ARSA 4YYZA 1G8AA 5K8IA 2X1MA 4N48A 5CLHA 4EPTA 1QP4A 2XWBF 3MBIA 3VNBA 4D9BA 2BL4A 3PC8A 2WD7A 4JC0A 3ZS8A 1YE5A 1ZAYA 2DFPA 4KNVA 5AWFC 3PNKA 1WCWA 4RPHA 5I4CA 5DKFA 1S3IA 2WSLA 3L7BA 1TU3A 3PUYA 3TF5A 3ELWA 3D3KA 4ASUA 2J0QA 4MLZA 1EFVA 3KE9A 2ATVA 2CVFA 3TLKA 5F7ZA 4BLUA 1QO9A 1LLUA 2CLEB 3ITKA 4JR0A 2V0GA 3EFOB 3L6OO 3KTDA 2H65A 4QXMA 4D6PA 2GXUA 4AUEA 1OJLA 5GOTA 2WJ6A 2ZIFA 3IUBA 3M3PA 5AHKA 1W0KD 1PL0A 1EFVB 2BEUA 2Y05A 3NHUA 2XVXA 4GMHA 5LWQA 4QJ4A 2JAPA 3RAPR 4AD8A 2XMCA 3O3MB 3WGYA 3LQ2A 3A6JA 1CVIA 1I4OA 1PGQA 5LSAA 1P1FA 2V8OA 3ULKA 1RM5A 1NDHA 1Z28A 3M3HA 1XTIA 4KI7A 2YRFA 1X19A 2D2EA 1A1VA 1BGXT 3EW7A 5IKMA 5LB2A 4AUMA 1W1IA 1AV6A 3UV6A 1P81A 1OA1A 1LTQA 2H0RA 4FHEA 2CKMA 3LT0A 4IO0A 3LLUA 1NN5A 1KU0A 1DIHA 1Q7BA 2WJPA 3OF5A 4H60A 1C9KA 2VSXA 3PKIA 4LYJA 1EWTA 4MARA 2NMVA 1EJ6A 1WMEA 4S1TA 3CVJA 3TIGA 1CDDA 1X3SA 4U6SA 5LC1A 3OIVA 3SJZA 1QG6A 4DVJA 5A3QA 1VSBA 3RSQA 1SBCA 1ZITA 4LJAA 5B7QA 3CEAA 3F2VA 2OE2A 4M0PA 1C80A 4ZYUA 1ZVKA 4KMMA 1B41A 2CW5A 7GPBA 1FYXA 2WRZA 4NBVA 1P9NA 1MD9A 1AG9A 5KIAA 2ZRLA 1ZN9A 2ZB2A 4IZHA 5I7HA 2ACEA 4X6XA 4CKBA 3G0GA 2WUDA 4LRYA 3VH4A 1I30A 4UPEA 2J32A 3PD0A 1ZZEA 2QORA 1U31A 3H83A 3S1AA 3BF8A 1U8AA 2XYQA 3SLRA 4FOOA 3UWOA 1ONSA 2J3EA 2Y4OA 1MT0A 1M6VA 2I66A 5DTEA 3BKWA 4FS3A 2PZBA 1W7AA 3GELA 1FDRA 4LKRA 3ZXSA 3MJCA 3T4EA 5BVGA 3W05A 2O3SA 2Q4OA 1VQ1A 1YQQA 4D8VA 4GX5A 5CA1F 3CX7A 3QBJA 1FPQA 1H2AS 4U63A 3OTHA 4JUCA 3C5CA 4F06A 1M6EX 4R6WA 3LPNA 4F1WA 2CEAA 4MRMB 4UVEA 1E63A 1WSWA 1X70A 2QLLA 1BSVA 4IL5A 4LDQA 4Q1DA 4QGFA 1PQYA 5E1MA 3IUMA 5DULA 4HR7A 5JLAA 2QW1A 4C7OB 4YT4A 5IBCA 2P3LA 1OBVA 5TQ0A 4DWOA 1SXJB 4E1VA 2AL7A 3JVIA 2I2WA 2PR2A 3ZLVA 1O6FA 4RTQA 4KYVA 3PENA 3GLIE 2J08A 1Z25A 2HV9A 1IONA 1B26A 4EKDA 1NUUA 1N57A 4J49A 1MA3A 3ZGVA 3ZJUA 1PKEA 4DCOA 1YZKA 3GPCA 3RU9A 2ZREA 1LFDB 1NVUQ 1CNEA 2Y1CA 1J42A 1YS1X 2C9OA 5LOVF 2R6AA 3SC2B 1SU6A 1FJHA 5SYMA 4M8NE 2CHQA 4NK4A 3EOBI 2ZSUA 1VPTA 2Z1MA 1QYVA 3G9XA 5IC5A 4CYMA 3IQGX 1DXOA 1VRWA 3EB9A 3FOCA 3HM9A 1P1KA 4EFLA 5HQ3B 3A06A 4LQLA 2J85A 2BIFA 1KMNA 2HSZA 2ZUVA 4MVJF 1NBWB 4ZYVA 3CUUA 3LBAA 3NDPA 5G1PA 4TKLA 1PJBA 4X8OA 2HT6A 3I58A 1HMYA 3EXHB 2XW6A 3BWMA 5ECWA 1PDWA 4QUIA 3D1LA 3E48A 2WE7A 4JASB 3U6KA 1P0CA 3NTLA 3EWIA 4RXTA 1LV8A 3OIYA 5EHIA 2DWQA 1RM3A 5P8WA 1M1ZA 2J3JA 1KK3A 2VHQA 2WILA 3Q8KA 4WNAB 3KC2A 1L3BA 2A9VA 1NVFA 5JTTA 5JWOA 2V6IA 1LK5A 1REQB 5ESWA 3H1GA 4LKOA 2ZRJA 1JYSA 4G5HA 4C0JA 3CUEF 2JBAA 1SQ5A 1I2AA 2JIBA 3EC2A 1QHXA 3AJDA 2O0KA 3FN4A 3NT2A 4QECA 1W19A 5D3MA 2AOXA 1A8SA 2NZWA 1LPAB 2PM8A 4K26A 4R0VA 1V95A 3UV3A 5CB4A 1O96B 2LW7A 3E5NA 2BEJA 4S12A 5FA8A 2ZR0A 4YRRA 4TMKA 3L6BA 1M34B 5I7AA 1S2GA 2PUAA 2XX3A 1WKBA 4H16A 4CKYA 4WLNA 1P0IA 2Y2UA 4OJQA 1GNRA 2IE0A 3PDWA 4M37A 2VT7A 4TN5A 5C34B 1TJ4A 1RJGA 2FZGA 3PHJA 4NHEA 2CLIB 3HY3A 3RS0A 1SXGA 5ITZB 4MUGA 4X1IA 3SJUA 2ZIEA 3I6MA 4XB2A 3JSAA 4O1HA 1LA2A 3TEMA 2JLZA 1ADFA 1H8HA 3QA3E 2GX6A 3RQIA 5D51S 1UJ2A 2B4TO 1IRXA 4BNHA 1QIGA 3BMOA 1YC5A 3U2QA 3TJMA 4AULA 3U7JA 3EA5A 4JODA 1VP3A 2XADA 3KQTA 2AOVA 1W36D 2E85A 2QJRA 2WOOA 1GZSA 5T4BA 4RWZA 2ZYSA 1CY4A 1ST3A 4MX8A 4OGFA 1IWBB 3V2GA 4R8RA 3G5AA 3D1JA 3P0EA 4JQCA 4TUYB 2C1XA 5AM0A 1M2VA 3RHFA 1WNFA 4S1VA 3RS9A 4RVSA 2PRSA 3ORQA 3GU3A 4P4GA 2WMOB 3FGZA 5AI4A 2V97A 2VKQA 4ZRMA 1E7MA 2C5HA 2D3WA 1UBRS 2BJHA 2J9ZB 2P4SA 4HAXA 4IRUB 1CDZA 2Y76A 4US0R 4GG1A 1NRIA 4KGVA 1XJCA 1RXCA 4JYZA 2JGEA 4B3GA 1M0EA 1BVYF 4C4XA 3TDMA 2NZVG 2WP8J 3EQZA 2Z4RA 4LJ5A 5AKZA 4JJKA 3HDYA 3TOVA 3A14A 1HG1A 2PKRA 4TVBA 2DLDA 1V8OA 4TLCA 5AW5A 1VGQA 2QXUA 3MXTA 3S4YA 3D7SA 4MYCA 5EMJA 2PVSA 1RWWA 2W2VA 3KEGA 4AWAA 5BV1A 1ZK2A 1O58A 2DU8A 3CUTA 3E3OA 4FNGA 2J0EA 2MT9A 3EZ9A 3I04A 3MWKA 3ZQ4A 5JJ5A 5DRYA 5DTRA 1JKMA 2VDWA 5T57A 1V6CA 5IC6A 3OX2A 2JIZA 1FFBA 3M4ZA 5HK9A 1M7HA 2WMNB 4K88A 2QMUA 1VLMA 5DTQA 1RDFA 2QF7A 4U8GA 5F4BA 1E0DA 1I13A 1L7RA 1UJCA 1NQAO 1EB8A 3I1JA 3KFLA 1ZC3A 2V7QA 5THKA 1S02A 3USZA 3WV4A 3EEOA 1M2KA 4TOIA 2YYZA 1P74A 3W2IA 4BO4A 1E79D 1PJ8A 2BZ0A 2RJ3A 1S8NA 1UK6A 2N42A 3O1LA 1N2CB 2EYQA 4PBTA 4ZOAA 4EVIA 1NL3A 3O03A 4GBGA 1H6CA 3RGWS 5BQXA 3UAXA 4BMDA 1P33A 3AQIA 2YHUA 1L1FA 4CBVA 1QPGA 1JEEA 3FA2A 3HWWA 4GYYA 4DRXB 2IUEA 4LN1A 2DHEA 1TKCA 3B85A 1GP2A 1CV2A 2IYVA 3K0CC 4IWYA 4KR3A 2MYPA 3EXIA 4A6PA 5EUBA 2O7QA 5TJHA 4HWPA 5UKDA 4ZO6A 3W3AH 3JQPA 4HWTA 3CLKA 5FPSA 1U7ZA 5BQFA 2H00A 1U0TA 2NXEA 1OWLA 3C16C 4HNAB 4ZVMA 3VKWA 2G9ZA 1SVLA 4M1OA 1TEXA 2ZSIA 5T6MA 3T5MA 4BNNA 2PX6A 3GEPA 3DLAA 4Q4AB 3V5NA 3WV5A 3T1YB 4TZ6A 1C8BA 4ZODA 3U4DA 3OM1A 4YAJA 2FPRA 2FMIA 1EPUA 1T26A 3R0QA 3M4YA 4BO0A 4PZUA 2Q41A 1VPEA 4P38A 1N6PA 3IEVA 4OYLA 3E9RA 4KQ6A 1MB0A 3D4IA 1CERA 2AE1A 5HIIA 5LQSA 1IUOA 1X87A 4LF8B 1OI7A 1PUIA 3PE6A 3PR1A 2YJTD 1EJ2A 4QU0A 4MKXA 5KX5B 4Q1EA 4WK0B 3RTEA 4YQZA 1JAXA 1XHFA 3QFTA 1G7RA 1YFLA 2IH5A 2R1ZA 4RZXA 3OQNA 3Q41A 2FWMX 4V0NA 2Y0PA 3TE7A 1JR6A 4YALA 1NM5A 1PT8A 4FN5A 1CUZA 1BS1A 1ULHA 2GN8A 2UYYA 4B0OA 2A9KA 2ZTSA 1CRQA 3RSZA 1C1YA 3MA0A 2GNPA 2O6HA 1RJDA 2R8PA 2VJAA 4AY5A 1P73A 3X1KA 1MEEA 4B82A 1EFPB 2F3PA 5IPFA 1J1UA 2I2AA 2B21A 3T52A 3FIUA 3AB8A 5AM4A 1M1UA 3U39A 1XIVA 4GI2A 3M5CA 5A6SA 2HGZA 4JP2A 3KQYA 3GBSA 3ZE8A 2JBAB 4HDQB 4JB8A 2ZBFA 1G3UA 4HWKA 3AV0B 3I28A 3V8PA 2J5KA 5LOVA 4UREA 1GAXA 2WAYA 2BFWA 3WIEA 3N0WA 4ZQGA 4IVPA 2YJZA 4G4IA 4W9RA 2M1XA 2NSYA 2Z9DA 3IJ5A 1IG0A 3QKIA 4JYBA 4PLWA 1ZJWA 4AB1A 4CKZA 4RMNA 2GR9A 4J7AA 1RSZA 3FMOB 3JQFC 3BXFA 3P4XA 4YV0A 3C14C 3E7FA 4UFPA 1IAQA 3P32A 1VKRA 3TLYA 2C4HA 1R6DA 5DHUA 4PZ9A 4QJ5A 5KX5F 2WF5A 3CVOA 4DNOA 3ADKA 5E1DA 2GD6A 4MQMA 2EQAA 4XXHA 4AZSA 4D99A 5D2CA 3HCOA 1H8HD 1GR0A 4BQFA 4CFYA 3EOAI 1MAHA 2IH4A 3QKSA 2HJVA 3X44A 2J45A 4BFVA 4KR9A 2WUWE 2DR2A 5HIKA 3GDHA 1U7TA 2PGIA 1IUKA 1FQOA 2ZRMA 3DGEC 4LY6A 1NW3A 2HL6A 1T3SA 2BFDA 5HUJA 2H11A 1EXDA 4C0WA 3W5AA 2W93A 3EG9A 4WLOA 1QWSA 1U0NA 3BKXA 4O8ZA 4MIOA 1K75A 3VH1A 5K8JB 2EQ5A 4N01A 4MW2A 4XB6B 1NAHA 3HB4X 5SZJA 4M9CA 2UUAB 2QYSA 1H2YA 3PI7A 5ALKA 4F60A 4B40A 1NI5A 3NNNA 4RZUA 1JDBB 4O2AB 1JA0A 5CPBA 1JL3A 1KI6B 1RI3A 1IQ0A 4JB3A 2HR1A 1WW2A 3QVUA 5BQ5A 2Q2OA 1YOVB 1E7QA 2PFGA 4GL4A 1GSAA 2PJUA 2JLSA 3TQRA 3U7QA 5JAIA 3OFKA 3PWSA 1PVVA 5DM60 3OCCA 2WHPB 4RZQA 1SQFA 2PE5A 1GPBA 5A6SB 1Z8HA 2FPPB 4YT8A 4LWQA 4D4MA 4LZNA 1TEHA 1WVIA 2BJVA 3G9QA 3H5RA 3P4UA 2XMPA 3JQ7A 5E95A 5F52A 3UJNA 3RC8A 3LD9A 3IC5A 5TMDA 5AJYA 1MEOA 3QX7A 3K9GA 3EF3A 221PA 4O8CA 3C1UA 1Z5PA 4PAMA 1NQXA 2IYAA 2PPVA 4YAFA 4EEZA 5J47A 4TRNA 4YCNA 3F5FA 1P62B 1N2ZA 3QPWA 4P34A 4FBGA 5HGXA 5C51B 2BM0A 1U8XX 4BNTA 5KX5A 4I4LA 1RXYA 1CZOA 2HIAA 3H1TA 1H2XA 2BC9A 4ALMA 2OYSA 4Q66C 3RIMA 5IJ9A 3PITA 2Q6IA 3FI9A 4IWNA 3FYTA 2IXEA 1EBUA 1RZRD 4JR2A 5CR9A 1V37A 2GKGA 3B6KA 3JQAB 3MWGA 3QXCA 1PWZA 4UMDA 5J2TB 4CKBB 5AW6A 2R68A 3SX4A 3LYUA 3L1KA 4G5QA 2ZW9A 3PQ2A 3KJHA 4GPTA 3NVDA 3D2AA 3RKSA 1DAOA 2Z83A 2BGUA 2QX6A 4CF3A 2QUAA 2B3TA 5CHYA 1JG6A 3V6LA 2FX3A 4N5IX 4W1RA 4RZSA 1XROA 2FPUA 1V39A 3NXKA 3LCRA 5CDGA 1UMDA 2IGBA 4X91A 2WUGA 3IGFA 2H2IA 3MBOA 3BORA 1A5ZA 4NYIQ 1GKIA 1YQDA 3HUFA 4URUR 4KDCA 3GGSA 4IIUA 3BM5A 2CCKA 3CV3A 4TV9F 2QTVB 1YS7A 3TW6A 3MUEA 2NLOA 1E0SA 3LMKA 4MRRA 3UC9A 3NM5A 1N2CA 3ZX5A 4DV5B 5FBQB 4GC5A 3SDZA 1ULAA 4AL4A 1SH7A 3BCHA 3X1YA 1NVMB 4DMGA 3UB3A 2P67A 3WA6A 4EFMA 2GPNA 5IKXA 2MYNA 4LXGA 4RGQA 4ED9A 3EEQA 4ZGWA 3EFEA 4RE6A 1FFCA 3FMFA 1LSOA 2D1QA 3GJ8A 5DBEX 5G0UA 3TYXA 1JSCA 2B35A 1WRBA 2ZPAA 4FEAA 2FR8A 4RCZA 5EINA 3ZZMA 3DV2A 3GWZA 3O92A 4FONA 2QENA 3ZD9A 1RWXA 2DKNA 3C1TA 3PFKA 5L3QB 1ZM9A 2ZJ8A 2LXNA 4RJ2A 2O2DA 1ZG3A 4OP3A 2WSIA 5DN9A 3NYIA 2GRUA 4Y3UA 3TZQA 5DBGA 3AUXA 3VR6D 4K2HA 5KVSA 4CR7A 5DI9A 3BA6A 1R2QA 4AM8A 1X7YB 2ZROA 2HA2A 4O63O 5E0KB 3FYUA 1Y1LA 3GZNB 4Y6LA 3H2GA 1JJIA 4GP6A 2AKEA 1DDGA 3WFIA 3THYB 2K7ZA 3DLTA 4XGRA 1PI3A 1GUAA 5EC8A 3G89A 1G9XA 1Q0TA 3NO4A 2I91A 2WKPA 3QI2A 3QMPA 3OE1A 3QOWA 1HO3A 1TMGE 1WZUA 4ODIA 3EYWA 5AYVA 3UT0A 3ZWVA 2CB0A 1U3TA 3IFSA 1X14A 4Q21A 1ITZA 3O4IA 5HTKA 4Z7NB 1A04A 3GRUA 5TS3A 4CXMA 4UCQA 1DFGA 1Q0UA 2VDJA 4BRUA 1VHLA 4Q4JB 4WNYA 3GJYA 5JBIA 3L1HA 2P11A 3FTCA 3P71T 1LZKA 4NH4A 1LDNA 1G5IA 3CNOA 4CIVA 1WHSA 2P9TA 4AJLA 1RCUA 3C6XA 3DT9A 3B6MA 1FUUA 1RM4A 4EZEA 4LVUA 2G9RA 4J4HA 4FCCA 4LCBA 4BMZA 4KTVE 4ZP1A 2GD0A 3I9JA 2QT1A 3PT5A 4IDFA 1DJNA 4TLLB 4K05A 2VNKA 1OROA 1JBEA 1SKQA 2VP4A 2WWHA 3C45A 2GZSA 3OQHA 4RTLA 5CDSA 5JXIA 2EKQA 5DNCA 4LF5B 1QZZA 5GGYA 1XCJA 3V4LA 1DDOA 2I4MA 4QIHA 3GH1A 4L8LA 4QL3A 4HDNA 1H5NA 2CMHA 1BE8A 2NAFA 2GEVA 2ACKA 1DT3A 3DOIA 3PGMA 3SHQA 4XB1A 4XLTA 3WWCA 1IAVA 1HTTA 1MT3A 1FP4B 1K6EA 1ZGJA 1JKIA 2WAOA 2Z2ZA 3BRWD 3PUZA 4K03A 4PVDA 1Q17A 4YYEA 1SY7A 5HFAA 1GFZA 2WJWA 3GLRA 4MWTA 4FX2A 4PYQA 3RO7A 4BJ3A 1ELOA 1KZ9A 3UPDA 3H18A 4YMWA 1FDTA 1EFKA 5D8DA 5DYGA 1VXRA 1QZ3A 2KYRA 3V32A 5A5VA 3DMDA 1QFYA 4R9SA 5FTNA 3V4OA 3CH5A 4C6RA 4C20A 1CP3A 4G3XA 5CBPB 3L1UA 4DA7A 1VJRA 4TTVA 5DNAA 2C2HA 2VP3A 4GI3A 4PLVA 3I4CA 2PH5A 5KYVA 2C29D 4IHAA 1EP1B 2P62A 3QE2A 4MVJM 2JFHA 2D2FA 2RGDA 3NNSA 3H9UA 2DUWA 3E1KA 3L7AA 4FYPA 4JX8A 4K0RA 1X6VA 3QPVA 1EFLA 4BDSA 5CFMA 2GFQA 3VU9A 4C06A 1E5QA 1JTEA 4ZZ2A 2ZRNA 4BN0A 3DJYA 3OOHA 4JBIA 3RJ9A 4QGSA 4PYOA 1J8FA 2EL9A 3F1KA 5SZHB 2FW9A 1MU0A 3FNFA 4EFKA 3NTXA 4YH1A 2XVAA 1ZOLA 4RGYA 3SXUA 3THXB 1L5MA 2VK2A 2M2IA 3DLCA 1OB5A 3KSRA 1JHPA 2OPHA 2O8FA 3DAGA 4ZDWA 5B2EA 2G4CA 4IO1A 4B2IA 3TG8A 1A9XB 4DEVA 2VLIA 2JAUA 1YMUA 4CQJA 2AI3A 1GARA 1ZHFA 1EXNA 4OLAA 2WM3A 3WK7A 5EIHA 1UBUS 3D7KA 2X76A 4OHVA 1QO0D 3EXHA 1BC5A 5HQTA 2BHLA 4Z4FA 1WHTA 1IPHA 1PQPA 3C3YA