4Z49A

Homo sapiens fatty acid synthetase, thioesterase domain at 1.7 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
262
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Estimation of Hydrogen-Exchange Protection Factors from MD Simulation Based on Amide Hydrogen Bonding Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fatty acid synthase
total genus 95
structure length 262
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 4z49A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z49A01
4G9GA 2HRRA 3WKDA 4INZA 3G8YA 3LCRA 4X90A 5T4HA 3DL7A 2O7RA 2AJCA 5HK9A 5CBKA 1XRLA 2OGSA 1CUBA 4MYDA 5A62A 4AN1A 4UHDA 4OPMA 4J0HA 5ALTA 1GPLA 5A6VA 2Y2UA 3KWJA 1UKAA 5C7YA 3AIKA 3H2JA 5EHZA 3DNMA 1QOZA 2WHPB 2VAXA 3UMJA 3A2MA 4DM7A 1CUIA 4CG3A 4W1PA 3WK9A 4AO6A 2X8BA 3A2NA 1T4MA 3C8HA 5AI6A 3G0BA 4XVCA 2XDWA 3JW8A 4G1FA 2XMGA 1EDBA 3FWHA 4L3WA 4BATA 1CEXA 3NWOA 2D0DA 4FNMA 5ALGA 3VJKA 4A23A 1WHTA 4WCVA 1P0MA 1JJFA 2IX9A 4MQMA 4JH0A 1FJ2A 2I3DA 3KD2A 1FFCA 3WWOA 4ETWA 2HU7A 4X95A 4DSZA 1E3QA 3DYIA 1WCYA 2VSQA 5AKXA 1F8UA 2XUAA 3IUMA 1XZJA 2XI4A 3L1IA 1DQYA 2C5GA 4FLFA 1K5PA 1Y7HA 2H7XA 5K3FA 2PKYX 2PSDA 4KACA 2HL6A 1ZI6A 5HF5A 1F0PA 4KE8A 1ZD5A 2XB6A 1EH5A 4BAZA 5AKLA 1XQYA 4U2GA 2VA9A 2HFKA 1Y37A 2BGRA 1E8DA 4B80A 3STWA 3GROA 4YPVA 2BUAA 4I3FA 2WUGA 5E4JA 3HEAA 1HLGA 3STTA 1LPMA 5JALA 4K6HA 5SYNA 2VATA 1QONA 5ALJA 2VT7A 4FKBA 4EA6A 3HLKA 3QMVA 3DYVA 4RGYA 5DWDA 1WM1A 3R41A 1YA4A 2QM0A 5D3KA 4NZZA 4H7DA 2OAGA 2WQZA 3QVMA 1R9MA 2JGEA 5CH3A 4G4JA 3OOSA 2EDCA 2Y6VA 3WKCA 1TIBA 4XIIA 1LNSA 1DQZA 2OGZA 1WHSA 3QMWA 4OYYA 5CT8A 4PW0A 5LZ5A 4MXDA 3WL7A 4Q1VA 1GXSA 2BAGA 1TQHA 2J4CA 3ZLVA 1WPRA 1SOMA 4G9EA 4HXGA 1VXRA 2RI6A 5IVDA 5ALPA 3FYUB 2XQFA 3K9BA 1JKMA 4Y9SA 4U2DA 5HQ3B 4WFIA 1D07A 4EY7A 2PSHA 2XLBA 4M0FA 4UBLA 4LXIA 2RIPA 4XX1A 3DS8A 1UK8A 3WLAA 2QJWA 1ZD3A 4C6HA 3I28A 1ZGCA 4DNPA 1JU4A 1EK2A 2GZSA 3QYJA 4FLEA 3D4LA 4FFVA 4Y2VA 5FV4A 1QIFA 2QS9A 3KDAA 1QFSA 2H7CA 5KREA 1QIHA 4QDXA 2HA5A 3CCBA 4FNGA 2Y6UA 3I6ZA 2Z3WA 3CN9A 3H2KA 4B81A 3PDCA 5BWBA 5ALEA 3RARA 1LBTA 4GDMA 1CV2A 5ALHA 3O95A 2VJDA 5LZ7A 2HHAA 2HIHA 2HA2A 1A88A 2G63A 4QDTA 3U1TA 4QZVA 3QPCA 2QKYA 1BS9A 2Y2VA 3B5EA 2XQKA 5JAHA 4QWMA 4ZGBA 3ZWQA 2C58A 5AI5A 2WUDA 3O9VA 4Q34A 5C81A 1FFEA 1DT5A 4P92A 4Y2XA 1XLWA 4FOLA 1AZWA 4X91A 2OQVA 2XUJA 1P0IA 5FDFA 3PI6A 5HF8A 2XUDA 3BXPA 5DNVA 2CKMA 1C7JA 2QOEA 5JAUA 5CH8A 2QMQA 5HF9A 3NGMA 4N8DA 4CG2A 4KR0A 2HA3A 4FDMA 2WHRA 2R11A 3QPAA 1XZLA 3H2GA 2ZJ6A 3QH4A 2HU5A 3DKRA 5AH0A 5DNWA 2WHQA 3ANSA 4IH4A 3BJMA 1AC5A 4QLOA 5LP1A 3WIOA 4PSDA 1JFRA 1HQDA 1U2EA 2CEKA 5AKIA 2Y1KA 1LPPA 4WDRA 4Y2YA 4L9AA 3PF9A 3OPMA 2ACEA 4KRYA 4WFKA 1MNAA 4UHHA 1KU6A 3H18A 2J4FA 5ALWA 4BAGA 4F0JA 4FMPA 1FFBA 5HCUA 3R3UA 3OTQA 1Q0ZA 4C87A 5AKGA 1EXWA 4E11A 5AM5A 3M82A 2OCLA 3FSGD 1XQVA 3BDVA 3H04A 3STYA 3WL6A 1XZKA 1SCKA 1XQXA 4WDQA 4Y2UA 1ORVA 2O2HA 2JEYA 1CUCA 4DTCA 2HADA 2B20A 3W9UA 1UWCA 2Z8ZA 4H18A 4RE6A 5ALLA 2AJDA 2BGNA 1XZMA 3BDIA 1UKBA 2Z8XA 5FRDA 4FWBA 5K3AA 2DFPA 1DWPA 1U65A 3L1JA 3ZV7A 1QFMA 2WM2A 7YASA 4BE4A 4KEAA 5T4BA 1GKLA 1QIDA 3WWCA 3SC2A 4B9EA 2QTBA 2OPHA 3AZQA 2FJ0A 3IUNA 3T52A 5AP9A 1R4ZA 3ZLTA 3WKAA 5HF6A 2PL5A 1A7UA 2XUQA 3NOXA 2QJRA 3HABA 4UHFA 5CT6A 4U2CA 1QLWA 1S8OA 2J3DA 3I6YA 4QDZA 1H2XA 3ILSA 4W1QA 1ZD2P 4Y2JA 3BE8A 3DCNA 4GBGA 4AO7A 2ECFA 2ONCA 1QGED 5JASA 1R9NA 3KSRA 4KAJA 1DTEA 2ORYA 1CR6A 4KE6A 2AJBA 2OG1A 4L0CA 2WJ6A 3U0VA 4IH9A 3FLBA 3N0TA 4WJLA 1K6EA 3MGAA 4B9AA 3MVEA 1SCIA 2B9VA 1WB6A 1CFJA 2WFMA 3O0DA 3C8DA 1N1MA 3B12A 3RM3A 2WG0A 5AIAA 4OB7A 4CCYB 2XMRA 1O6GA 2BKLA 1SC9A 4YK7A 5JYCA 2CUTA 2G4LA 5CT5A 1DT3A 1ZGBA 1QIGA 1W75A 5T4EA 5LKAA 4C4YA 4EY4A 4JYPA 5JATA 3HXKA 2XUKA 4BRZA 1ODCA 2WILA 3WIBA 4BYMA 1W52X 3WJ1A 1TAHA 3W2TA 1AX9A 1WB4A 3UUFA 4B0PA 1EVQA 1W6RA 3FYUA 5ALFA 4ZV7A 4TPKA 1MT3A 1XKLA 2XMZA 1XKTA 3H17A 4G8BA 5EGNA 5DNUA 2OAEA 2ROQA 3GUUA 3YASA 1Y7IA 3P2MA 4OD0A 3IIIA 1NU6A 1LBSA 2HU8A 3G0GA 1YASA 3R3XA 2WUFA 4Y2QA 4HVTA 2BFNA 5AI4A 1A8QA 5D6OA 1VOTA 4FBLA 3D59A 1QJ4A 1L7QA 5FXMA 2JGFA 5LYYA 1UK6A 1P0PA 1DWQA 2XUGA 3H19A 4DSAA 2Q0XA 4PO3X 3WI7A 3I2FA 2HRQA 1OCEA 1BRTA 2VEOA 3ZI7A 2GYVA 4B83A 2ZVDA 3I2IA 4LKOA 1VZ2A 5FPQA 4G4IA 1TCBA 2C0PA 3V1NA 2DHEA 4KE7A 1THTA 4X6UA 2BCEA 4NVRA 3LP5A 1IMJA 3C6BA 3O4JA 4AQDA 1X2EA 5FKJA 3AIMA 1CUZA 4HAIA 1OXMA 1WOMA 2EDAA 3DD5A 3LIIA 4ZI5A 1JI3A 3OC0A 3QMMA 4J0GA 2Z3ZA 3FLAA 3AZPA 1BCSA 3R3WA 4D9JA 1DX6A 1ODSA 3QM1A 5CT4A 3NUZA 2YH2A 1T2NA 1BEEA 1HBJA 5AI8A 5I9IA 1YB7A 4EHBA 1E89A 3FCXA 1CUSA 3HYSA 2FJPA 4HXEB 2XUOA 4UHBA 3ICWA 5JZ9A 3QPDA 5ALSA 2VTVA 5CRIA 5DTJA 1I6WA 3TJMA 3G0CA 4EY5A 5ALRA 4TVKA 4JYMA 1HL7A 5AI9A 4ROTA 4B82A 4WFJA 1AKNA 2O2GA 4HZGA 1Q84A 3DEAA 4X97A 4KE9A 3EBLA 4BE9A 1G4HA 3IA2A 3DQZA 5IVHA 3S2ZA 2XMCA 1SCQA 1GQSA 2YXPX 5I7UA 1UOQA 4HRXA 4OU5A 4PNZA 1XROA 2PBLA 4P93A 5ALVA 4U2FA 3SX4A 1AMNA 1ZIXA 5JZSA 1WB5A 4DMCA 2PUHA 4EBBA 5AM2A 5JAOA 4W1RA 5CXUA 1AGYA 5ALMA 4BTLA 4MJ3A 4ZREA 4PSUA 4ZV9A 2VT6A 1H22A 4QA9A 4UHEA 1GT6A 5D3ZA 4Q05A 2G5PA 5IH7A 5CXXA 2JGJA 2OGTA 2HA4A 1IUOA 2HDWA 4MEBA 3E1GA 1CUGA 2AJ8A 3FYTA 5AM3A 4BCCA 5ALUA 4NMWA 5AK5A 3OG9A 4C01A 2GBIA 3D2CA 5BV7A 4UBJA 5A7FA 5JARA 1AUOA 4K2AA 1MTZA 3AILA 1EDEA 4RE5A 4B0OA 1C4XA 5F4ZA 2C0QA 1UOOA 3HSSA 4GHWA 2WIKA 2XUHA 3WKBA 5ALYA 1H2WA 1EB9A 1ZICA 4GI1A 4OYLA 5AK6A 5AJHA 4BZZA 2PPLA 4C88A 1XRMA 1XQWA 1ORWA 4GEGA 1XZFA 3FSGA 1BN6A 1MAAA 5CURA 4LHEA 1CQZA 2OCGA 4W1SA 3WKEA 5JD5A 1WPXA 4KYVA 4K5QA 2ZYRA 3WL5A 3D2BA 4GW3A 2ZSHA 1BEZA 4IO0A 3HACA 1L7RA 4BVKA 2WFZA 1HDEA 2WUEA 4DLNA 3H1AA 5CH5A 3V1MA 4N8SA 4EY6A 4FTWA 4QDUA 4CIAA 4X92A 3ESBA 3ICVA 4BZWA 1CUFA 2V9ZA 4AN0A 2WIGA 5E2IA 3BF8A 3KXPA 2D5LA 1E8NA 1EVEA 3WZLA 1ACLA 2CMFA 2V98A 1XRPA 1CUWA 3F97A 4WY8A 2V97A 1A8SA 4XJVA 2BJHA 1N5MA 4DYHA 2GYUA 5C8ZA 5EIAA 5A71A 5LKRA 4ZXFA 4CCYA 3FYUC 1QZ3A 5JD4A 2VJCA 5A7GA 5FUMA 3MUNA 2WTNA 1EA5A 4ZRDA 2QXTA 3C6YA 1VZ3A 2UZ0A 2ZJ7A 2AXEA 1ETHA 2J3QA 4B7ZA 3B3QA 2H7YA 4YASA 4GXNA 1GGVA 1P0QA 2ZJFA 4OU4A 5HK8A 1QIMA 1QO9A 1TCAA 5ALQA 1RYYA 1UK7A 2WIDA 1YSCA 1U8EA 2RONA 2QVBA 3K6KA 3JWEA 3QZUA 3D0KA 5HKAA 1RWQA 4PQEA 3ZLUA 3I1IA 2IITA 1MN6A 2G5TA 3EQ8A 5DYTA 5KWJA 5JADA 3ESCA 3HRHA 2JGIA 1AURA 3I2JA 5AHXA 4Y7DA 2HFJA 1N5RA 2PX6A 5AK3A 5LZ9A 1VA5A 4K6GA 4AMZA 4KAAA 1FSSA 1J07A 3RK4A 4Z49A 4J0KA 3BWXA 2XMQA 4H7KA 3C87A 1ZJ4A 5FPPA 5DTIA 3GBSA 4G4GA 1VE7A 2HA0A 5ISMA 1LGYA 4BP9A 1XLVA 3VISA 3AJAA 5AKYA 1KEZA 2RGUA 4FFWA 5AI0A 4BVJA 3DLTA 1BU8A 2JEZA 3FOBA 2VJBA 3IB3A 3D7RA 2HA7A 2R8BA 5HFNA 1JT2A 4C4XA 2PSJA 4C89A 5EI5A 3G0DA 4U2EA 1CRLA 4DIUA 3M83A 2FX5A 5BWCA 2XUIA 1XRQA 4UBIA 2XQJA 1QIJA 2AJLI 1ZI8A 2YASA 2B61A 1VLQA 2XMBA 5AOCA 3WWDA 3Q8WA 5AIBA 1PFQA 4HS9A 3FNBA 1DINA 1JMKC 1ZOIA 4H77A 1FFDA 2W6CX 4AB1A 1E66A 1OILA 3PF8A 1E8MA 3DOHA 2QT9A 2JGKA 3WL8A 5JZBA 4EZIA 4J0IA 4PF1A 2WIFA 4DGQA 5K3CA 1CPYA 4UBNA 5LLSA 4H7JA 3V48A 1QIEA 2XUPA 4QDOA 4QWWA 5CW2A 4J03A 3FCYA 1UK9A 4BRSA 1IUPA 3E0XA 1W4LA 2WJ4A 1O6FA 1XRRA 3BL8A 2WIJA 5K3DA 1M33A 4IH1A 5K3EA 1G66A 5HKBA 4AZ0A 5JD6A 2CB9A 1R3DA 1R1DA 2IIVA 1BROA 4AXBA 4J3JA 1CLEA 4LXGA 2ZYSA 2XT0A 2WU4A 1G42A 1TK3A 4MWTA 3I2HA 2JBWA 1BE0A 3ED1A 3WK4A 2C5FA 1DX4A 2CZQA 2WLSA 3I6MA 4ITVA 4N5IX 3CXUA 4FLMA 1JJBA 3F98A 1BN7A 2DQZA 4P08A 3SK0A 4OCZA 1LPSA 3AUKA 1XZHA 2QRUA 3ESAA 2JIDA 1QE3A 5A2GA 3C43A 5EHNA 5DLPA 6YASA 4K6KA 4V2IA 1Q0RA 4J0DA 4CCWA 3V1KA 1J2EA 2XQIA 1XFDA 4G5XA 1MPXA 2NW6A 5LIPA 3DOIA 4BTVA 5C8VA 5HFAA 4EUSA 4HXFB 3EIOA 1JJIA 1XZBA 3WK8A 1UT6A 2OLEA 4AX4A 3VVLA 2X76A 3DKKA 3AINA 1UZAA 2ZYIA 3R0VA 4JUIA 1NX9A 3FLEA 4E15A 3I1YA 3PFBA 1N8SA 4BCDA 3AFIA 3PE6A 3PFCA 3STVA 3HJUA 4ARBA 4M0EA 1UXOA 5IVIA 2O7VA 1CUHA 3G02A 2WG2A 3PUIA 3IDAA 1VKHA 2BUCA 4LYDA 2X5XA 2DHCA 2GBFA 2GBCA 1XZDA 3LLCA 4QE3A 1CUYA 3I2GA 1MNQA 4UBMA 3CCCA 4OB6A 4UBKA 4AZ3A 4H0CA 4LXHA 3OM8A 4F5ZA 5AM0A 2WHPA 1L7AA 1MJ5A 1YAJA 1EB8A 1MX9A 4X85A 3F8SA 3C70A 2GYWA 3PICA 1MO2A 3FAKA 4X7BA 4G8DA 2PUJA 4BB0A 4C4ZA 3WK7A 2WFLA 3BIWA 4HTAA 5HQ3A 4X94A 3N2ZB 1J06A 4OSEA 1CUVA 2WTMA 3IULA 1QTRA 4I19A 2RAUA 4HRYA 2C4HA 4XWGA 4L72A 2XQGA 1CUAA 1X2BA 3ZPXA 2I78A 1ZIYA 3C5VA 4E14A 3O9MA 2DR0A 2QUAA 1ACJA 3VXKA 1VXOA 3G9XA 1MX5A 5EIHA 2H1IA 4UFOA 1XZCA 2BUBA 2QR5A 4Q3KA 2OCKA 2DSNA 1USWA 4J7AA 3WJ2A 1W1IA 1R88A 4B85A 4CFSA 5FOQA 5AOAA 5JAPA 1CUUA 1X70A 2P8SA 1EINA 3F67A 4BBZA 3WK5A 4TGLA 2PSFA 3RLIA 4X93A 3EF3A 3S8YA 1ODTC 5YASA 3LS2A 5H3HA 1Z68A 3G0IA 3BIXA 4KRXA 4UPDA 3OURA 1ZJ5A 1CUDA 4AO8A 2VF2A 3K2IA 2GZRA 3M81A 3L1HA 4G8CA 3STXA 4N5HX 5K3FB 2WG1A 4H7IA 1VA4A 4BCBA 1CIJA 3V9AA 2HA6A 2W22A 2PM8A 1VJ5A 4B6GA 3F9CA 3C5WP 3TGLA 3ANTA 1YAHA 1IUNA 3O4IA 4U2BA 1TKRA 1EK1A 4KAFA 4WY5A 4BAUA 4Y2SA 2I03A 4EY8A 3X3HA 4EB0A 4CG1A 1HPLA 5ALZA 1LLFA 5I8PA 3SWWA 2GBGA 3C45A 2XE4A 3FVRA 4N8EA 5AKHA 4BP8A 3WYNA 1THGA 3R3YA 2VJAA 2VAVA 3DL4A 3IURA 1GZ7A 2EEPA 4X6XA 3G7NA 2ACKA 5FP0A 2C7BA 3H2HA 1DWOA 2PU5A 1GPKA 4IHAA 2OCIA 3IVMA 2XLCA 1E5TA 4QNNA 1CQWA 2B4KA 3EQ9A 4Y2PA 1IVYA 1UFOA 3D2AA 1ZI9A 3GELA 1TCCA 3IBTA 3LIPA 3IUQA 4FBMA 4GECA 1C7IA 1PJAA 2PSEA 2QZPA 3W9BA 2YYSA 4H7EA 3VJLA 3WMRA 2ES4A 3KWFA 4BVLA 1QTIA 4MWSA 5HZGA 3QBJA 5IVKA 4H7HA 4GLBA 4PV7A 5DYYA 1ISPA 3C6XA 4YX9A 5ALKA 1FFAA 4DNOA 4DMHA 3H1BA 4W9RA 3WWEA 3DDUA 3WWPA 4MEAA 1K8QA 3C6ZA 3W06A 4X71A 5EHQA 3W04A 2XMDA 5FLKA 4UHCA 2ZYHA 1JU3A 3H2IA 4PSCA 1LZLA 3WA7A 4I4CA 5AK4A 1PV1A 5E4YA 1YR2A 2XMSA 3WZMA 1UOPA 4A16A 2XUFA 5ALDA 5DYWA 4QLAA 3MUOA 1MX1A 5CMLA 1AQLA 3FBWA 4KJXA 5K5EA 3HC7A 5LZ8A 1CVLA 4BDSA 1G5FA 1J1IA 1LPNA 3WA6A 1IZ7A 5AKZA 4Q3LA 4DMKA 3EQ7A 1CUJA 3G9TA 1H2ZA 1YB6A 2E3JA 3M3DA 1BCRA 4DNQA 1K63A 1ZD4A 1EDDA 5D7BA 1SFRA 1GQRA 2WU3A 4LYEA 1GKKA 1CUEA 1RP1A 5E4TA 2V96A 2Z5GA 3CN7A 3AIOA 2O2IA 5EIEA 3VVMA 3G9UA 1YCDA 4ZWNA 3VDXA 3RKSA 1K4YA 5A7HA 1GPNA 5LZ2A 1KU0A 3I2KA 3G9ZA 1EHYA 2OQIA 3WQHA 1A8UA 5CT9A 1TRHA 4GWLA 1DU4A 1NU8A 5JANA 3PUHA 3TRDA 2QXUA 1XLUA 2WKWA 5BOVA 1YA8A 3H0CA 2K2QB 3A2LA 4UFNA 2DQYA 3D3NA 4OUKX 5CTAA 4BC1A 3R3VA 1CUXA 4H7FA 4MYSA 4X6YA 3VJMA 1LPBB 5AM4A 5AO9A 5AOBA 4UBOA 3BJRA 1EI9A 1F6WA 2DHDA 3R3ZA 3O4HA 5KBYA 1QIIA 1QO7A 4Y2TA 4FHZA 2JGMA 5T4FA 1QIKA 5AKEA 3VKFA 3WK6A 4P9NA 4S0XA 1U4NA 3A6ZA 4LIPD 2VQ6A 2QUBA 4NS4A 3HZOA 1F0NA 3DJYA 5LZ4A 1LPAB 2RHTA 1JMYA 1XRNA 5SYMA 1XZIA 3R40A 2ZSIA 3GFFA 2RHWA 1UKCA 5AKJA 3ESDA 4A5SA 3E3AA 4JNCA 3D5EA 3Q0TA 4F21A 5AICA 4OB8A 3F96A 4Y2RA 2OXEA 3T4UA 4IQ4A 3WYDA 4JEIA 3E4DA 4RPCA 5IKXA 5ALNA 2JGLA 3BF7A 4DMFA 2PVSA 3V1LA 3STUA 1R50A 4B84A 1LPOA 4QEKA 4E46A 1W76A 5ESRA 4CI9A 1MAHA 1YS2X 1MU0A 4X3CA 5EHXA 1XZEA 2CJPA 5K3BA 5AM1A 4M0MA 4Q3OA 2WSLA 4DNFA 1B41A 1LZKA 5JIBA 4J0CA 4J0JA 4BDTA 2I3ZA 3GA7A 3HI4A 4UUQA 4BC0A 2JF0A 4X00A 3JYHA 3AZOA 2WJ3A 5KWIA 4UFPA 2WFLB 4ARAA 4O08A 3FVTA 4RNCA 4CIBA 1XZAA 5ALIA 3IUJA 1VE6A 2HM7A 3W05A 2FUKA 3TEJA 3UUEA 1XZGA 1HKHA 5AKKA 5J3JA 5ALOA 2PU7A 4Q82A 4W63A 2CBGA 2LIPA 1IZ8A 4F60A 3A70A 4MQLA 1B6GA 3GZJA 5C8XA 4AMYA 2DCMA 2H9YA 5EFZA 1H2YA 1EX9A 1H23A 1Q83A 4H35A 5DJ5A 3KOOA 1YS1X 3QITA 3O4GA 5ALXA
chains in the Genus database with same CATH superfamily
4G9GA 3R77A 3U9LA 4UJ3A 2PMDA 3DDCA 2P65A 5D1HA 4AJ4A 4INZA 3T1VA 2ZREA 4UAUA 3JPWA 4HDNB 3B6JA 4WBNF 2I2CA 3G8YA 4X90A 2GZAA 5T4HA 4R8SA 4DUGD 1TTTA 2IELA 2X0RA 1MENA 4NL4H 4JSYA 5LVAA 4W5JA 4PM4A 4W6ZA 1A4RA 1XRLA 2PD6A 1FTNA 2I9PA 5HJ5A 4Q9IA 1GLVA 1M2FA 1NRIA 4FNOA 4N3GA 1FTGA 1SPXA 3FOCA 5HKKD 1P2BA 1ZGJA 1ONSA 3L0OA 4B7CA 3R7WB 4OF4A 1GUFA 4CI0B 4S1WA 3HH8A 3U3ZA 2OB1A 3O83A 1A95A 4ER3A 2RB4A 3RSZA 5LJLA 1O0CA 3IS3A 4Y3UA 4MRNA 2I2FA 4JY7A 4OPMA 4QXQA 2OORC 1OB5A 4LQCA 3AEXA 4X1KA 1SN7A 3QEOA 5ALTA 4YPOA 2XXBA 2RGAA 4QOFA 3ZNOA 5CBPB 4WVFA 3WAJA 1GGMA 2IOFK 3VVCA 4EKIA 2P6PA 1Q1QA 2QTRA 4DWWA 5KSWB 3ABIA 4IMPA 3TLZA 3REGA 1Z4IA 3ZOZA 3KWJA 5GY7A 4KQWA 2QBYA 5IYZF 2J3HA 1QKJA 3ZDRA 3DNMA 2O3QA 4PYRA 2WHPB 2VAXA 4LDJA 2GBLC 2ZPAA 2B4QA 2H08A 4EO7A 4NU0A 1HX7A 2JIPA 1Y1SA 2MSLA 5CVEA 1CUIA 3T7JA 4E5KA 4D4HA 3KLBA 3OZVA 1P1IA 3BMCA 1WBDA 4MR7B 4N0DA 4WCFA 2VDNB 3KUKA 5F35A 2W6PA 2A7QA 5EJMA 4MKHA 2XVYA 5AI6A 1R5NA 2C00A 2ONZA 3U0BA 3PKZA 2BGTA 2R7AA 4XVCA 2XDWA 2QN1A 2QQ0A 2ZWIA 1N9ZA 3RJ5A 1J7KA 2H2IA 2XMGA 1YGPA 4L8WB 2DSTA 3DEKA 4XWAA 3UOWA 2EC5A 4H4CA 4RDCA 2C2WA 2ZDQA 4BATA 2M2IA 3K0CC 1DQPA 3QKSB 2QN6A 4RHXA 5HGXA 3V8BA 3HXPA 2YYYA 5FX2A 3VNSA 2Y1EA 2BSXA 2D62A 4WI1A 4C08A 3H1TA 4E03A 2PVCA 2FR0A 1OH8A 1LTKA 2RH4A 1MB2A 4YO8A 4V24A 2ZB7A 1Y4UA 3FKSA 2EGHA 7MDHA 2A5YB 3GAMA 3ZWAA 4WXRA 4GXTA 2FJUA 1ORRA 1JPNA 1JKIA 1RQLA 2HU7A 4C30A 2JFYA 2X2OA 1O57A 3AM5A 1JIIA 2ZDGA 3VSDA 2VZEA 4TQAA 4UHKA 2JGDB 4QBTA 3T41A 4P5EA 1Y3IA 1U8XX 1WCYA 2VSQA 2X3YA 1C2TA 1C1DB 1ZRNA 2BISA 1U4SA 2Y66A 1NI4B 1KARA 3KO8A 1AZTA 3NYRA 4WRRA 1DV1A 1GR1A 4URYR 3O1IC 5IM4A 2WHYA 4MS1A 4Z3OA 3UW1A 4XM0A 1QRUA 1ID8A 2IXBA 2VK2A 4CODB 1RYBA 2LVBA 2XR1A 1HEIA 1I7LA 2C5GA 2CD9A 1JLLA 2OO5C 1RWKA 2OOSA 2B1QA 3KYCB 1K5PA 2B37A 4ND4A 3EIHA 2A88A 3UJAA 4G1MB 5JV5A 2X9QA 3DCYA 2C2BA 2IEIA 5K3FA 4AICA 2I55A 1GJRA 1WMAA 2G9RA 4CKEB 3UAOA 4G0NA 1GZ4A 2XB6A 2PZBA 2I5PO 4DBLC 1CJCA 1KQPA 1YZ3A 4EAAA 4JBHA 2QL7A 4NJOA 2QTCA 3G8DA 4N5MA 4O2AB 4TLBA 3HKEA 3SF0A 2X7XA 5JMPA 4EX7A 3OTOB 2X0IA 1KJIA 3L7LA 2VTBB 4U2GA 4XFDA 2GA8A 4NY1A 1DPGA 5FWYA 4JI8B 1FNSA 3K73O 1NQXA 1C0LA 3Q7PA 4ROSA 1DO0A 2HFKA 1SXGA 1Z6PA 2ZUBA 1NTOA 2QTZA 3GEMA 3VZBA 2DWPA 4LE0A 4B79A 4CFZA 3STWA 2P1RA 2IZ1A 1DQNA 2EBHX 3CV3A 4Y6SA 1T8WA 4YPVA 1SZPA 4ZV4A 2O2XA 2VQFB 1WDWB 1RQ7A 3BFKA 1CRQA 1HLGA 5C5EA 1JIKA 2HF9A 3F2VA 2FG7C 1HFKA 4QTXA 4I1SA 1KK1A 1FXUA 1PGJA 1NQWA 1SQ5A 1R0SA 2I6FA 2PZGA 2VF4X 4JUDX 4WOJA 1QVWA 4K6HA 5CNIA 5L3QB 1ZBQA 4RD6A 4D6PA 3MQ2A 1T9HA 3CEMA 2XKKA 1QHEA 5LR6A 1A5TA 1LLCA 3DPUA 3RLFA 4MO2A 2FVXA 3B7PA 5ITZB 1KTIA 4IXTA 1VC2A 1Q7CA 1DC4A 1L4FA 1NVGA 2D6FA 3N7UA 1V4BA 2WICA 3TL6A 3ITNA 4GOMD 2XWQA 3TZBA 1I3LA 3AVWA 5EZ6B 1IE3A 3MS7A 4LN1A 5DRYA 4P0PB 4LXYA 3ET5A 3QMVA 4RKFA 3HB5X 3DYVA 2FNAA 3DUFA 1XELA 3LBHA 2QRPA 4WV3A 1YO6A 3LFTA 3K0BA 3KLPX 2BZ1A 4IQFA 2H5LA 5CFZA 5JQGF 1LDGA 2O59A 3WLHA 1K27A 2P9TA 4MB6A 3B9QA 4I50B 4KFCA 4NZZA 2OCYC 5C4IA 4NZYA 2P2YA 2PX8A 4ZHQF 4RWEA 1I5OA 1R9MA 3Q85A 2JGEA 2HB6A 4IZOA 2VEDA 1L6IA 3CG4A 3R0QA 1KPGA 5CH3A 3L8MA 3HPRA 1B73A 1GRQA 821PA 2Y6VA 3DE5X 4IRMA 1VI5A 1PGOA 4L6AA 3GGPA 4MVJE 5BV2P 1HFEL 1X77A 3KX2A 5J58A 3P19A 5EJ8A 1M2VA 1LNSA 1NSTA 5I3ZA 3O6VA 1JAIA 3HV2A 1Z74A 2Q5JA 3OSZA 3QMWA 2RK3A 5LZ5A 2H00A 1FNCA 5BT8A 4P33A 4PO1A 3QG1A 2FWPA 1UL1X 2ZYAA 3BKWA 2HGZA 3FIJA 5A0FA 4F4JA 4HN2A 2X4LA 1UQTA 4PZEA 1GXSA 3V8VA 3PNBA 4YRSA 1WF3A 1JDUA 2DH5A 2Q3MA 2EGUA 2FDRA 2YJNA 3N8KA 4U7GA 4DAEA 3BE4A 1ZVJA 3AF1A 4FIDA 4ND6A 3ZZMA 4HDMB 2Q2VA 2EARA 3AEKA 4OJNA 4ZVLA 3L8CA 3ZH2A 5K8CA 4RIHA 4HXGA 1FVOA 2X4IA 3TXAA 1M7BA 5EJ2A 4CM7A 3TW8B 2IKQA 3AHFA 1FW8A 4BKMA 3PGA1 2ZJZA 3OA2A 4KV9A 5ALPA 4LI0A 1CZKA 1FXSA 2NUAA 1HZJA 2RG7A 2Z5LA 3FYUB 3HFRA 3QTLA 4JHLA 4MPDA 5FO1A 4H4DA 5H02A 3I3OA 1QHGA 4GMXA 1QYIA 2CE7A 2FB9A 2GS9A 4O1HA 1JKMA 4LWQA 1NWCA 2RFLA 3S70A 4MV9A 2PRYA 1KYQA 4N5LA 2COEA 2I65A 3ON5A 1M2WA 1PLLA 4ZYUA 1OROA 1OXBB 3NT4A 3WOHA 3TQQA 1NJ6A 2H1RA 4QNRA 4JQOA 4EY7A 4M46A 5BWLA 2PSHA 3OQ6A 1YFLA 2X13A 2JKVA 2PT5A 4L6IA 1XHFA 3GUVA 4HGRA 1ZHOA 1GITA 3WYCA 4Z4FA 4WZAE 1GEGA 2CHUA 2ZIXB 4OFBA 2I6GA 4NCNA 3RG8A 2XKJE 4QPNA 5ESXA 4B2PA 3NVDA 1ZD3A 3DFUA 3QEMB 3GNTA 5TT1A 4C6HA 4H1WA 4FYHA 1ZGCA 4BGDA 1QUFA 2WWYA 4CKBA 4UEOA 4ARCA 2ZRGA 1L5GB 2PGDA 1KBQA 1RI5A 3A4IA 2FRDC 4WESA 4A7PA 3IO3A 3NGLA 1G2OA 4AW9A 1E1DA 1KETA 2C99A 4Q1DA 4AZVA 5FV4A 1GZUA 2TMKA 1J1ZA 5H1YA 4IUDS 4NDNE 4WVLA 4JR1A 3BKXA 5KREA 1O9GA 1T1GA 4BZXA 1RKXA 1AQUA 3PUKA 1JNYA 1C3JA 4P5DA 1FDOA 3LK6A 4PNPA 2YVQA 4PS0A 3SS7X 2H63A 4HZUA 1X9GA 2ZCVA 1GDDA 1SULA 3QFSA 1YZFA 5ALEA 3RARA 2JVIA 2G8NA 2C4TA 3RSGA 3WLLA 3FMGA 2ZETA 3RANA 3GEBA 1EM8B 4TMWA 3EXFB 1AF7A 3F6YA 3MYRA 2DB3A 1C1XA 1OXSC 1ZITA 1RYNA 2QGZA 2O5VA 4LNUA 1UFQA 4PZDA 2C3MA 3EJ6A 4LMRA 2OGUA 1WVGA 1BW9A 1X14A 4OMFG 3PX7A 4HB3A 2QN2A 1ECJA 5KYWA 2HHAA 2CLSA 3D8BA 3M49A 3FJOA 3P5BA 4NAUA 3IODA 1NUSA 5BY2A 1UMDA 3EVBA 2G63A 4X8MA 2Q29A 5E1OA 1YH3A 4BO8A 3U1TA 1T8UA 3FTPA 1NURA 3ENZA 3EVEA 4TN5A 4PLFA 2J9FB 2QKYA 3FDFA 4RZ3A 4B6EA 3TRJA 3BXOA 4IDGA 4S24A 1P39A 1PN3A 4IDPA 2XQKA 3HGMA 1YZKA 3M6UA 2NO5A 2WZBA 3FUVA 2JFVA 3FBTA 3SIXA 3NHAA 3V8RA 1SKAA 3TQHA 1PK9A 2WMYA 4EHAA 2FSHA 3H5IA 3O9VA 4HLQB 1BS2A 1KYXA 4MROA 4QPPA 3OE5A 3TOSA 4ZJUA 4K9KA 3UWMA 1I3CA 2V7QA 4D9BA 1E4EB 4NYMQ 1TEZA 1KRHA 3A6HA 1X8LA 1FFEA 2P30A 3GHYA 3FROA 3IKJA 4J1NA 4NPHA 3HYNA 5E95A 1KJNA 2J3IA 1P4RA 2ZIFA 4HEJA 1AN9A 1MAVA 2Z95A 4NOLA 5EUBA 1IN5A 5I9SA 3Q9LA 3M1LA 2H9AA 1H2AS 4PYJA 3BFXA 2BEJA 5IJ0B 3OD5A 1SQSA 2M32A 4HP8A 2VP4A 2XNKA 3IOBA 3FD8A 3LX4A 1GRRA 2YIJA 5FDFA 3PI6A 2G0NA 5DX1A 1OTXA 4IVNA 4J07A 3KU1A 1GNSA 4P2GA 4Q7JB 3UHJA 1QHHB 3QLVA 1ETUA 2OCPA 4EITA 1L4LA 2NZXA 1UEJA 1FU4A 1QZUA 1UPCA 4C7JA 4ZI7A 2J5XA 1L1RA 1EDOA 2FDXA 2D1TA 3H97A 1X1SA 2I6XA 4HAVA 2NV6A 1GY8A 4I99A 4ZQFA 2V9CA 5CH8A 2C4NA 3L04A 4MTLA 3H0EA 4RS3A 1T15A 2EFCB 3ESRA 5HF9A 3ZUPA 2F6RA 4EJSB 2WKPA 3KZNA 1WD7A 5B1SA 4CG2A 4ND8A 1Y9DA 4FDMA 5EQTA 2R11A 4U7PB 4F4HA 1Z4JA 1V3VA 2OHXA 1EGAA 3I5XA 1GYQA 4JU8A 5K6AC 3OE7A 4EI9A 3KT0A 3QH4A 4MA5A 3DKRA 1ZG3A 3ONVA 4LY6A 3WXMA 1U7WA 1A5ZA 3OZEA 2FEPA 4I81A 1FNMA 1X80A 2AW3A 2O2CA 1CJUC 5LP1A 2RMKA 1N2GA 3MQFA 1JFRA 2IQ5A 4EVIA 4WNIA 1RRCA 3C3YA 4BLWA 1LPPA 3ICEA 1YRWA 2J0EA 2NSYA 5A1TA 1Z2CA 1FDIA 5BV0A 3LP8A 1KYIA 4IFTA 1XCOA 1E3MA 3IV6A 3G0OA 2GEDA 4NECA 1EPUA 3PF9A 2OP1A 4KGVA 1PD0A 5ICFA 4KRYA 1V48A 4RVNA 4WFKA 3I0ZA 4G5FA 1T9GS 3W3AA 1MNAA 4HJRA 4G24A 4IYRA 3H18A 4CF7A 3Q2IA 4OHYA 1L5QA 1G8YA 1U94A 1YS6A 2BFDB 4LWPA 4RV5A 4DKJA 1VP9A 4HDKB 4J0FA 3NKLA 5EEGA 5ECYA 5MN4A 3W8EA 4TX1A 1Z62A 4QVIA 1ESZA 1XZPA 3CMCO 1BU5A 2Z4RA 4EA7A 1Q0ZA 3BWCA 5AW7A 5H83A 5FT9A 2VN8A 5SICE 1A4XA 1JH9A 4QGBA 4KPFC 4S05A 3GR6A 2CJWB 3HS3A 3UMMA 4V0SA 5TVGA 1SQGA 1GAWA 2FN9A 3SEFA 1HG0A 3ELDA 3ILYA 2FZLA 2HQOA 1JPVA 1Q21A 1J7JA 2Q1XA 1OAAA 2VF5X 3I4CA 1XQVA 3O21A 4Q19A 4TRRA 3LHSA 3Q8LA 1Z13A 3THWB 4K40A 2H06A 1R5JA 1N7JA 4MCHA 3X2SA 4D3SA 4LJLA 4AJ1A 2KE5A 2BCJQ 3SMVA 4CQMD 2C61A 2V5UA 3LZDA 3QGMA 4OXKA 4Y2UA 2VYNA 3NHPA 1ORVA 3L01A 4HWRA 3FFXA 4X44A 1GPWB 3T1TA 2IT1A 4GMFA 3EGEA 4TKMA 2B20A 1UT8A 3WB9A 4M9SA 5F4BA 5ALLA 1UINA 3LHFA 5FO0A 3VAAA 3VOAA 3HY3A 2FZ5A 4G41A 2BGNA 2FK8A 1OYVA 1S8NA 2CVPA 4IQ0A 4YCBA 4MYCA 3MS2A 5FRDA 1IBCA 1Q1GA 1AM4D 2ZP1A 3IJRA 5KWEA 1A1VA 2DJ5A 1R8QA 2MJLA 2XMPA 1SIBE 4WNYA 5H81A 1E9BA 1I1HA 3DHNA 2ET6A 4NCKA 3L1JA 3IV9A 1DBWA 1GDHA 7YASA 2CF6A 2ZIUB 3P0HA 3ONWA 4CEIB 5IBQA 5GZ3A 2G06A 4PSAA 1JB9A 1KQ3A 4OUDB 1Z7EA 1K8YB 3GEHA 3HNOA 4YAIA 1E61A 4ZKDA 2V1UA 3PJRA 2ZRBA 3CX4A 1E4YA 3SC2A 3QVLA 4BASA 1GTRA 3TPCA 4GM1A 1LSJA 5BWOA 2VF8A 1N34B 3ZHTA 1JXOA 1PJ4A 1S7GA 2E7ZA 3DWIA 4KWCA 4JI6B 4JV5B 3IUNA 4O0MA 4M87A 1OWLA 1WUKS 2O0KA 3EVAA 1G9SA 3BQ9A 4FQ7A 4PR3A 1YK1A 1ZCFA 4Q15A 2JIZD 1ATIA 3T5GA 4Z54A 4YC7A 1P1CA 3L0ZA 5ELLA 2QEQA 3S1LA 3ZLTA 3QUSA 1Z45A 2ZRIA 3WKAA 1G5TA 2GXSA 4HDSA 3NOXA 3CX3A 4OA8A 4E22A 2QJRA 1VHWA 4RPGA 5BUCA 2H3HA 2HSEA 3A1NA 3EGDB 3EMVA 4UHFA 3AFGA 1BMQA 5AVYA 3PXGA 4X8HA 2BLLA 2WAMA 1LJLA 1TT5A 2HHLA 3Q2OA 4YRJA 3K2EA 1CJKC 1S8OA 2ORVA 3A1VA 3I6YA 4DBZA 3U16A 1WBBA 1MRZA 4ND7A 1NJ5A 4HV4A 1OPXA 3UCEA 4Z86A 2FX2A 4M9UA 3BH7A 4R71A 1ZD2P 1N8KA 2JLUA 1EWVA 1F2VA 1YB5A 4X1YB 2NLOA 1I33A 5DB4A 4KRFA 1IEWA 2G82A 4JK3A 1WTCA 1REQB 4PBSA 5REQA 2CLHB 2G9QA 3TVYA 2ECFA 2ONCA 3E7XA 1YBMA 1QGED 2RGDA 3EFEA 5JASA 1R9NA 4DVGA 3LMKA 3BRWD 4KAJA 2VJMB 2PUAA 3E2IA 2WYHA 2ORYA 3K0AB 2J59A 1L5SA 2PJDA 2X15A 4FOOA 5DBFA 1NVXQ 4QASA 3V97A 1V0JA 1Y1RA 1KSHA 4R2JA 2QN3A 5LLDA 4A82A 4IL5A 2JFGA 1I94B 3ROGA 4CNBA 5FADA 2GNPA 2C4KA 3MGKA 1WV1A 3DBLB 5ITZA 3TNDA 3JPYA 3LCUA 4D8VA 1USUA 1NHGA 3LHIA 4ZYWA 2PPVA 1TECE 1W36B 2WJ6A 5IUKC 4IH9A 3WSVA 2AOWA 2B4RO 3OETA 4BP1A 4QYIA 4P36A 4C05A 2DPGA 3EVFA 5FFMA 1GQOA 2ZRFA 4QJ3A 4XRGA 1JBQA 4F04A 2RHOA 1GNVA 4HGQA 3WP0A 3WX0A 5LJIA 5KVSA 4B9AA 4QX6A 5IJZA 3ISVA 4UQOA 1YS7A 1WB6A 5AVUA 5JSFA 2BMAA 3SQOA 1M5RA 3OIGA 2WT4A 5LQNA 3N3BC 1MORA 1DHTA 3EOZA 4Q7KA 3RHTA 3M9XA 4N1AA 4N7RA 4PAMA 3RM3A 1ZWKA 1E64A 3UXMA 1UXKA 1D6JA 5DISB 1XP8A 3OZCA 3WL4A 2QTGA 4DWOA 5EIXA 1CZHA 3KHKA 5A4IS 1UFRA 1SD2A 4IIJB 3AKZA 3D6MA 2OLJA 4KQ6A 1YU6A 4XQEA 2BKLA 2B0CA 3O8QA 5BUZA 3GUZA 1CB0A 1TA4A 2ZBQA 3DT8A 1LLUA 2R6CA 3VYSB 5G2OA 4YK7A 4Q9DA 1TQ2A 1EBUA 4ARVA 2CUTA 5JYCA 4MWOA 3UM9A 1SU8A 3W2FA 2JA1A 4ML3A 3GXOA 3QENA 4RK6A 4BHTA 1ULBA 4KREA 1UOEA 1DIHA 2AXNA 4KXUA 4JYPA 5JATA 5K0BA 1AXEA 3R44A 3TYXA 4OX9Y 3W0LB 5BYKA 4BYMA 3OIDA 2A0WA 2F43B 5CGQB 2IZ0A 2QTTA 4LZWA 3S40A 3GMDA 1TAHA 1KJ8A 4P4UA 4YCDA 1NL3A 3ND7A 5TMDA 1USVA 5DN6D 1AX9A 3HXMA 1DHRA 1CR0A 1COWD 2E4XA 2DERA 4MMZB 5DBOA 2WP0A 4YRPA 4IX1A 1Z29A 4ODIA 4B0PA 4F6RA 3C97A 3HYCA 3LRPA 4NBKA 4KMRA 3NHBA 1AZLA 1L3IA 1R6UA 1W6RA 3FYUA 5P8WA 4P32A 3C24A 3MRTA 4EDFA 4TPKA 1P1FA 1NRWA 2AOUB 1E9FA 1RYEA 1WABA 4LG1A 2XMZA 1Z8FA 3SHVA 3V55A 4C7VA 1JEJA 4WKBA 4JP5A 3KJGA 2IVFA 2XB8A 3S5UA 2YQZA 1KFCB 3WHIA 4NBTA 4F7DA 2GCIA 1NVTA 1QAQA 1Z4MA 4O2LA 2BMDA 4QRDA 3NIWA 3AM4A 3V4PB 3VR6D 3QE4A 3AB3A 3N1UA 5HTKA 4WN9B 3ULKA 5KYTA 4KK4A 5CB4F 4ZRMA 5C3UA 4CW7A 1L5NA 3FRIA 1SEPA 3I53A 1RHUA 4DNXA 3CG0A 4YP0A 3W6UA 1U1IA 1YASA 1WQ1R 2P62A 3E8XA 4QTTB 1JHQA 3R3XA 3HCFA 5JJIA 1YJ5A 2VDKB 4JLSA 4RXUA 1W2HA 2OCDA 1EA7A 3NT2A 3T3HA 4QKQA 4QYMA 4LGYA 5AHWA 4C9BA 2HT6A 1SXJA 3GGSA 5AI4A 3L40A 3LBIA 3S5JA 3BG5A 1VOTA 3W2IA 4FBLA 1V96A 4V03A 1Q17A 3UMCA 3E7PA 4A2WA 3LY8A 3H6KA 3DR5A 3FVVA 2KBFA 3FYHA 4NOJA 4HI0E 1EAMA 1UXHA 2HXYA 1W35A 2O06A 3M70A 4WCFC 4DFDA 4CL0A 1V6SA 1W1UA 3CY6A 3NNDA 4PO9A 1TU0A 3ABZA 2C0CA 3KB1A 4GZ5A 4C2AA 4Z0TA 3B2EA 4KKXB 3NH9A 5EXDA 3MBOA 4ZXPA 5B3LA 3HGQA 1NVUQ 3IQGX 1OCEA 4KXYA 2QX8A 4BU1A 1Z34A 1E94E 1UF9A 2GYVA 4C6SA 3R75A 2FGKA 2C9ZA 4LKOA 4OM7A 1XAIA 2CUNA 1D6SA 3AUAA 1K6IA 4N3CA 1DBPA 2W48A 4R2IA 5DLDA 3O8NA 4B75A 4B34A 2CHFA 2Q3BA 4XYMA 4DQXA 1F0YA 5BXYA 4MQ6A 2Y68A 3AYXB 3TB6A 3HR7A 1XQ9A 3IKVA 5KYWB 2ZXUA 5LXTF 1XR3A 3KQQA 3OOYA 4X6UA 4NVRA 5H9VA 5M34A 1CEYA 2ZAGA 3Q7SA 3C6BA 1G63A 3PNYA 5CG1A 1KZ6A 1C50A 4JP1A 4YS6A 2X8JB 1XNHA 4BIMA 2EBWA 3BRSA 5A04A 5AW6A 4AY6A 3L93A 1N3IA 3KB6A 1R15A 2H1FA 4HAIA 3NKVA 1ISHA 1MB3A 1SXJC 4M21A 3O75A 4NZPA 3LIIA 3LA6A 3FZGA 1V5WA 1S2GA 2D2XA 3OPNA 2G88A 3PC6A 4ALIA 3LUKA 2QL5A 1CCWA 2UUOA 4HGPA 2OFOA 5NLLA 1YE8A 2P4HX 2N0SA 3FLAA 4KUEA 1W73A 2BD0A 2CVOA 1PJ8A 3AZPA 4US2R 3W1VA 1Y42X 2BM9A 5A4JA 4GUDA 5AVWA 1TJPB 1WKBA 1NNLA 1U5BA 4QJ4A 4BXOA 1RJEA 4TMVA 1Z35A 3ZE6A 1DNPA 1F6DA 3E53A 4FONA 2XKBA 3Q3HA 3MMNA 4ZVOA 3BWVA 3CF6R 3HDTA 5EMLA 4D99A 4M1TA 2C29D 1T2NA 2YH2A 4QBGB 4YT4A 3QA9A 1C8KA 3D7MA 5LFAA 1NZDA 1A7KA 3L05A 1PIWA 1NE7A 2ZM6B 4R7GA 1LDMA 4NCXA 1IHPA 3T7RA 2F90A 4EHFA 1HBJA 3DKIA 3UMFA 1X15A 2JASA 4L8FA 5AI8A 5HBRA 4RORA 2RJ3A 3MWKA 3GLTA 4EMUA 1BJKA 2X4DA 4N47A 4EHBA 3BXGA 1QGDA 3FCXA 2NU9B 3FTEA 3DV0B 4G9BA 5HKOA 3HYSA 3WV5A 3D4IA 4HXEB 1GL7A 4C0LA 3IHWA 3UJ9A 1R4MB 1RI4A 3N2KB 4YACA 1ZMBA 4R3WA 2WV7A 4D74A 3HVRA 4M0KA 5ALSA 1CS4C 2Q50A 3SC6A 1FYWA 3CWQA 3F4BA 2GM4A 1IB6A 1KMCA 1PVDA 2Q3EA 3D8UA 1I6WA 1Y9EA 4LDZA 4XDZA 3S2IA 3G0CA 4EKDA 4E5UA 1HM5A 1S8AA 2QD3A 1RI2A 2BH9A 4TVKA 1HL7A 3D3JA 3EQ6A 3G23A 1LV8A 1DIGA 3T3PB 2I71A 2PKQO 3JQBC 2HYIC 1YVPA 1J24A 5LP6F 4TL7A 5IARA 5CEFA 4HDMA 3WY9A 5TVKA 5JAHA 3BBPA 3BUSA 3MAJA 5KVAA 1N2CB 4DV5B 4PAOA 4X20B 1PQ4A 3JAKA 4G25A 4NC9A 1K89A 2WJPA 4QUHA 5TE9A 3RVRA 4B82A 4Y6QA 4PYLA 4N3BA 1NP6A 2X0NA 1RAGA 1SXJE 5L7WA 5GGYA 3A2KA 4IOMA 4X97A 3FUCA 4P2BA 4GX2A 4ND2A 1NYTA 4B33A 1XEWX 1YC5A 2ERCA 1RLMA 1G4HA 2F4NA 3W79A 4BE9A 2AQHA 4LTNA 2EX0A 2ORWA 1SCQA 3NYIA 1D9ZA 1TJ4A 4A91A 2IUTA 3K0EA 1ABBA 2JAQA 1PG0A 2O7NA 1Q15A 4NE9A 2J8ZA 3DEHA 4HYYA 1OUMA 4OU5A 4ADSG 4KDEA 4DUZB 1QV6A 2Q7DA 4DMRA 5ALVA 1O0BA 5LB2A 2Q3CA 1AMNA 3UFXA 2N1BA 4E1AA 5E6RB 1E1LA 5JAOA 1TM7E 3T8YA 5CXUA 5AVTA 1ZH0A 3AIIA 3CS3A 3N59A 4TS4A 5JOQA 1LTQA 3KOYA 4ZREA 4KVZA 4D0GA 3K6SB 4C14A 4ZZ3A 3EC1A 3PFHA 4TV9F 1KZGB 2J9XB 3A3NA 3H1PA 1H22A 2FF5A 3CLSC 4QODA 1H4QA 5B2ZA 4Y6GB 3U37A 3VPHA 3ABRB 3KOWA 4UHEA 1GT6A 3FGZA 1PZGA 3GBVA 5AVQA 5K0GA 2I6QA 4FFRA 5LMUB 4JENA 4BMOB 1JEOA 1I4EB 3DFZA 2C07A 2REBA 1HMYA 3C7DB 2Z6AA 1YQ9A 2E9SA 1B6TA 4Y18A 1FVXA 2A58A 2HA4A 5BYJA 4FI3F 1X8JA 2PWAA 4KSYA 4IEIA 1JKJA 2FKNA 3AKYA 3A1WA 4K8OA 4P4SB 4I8DA 3S6JA 1E4VA 2AJ8A 5LDHA 2ODBA 3FYTA 3LH5A 4EA6A 4XYLA 5K0ZA 3E9RA 2C88A 5ALUA 2R96A 4J43A 3W4KA 4NMWA 4ENTA 5AK5A 3OG9A 4C01A 3BK1A 1HSZA 1RHMA 1SD5A 4OGWA 4R8RA 4W5QA 1DC3A 5A7FA 2HIMA 4LE2A 1NHWA 2I8AA 3RJ9A 5BV7A 1OYWA 2Y92A 1II9A 2XOKD 5B5SA 1M2OB 3FWPA 3KE9A 1AK2A 1DXQA 2BJVA 1OF1A 4L15A 4BKQA 2Y8EA 1IXSB 1VIDA 5TQ0B 2DBVO 1A97A 3Q9UA 2GVNA 2RHBA 2BN4A 3EJWA 3JYNA 1JEQB 2C0QA 2DPYA 3HSSA 4S3MA 3SFZA 4CRWB 2WMOB 4GHWA 4Q18A 4AYWA 3O4RA 3P9ZA 3TTVA 3JQAA 3P20A 4G07A 1ZZEA 3QFCA 3OLVA 3ZTYA 1LNQA 5FH9A 3TR6A 4CKCB 1S02A 1SZJG 2Z4TA 3GCXA 4DLPA 1R37A 1Q7EA 4MW4A 3WGQA 2PPLA 5B3AA 1T3HA 2VJOA 4M8NE 1ECGA 2ALJA 4K46A 1ADJA 1QYWA 1U3VA 2PQ2A 2CGEA 2BMVA 4LRWA 5AW1A 1O03A 2F62A 1XZFA 1G4UR 3KT3A 2J6BA 3FSGA 2Q1SA 5H3LA 2EWWA 1SBIA 3JVDA 1E6UA 2F3PA 3AWDA 1ITZA 1E5VA 1LS6A 4JI7B 5BW5A 1LFDB 3J7TA 3IP7A 2ZATA 2BLNA 3WIVA 1PKXA 2OV2A 3THOA 4ZVVA 1W9MA 2DU8A 1V3TA 4K5QA 3R9XA 1FOEB 1K6XA 3WL5A 1XV5A 3MIZA 1I3KA 2QM3A 2ST1A 1T9DA 1VIVA 1U8UA 2QM7A 2REXB 4O3FA 2ZWOA 2VRCA 5EZYB 5U4XA 2DWQA 4LZPA 3C2QA 4YMVA 3H05A 4D8UA 1XNQB 3D9QX 2R7NA 1CHNA 3TD6A 3CRW1 5JMWA 2FW0A 3FPAA 2FSVA 2WZCA 1NTRA 1OZAA 2LCIA 2C98A 3F3YA 3K53A 3N9IA 1QHSA 4UQPA 4BNDB 5FJJA 4CYMA 4XWOA 5LNK6 2NTYC 2WUEA 2JD2A 4G36A 5JXGA 5BSRA 1PG2A 1CB7A 4ER7A 5CH5A 3U7GA 1RHRA 5CW1A 2QF7A 3MHPA 4AKEA 3CLVA 4KN6A 4BQIA 1KJYA 3U5ZB 1HT3A 4QOGA 2QUJA 4QDUA 2VWQA 3KR0A 2PV0A 4X92A 4Y6RA 4PG8A 3ICVA 1CUFA 4BUZA 2QJFA 5E2IA 1JN0A 5EL0A 3PDIA 3P0EA 3BHNA 2YZ2A 5AVRA 1ZR2A 1FFHA 3KXPA 4YRDA 1AB6A 3VPGA 1EXDA 1E8NA 2ZT7A 2NT3A 3NPMA 3NALA 1YJ8A 4Q4HB 1W94A 5DCUA 3WZLA 1CQIB 5AW2A 2HD4A 3ITKA 1ACLA 5EP4A 1PT8A 3FJ1A 3L1UA 3FPSA 4XEHA 1E1YA 2CMFA 4AP6A 3LW7A 3LTEA 1Y1TA 4O4IB 2OBFA 1PR4A 4EFLA 1N9KA 2AHOA 4FILA 5FBQB 1YR8A 4ZT7A 3MCZA 4U2KA 4WY8A 5FUBA 5L6MB 1A8SA 4JCCA 1AHIA 4Q16A 3LM8A 1ZVQA 2N75A 2XCQA 3EDCA 2GYUA 2HJHA 3E9CA 1UP7A 3E05A 1K4MA 2BM1A 3D3QA 1ZJ6A 2XTJA 5D5HA 4F71A 3E1SA 2BOVA 4HEQA 4IYJA 3O74A 4AC9A 4DS3A 4UTRA 3F3KA 1FSGA 2JLBA 3H1GA 4MRVA 1U3CA 4RSMA 5FB3A 3VBEA 4BVGA 3J81k 1MDFA 1X1TA 1Q57A 2BFDA 4YRFA 2DBZA 3ED5A 3QHPA 2ENWA 2YWRA 3RVBA 4MVJD 4MR9A 4QFBA 2FCAA 1ZP6A 2ZTSA 1EA5A 1UBHS 2ZB2A 1EG7A 1Z2DA 1PF7E 2GR9A 3I9NA 4B3JA 4EF5A 4ZCIA 1E0KA 2V7QD 1GA1A 4P80A 5EJ9A 1JV2B 3UQZA 2QI9F 1HETA 3B3QA 5GPBA 1NDUA 1RP7A 2GK3A 3DUWA 2ILVA 3HDGA 4GXNA 4H15A 3VZSA 1RJGA 1SA0B 1O89A 5CEEA 1U3WA 1TXGA 4R98A 1LDNA 2UYOA 5C18A 4WQMA 1QH8A 1K9VF 3E23A 4FEYA 2IHYA 4ATNA 1VB5A 4HX9A 3FJYA 2IOFA 4CPDA 4F4DA 1UK7A 1NUUA 1L2TA 1Y3BE 3K1JA 3KSMA 1JHYA 1YSCA 1VE3A 2RONA 3DLBA 4A8PA 1I4WA 1YZUA 2AUNA 4K9QA 1GGFA 5C53B 3NEPX 3DVQX 3TD9A 1XHEA 3AV0B 1FDVA 4ECEA 3JWEA 3QZUA 5HM8A 2ZYUX 4PLVA 1QH9A 3QVWA 2RHGB 1M1XB 2GHTA 3TW0A 1ZSYA 3DOUA 3G5UA 4FEEA 4PQEA 3B60A 4E30A 1DTSA 4BMSA 3PXCX 1ZM7A 3HTXA 3KUUA 1WR8A 3KZCA 3RJZA 2OL4A 1K86A 1FRZA 3A6GA 1W88A 3EEQA 3LZ6A 5BSFA 1AV6A 3L1KA 3NI2A 3WNBA 3CRRA 1DMSA 3KJQA 3I01M 3G7UA 3RROA 4F2PA 4FP9A 2SBTA 1SBNE 2C8VA 3FNRA 1NQTA 3FNFA 4GR9A 4A0HA 4DWVA 4RVFA 4BQRA 1M1YB 4PZZA 2CCJA 1PR9A 5AVZA 5HR5A 4LV6A 2FMKA 4MRMA 4DBVO 2HRDA 2G36A 2OSVA 2VUSA 2VNHA 3HRHA 3O8LA 3R4VA 1EE9A 2Q5QA 3CF4G 5BSUA 4OLAA 2O3RA 3DVSX 3I9LA 4DB4A 4C0XA 3VZDA 1H8ED 4EATA 1CP2A 1N5RA 4WK6A 2A5JA 5KYYA 1JHRA 3KR2A 3WICA 1P2FA 1Z5ZA 3EZ2A 4NEGA 4EEXA 5CB0A 1LB1B 3Q3VA 2FPGB 1BSVA 2CNWA 5DIFA 3MWDA 1QGYA 4G0ZA 1Q3KA 4U0KA 2FG5A 3OJLA 5C3MA 4NX2A 2PX0A 4MLCA 2HMWA 5EE5B 4Q7QA 1JWAB 1LLQA 3RAGA 3HCAA 3P45A 3C1UA 5LMCA 4JN6B 1QP4A 1YACA 2AFIA 4I5FA 4KIFA 4NDZA 3ZHCA 3W8NA 4DLBA 1H6BA 3GBPA 2B4YA 1MC8A 4JEMA 4B8ZA 1OY1A 1RBMA 2PYZA 4G4GA 4KO1S 4X7PA 3OT4A 4MS4B 5AW8A 4MTCA 4E1VA 5DHRA 1JZQA 5ISMA 1R64A 1M0WA 4RMIA 5G0TA 3HSYA 1XLVA 4HN4B 2BR5A 5DBHX 2QE7A 3WLPA 1QS0B 2Z4SA 1TUBB 4IZHA 4QOIA 3QLEA 2GSWA 4D82A 1YOVA 4M0UA 1K06A 2B34A 4D9HA 1S89A 4URVR 2G07A 5KYXB 3GNSA 1U6IA 2JLYA 1Y4DE 3DLTA 4HH4A 3ZVKA 1BU8A 3LDFA 4Y6PA 3HVUA 2B1GA 4KO4S 4LYAA 4OKIA 3UATA 1W8DA 5AW3A 3GNLA 3DDWA 3ETNA 1LI4A 2J33A 5HFNA 2LUOA 3H99A 4L4SA 4C4XA 2O20A 4F12A 1NKSA 2E5WA 2DY1A 1JPJA 2VZ0A 3NEYA 3U9TA 4CLHA 1CRLA 4HPWA 3UK6A 2IU0A 5TGZA 1CQIA 1SM4A 2AN5A 3M83A 3OHPA 1CY6A 2BEUA 3FR8A 4FR0A 4LOIA 5EP1A 4ZEVA 2G1KA 1NXXA 1A69A 1JHXA 1WEHA 2XUIA 4OQYA 2YHIA 4N0MA 5CA1F 4UBIA 2JK0A 2Q21A 2B3DA 3PQFA 2L19A 4JKYA 3VR6H 1T34A 3AL3A 2ZSJA 3CHYA 1SUDA 2R6DA 3QP9A 4EVQA 4LDNA 2B61A 2JAUA 1J25A 5AOCA 3AUUA 3Q8WA 1IBRA 1P5RA 2JH8A 2D5IA 4FKMA 4G1BA 3UC5A 4DQVA 5LBUA 4B6JA 1OW3B 1G8MA 1PFQA 4JVLA 3FNBA 1SXJD 4N18A 1DINA 1ZOIA 1W0KA 4FHFA 3SE7A 2W2MA 3CRZA 4S12A 5FNVB 3O8QB 5BUSA 2FWBA 1JR3A 3U7FB 1GQQA 1U8TA 1OILA 2HNBA 3AF2A 3ZY3A 4C4SA 2OR3A 3L0DA 3U44A 3QPUA 1PZNA 3OT1A 3Q9SA 4GPD1 1E98A 3K05A 3K20A 1OBFO 3TEFA 2D5CA 2QT9A 5FA8A 1S4QA 3EH2A 3C16C 2A1UA 4M7OA 3WL8A 2PUCA 3VO9A 1G5HA 3P32A 3E3NA 3PLNA 4QOHA 4EZIA 1TDJA 1EXNA 2WJGA 1KS2A 3PP8A 3RNLA 2O6LA 4PF1A 5AXDA 4HLUA 1NBOA 4MW7A 4DRXA 4JEUA 3Q3CA 1O94D 2CXHA 3P71T 3GA0A 1QLHA 4QOSA 5K3CA 4B3GA 1XF9A 3BCSA 3GJ4A 4UBNA 1I4LD 1TIKA 2Q07A 3AY0A 3IDOA 3VHLB 3WDKA 4BKOA 4RXTA 1QIEA 1BMDA 4M0PA 4DA9A 4MYTA 1Y5IA 5T6MA 4BFVA 4RZQA 4ACBA 3IVGA 4J03A 4RFVA 3WWZA 1D6NA 1SOVA 5BN3A 1IUPA 4PSVA 3WVNA 1TYAE 2Q4OA 2EOAA 1VCMA 3BVPA 4LX8A 1L7EA 4LRUA 2JVJA 1NYRA 3NRJA 1RXWA 1JAXA 1KY3A 1JSLA 1ZOSA 4RACA 2IF0A 5FF9A 3BRWA 3QPWA 1PK7A 3INGA 1T3LA 2O7QA 4Y9TA 1T5IA 1C7RA 3OM9A 4DR6B 1IN8A 1N7HA 4IH1A 2OD9A 5ER9A 5K3EA 1G66A 1ZOOA 3EZFA 5B3KA 1JECA 2YZ7A 4HPJB 1KI2A 1E4OA 3KHTA 4JMLA 3PIIA 3WSTA 4HZIA 4ZZ0A 1N32B 2GKOA 4C2TA 4R3NA 1LXCA 5I8ZA 4WKNA 1KK3A 4BRWA 1FYDA 2PD4A 4YEDA 2I9KA 5TRTA 3HE3A 1E5LA 2R00C 4FHCA 1PBTA 3NAMA 3M1IA 2QGFA 1E6EA 5CB6A 1OU0A 1WW3A 2QLLA 4J2OA 3I9FA 3EFOA 3VO1A 4FYMA 1VFPA 1V8ZA 4JBGA 4J3JA 4LXGA 3X0DA 1A72A 2ZYSA 3VGJA 4M88A 1F2TA 1G9XA 3WJ7A 5DPMA 4GIBA 3T5PA 4HB2A 1TK3A 3UUWA 3KQNA 4MWTA 3RS4A 4BMNA 3K8ZA 3MB8A 3ABQB 1XJ5A 5JFGA 3ZHVA 5CLFA 2DPMA 1Z4OA 2PLNA 1UT5A 1ISMA 3WGGA 1TJNA 4GO1A 3WK4A 4ZVPA 4UNPA 2VZ8A 1TYCA 2H65A 1CEEA 4LMBA 2WLSA 3H65A 2EF1A 1GU7A 1KZ4A 1RE0A 3M5PA 1TJ5A 4LJ7A 4OHBA 2B1IA 1ANKA 5ESWA 1L5LA 3SR4A 3NGXA 1JJBA 3JXEA 1BN7A 1JHUA 4LQDA 4UZEA 1CDEA 1RZUA 1VJTA 2I4RA 2NZ2A 5CUQA 3SGLA 4DEYA 2XTNA 4OCZA 1GXSB 2L2QA 2WD7B 4ED9A 5L3SB 1MEOA 3ZY6A 2QRUA 4R1QA 1E2GA 3ESAA 1AKEA 4FJ2A 4II2A 1P1HA 3PDWA 1JG1A 2Z2KA 1HLFA 1QYCA 5A2GA 4YMGA 3U56A 5KQLA 4PZ9A 2ATVA 5K7SA 1LBHA 1XYVA 5DLPA 1VSTA 2H11A 1FLNA 1USIA 5TARA 4K6KA 4RY8A 4EUHA 3MA0A 1QG6A 2GGSA 4D25A 3GT7A 1EGHA 3NJ8A 2V7VA 4JXJA 4AJ2A 1CZOA 3JQFC 1P5HA 3ROTA 4MWGA 1YL6A 2C3PA 1VLHA 2NW6A 2FMTA 1XJ0A 3FDZA 3GARA 3DOIA 3OLQA 2G9VA 1UJBA 3AHJA 5CX4A 2DKNA 5HFAA 3U4HA 1F38A 2VTDA 3D4BA 5KYKA 2BBTA 1X86B 3H9JA 1A50B 1DKUA 3RFCA 1YCFA 1ULUA 2RSLA 4DDHA 1GR0A 2CDRA 4OK3A 3LPCA 1NNI1 3WK8A 1WDTA 3PHHA 3ER9A 3GVCA 4C2BA 4PO8A 2OLEA 3IXLA 2JW5A 4IW3B 4PX9A 3T5DA 3H87A 1B93A 3VVLA 4AX4A 4CCAA 1N1DA 1B0ZA 1QGUB 4IGIA 3HL0A 5IT4A 5B1IA 3CINA 1HC7A 3SLGA 5A4MS 3ZDDA 4GP7A 4KN5A 1KWKA 4BXOB 4EMBA 1YKGA 3A1DA 2IHKA 3L77A 3EARA 2A9JA 3U7EB 4MGYR 3EA5A 4AD8A 1UBOS 4E15A 1G8KA 1T2UA 3PNSA 3I1YA 4CV0A 3LT2A 3PFBA 3W8DA 2BDTA 3AFIA 3PFCA 3T38A 3K8QA 4MIEA 3HJUA 2W6ID 3KYIB 1D0IA 3QE9Y 1I6MA 1KO7A 2I1VB 2I67A 3RV3A 1UXOA 2ECQA 4MQ5A 1Z0JA 4Y0NA 2ZYVX 5IVIA 4BLSA 3K9QO 1KY5A 1URPA 3IAS6 1T6BY 1HE8B 2YY7A 1YJBA 5I48A 1CUHA 2ZE8A 2I80A 3DZBA 3G02A 2WG2A 4LOAA 3V5NA 1ZN2A 1QYRA 4MW5A 3PUIA 4BN0A 2VP2A 3IDAA 2BUCA 3GFOA 2HW8A 2Q62A 3TBKA 3RFUA 1VDMA 2D7CA 3LLCA 4EHJA 1CUYA 5JNTA 3HBAA 4UBMA 3PC2A 5C1BA 3HYTA 5AQ1A 3E5MA 1FDWA 4RA9A 2P9CA 1IQ0A 4UTZA 1U0RA 3UTCA 1GVNB 1L3BA 2VXBA 1SHLA 3KJFA 5TC4A 4Y8VA 1HOTA 1NM5C 3ELUA 4F5ZA 4AKIA 4H1UA 3CWCA 4K2HA 5AM0A 3LOPA 1B6SA 5HILA 1NI5A 1Z07A 2O0JA 2H0RA 2TECE 1V16B 3OJ0A 1JIXA 1MJ5A 1JA0A 1TYBE 3MOSA 2ZRDA 2V7EA 4NE7A 3GRRA 3F8SA 2Y1WA 3HCWA 4GBMA 4Y98A 4YJ2F 1U1CA 2JDIA 3BQMB 4AUMA 2I1WA 4KFUA 3DZ8A 2G8LA 2Z0MA 4KQFA 1DV2A 3JWGA 1ENYA 2XZDA 4X7BA 2CFSA 3KEFA 3L0CA 3L02A 2IP2A 1VHQA 4BFTA 3B13B 4BLVA 4MHTA 3TQSA 2BEVA 1FYXA 2AEMA 3T61A 4RUKA 1YR1A 4MKGA 3BIWA 3BEDA 2FHSA 4OXRA 4HTAA 4DDTA 4ZCPA 4YT8A 1M74A 3AF3A 4X94A 1ZAYA 1J06A 3IDFA 2XYQA 2SNIE 3RWMB 5IAKA 3IULA 1QTRA 4E2FA 1RR6A 1EWQA 3ZQUA 4WT7A 2C4HA 5F3RA 3ZGXA 2IY9A 9ABPA 521PA 3NC0C 1AF4A 1I3OA 1NW4A 5IJ0A 1I1OA 1W30A 3ZJUA 5CYPA 4AF7A 4DCNA 4E14A 4TMZA 3T3IA 3ENNA 3IGFA 3O9MA 1HRDA 2XAAA 1GFWA 3LQ4A 4FHEA 3C14C 1LA2A 1CULC 4BX2A 2UXCB 3PTZA 5UKDA 4BQOA 2PKQP 2HEGA 2WKQA 4ZVRA 1GKYA 4F6LA 4A5OA 4R9VA 1N5OX 3QTTA 1ACJA 1EFVB 1CR4A 3O91A 5DFAA 2I6TA 3KXDA 3TRHA 3E2PA 1MX5A 1N75A 1E7MA 1QNLA 2BKUA 3M4XA 3SHTA 2QX7A 3WMEA 2PL9A 4HNSA 3QK7A 1KEEB 1R74A 3FLMA 1CQJA 3ZU2A 1UQUA 3WJ2A 3PJFA 3QLUC 4JI3B 4AY5A 1HQCA 4TYYA 3GP3A 1UMKA 3AF0A 1ZK0A 3G5MA 3GGCA 3QPBA 5KJEA 1C4WA 1NE2A 5C52B 1HTBA 4MQBA 1CUUA 1X70A 1D1TA 2BY4A 2AR7A 1SXIA 3CKYA 1FCJA 5M3BA 3MJFA 4GLJA 4UQLA 1EINA 2BHLA 1KGDA 3BSSA 3EG9B 4MI3A 4WASA 1YNSA 1EVJA 3NTLA 2HBQA 4GRIA 2BONA 4YJ3F 1RYFA 4JB2A 4OH7A 4NENA 1Z6AA 2O1EA 2GVZC 2H4HA 2NACA 3PDHA 4OQDA 1C81A 2W2LD 4YWJA 3JALA 1ABFA 3WRXC 1OV6A 4G4SP 5LNK1 1RJ9B 2YCBA 1CYDA 2NZ8A 4DQ0A 5H3HA 1B15A 3KSZO 3BIXA 2VNIA 4KRXA 5E6SB 1BA3A 2WF6A 2Y05A 3BK2A 3FSEA 3L46A 4V0KA 5CA0A 1NXTA 5DHTA 3SVZA 4AP9A 4B4UA 2B36A 1UMBB 2SHKA 2GZRA 3V34A 1RMQA 2C4UA 2D1QA 3DDOA 3L1HA 3AY6A 1Q19A 1NC3A 1UBRS 1Q1NA 3QG5A 2BM0A 4N5HX 4QUEA 1IK4A 2WUWE 2C9DA 1IJFA 4WOCA 2FWJA 4GYKA 1RKUA 1T1IA 2J6IA 2YN0A 4KO2S 4WLOA 4E4YA 3ZVMA 3THXA 2GXQA 4J29A 3WDMA 1NVAA 2VYFA 1UIMA 3IRVA 4Q9LA 4E6EA 1JR6A 4AKHA 1JDBB 1NR5A 3DTTA 3PR1A 3U3KA 4ENSA 5JZMA 2YHAA 1Y1PA 3W5DA 4BCBA 2NYAA 4OKSA 3QXXA 1DOZA 1CIJA 1K1EA 2ZPUA 4J2TA 3IR6A 5FI5A 3VZCA 1XCPA 4AKSA 2O1XA 3BT7A 4YREA 1PKEA 1L7OA 1X1AA 4CHGA 3V9AA 2Q8QA 3VNAA 2H8GA 2W22A 3B53X 5U9CA 1OFHA 3ETCA 2C83A 2ZSDA 4F11A 1C8LA 3M1YA 1U7TA 4HWPA 4MZDA 3WE7A 1J0CA 1U8FO 3S1AB 1UWVA 3HFGA 3BK7A 2GWRA 1U63A 3D6TB 2O2ZA 3GVXA 2DFNA 2JB9A 1W85A 2BMWA 1EZ1A 4U7JA 1D4FA 1CFZA 1YDEA 1F14A 1YHNA 1BXKA 1N2BA 2IE8A 2XB4A 3LCVB 1UMCB 3OOHA 1YAHA 2XXAA 3RF6A 1U1GA 2B25A 1ISRA 4U2BA 1Z5VA 2ZUTA 2RGNC 4IQ8A 4LZOA 1EK1A 3KJZA 4ZIRA 4E1BA 1WW2A 2R6ZA 4OMCA 1RJFA 4MKXA 3VDQA 2QUZA 3E35A 621PA 4HRAA 2HCBA 2W11A 3EZ7A 2AKYA 3UV6A 3EB9A 4RLHA 4BAUA 4NHOA 2NNLD 2D7JA 1IH8A 3CLUD 4GC5A 2I03A 2YMMA 2PLFA 1M2VB 2V4MA 4I14A 3RS8A 2HT1A 4CG1A 1HPLA 2DQ4A 1KYYA 2EZUA 4PPGA 3T5TA 3VPAA 1GL3A 3K5WA 4JQYA 4DLLA 3TG8A 5ILGA 2HCFA 3AR4A 4EKGA 3SWWA 2GBGA 3PHJA 5ELMA 1KP9A 4LNAA 3C45A 3H9CA 2GH1A 2XE4A 2GEVA 4G84A 4OBBA 2C5AA 1V9LA 1XTIA 3F1KA 3FPFA 4XTRA 1ZUIA 3WLKX 4OOEA 4RZUA 1X7XB 3TX6A 2Q9BA 3WXBA 4YR9A 1ZGHA 3P9KA 4JVMA 1CXZA 3EBPA 4AQYB 2A4KA 2WAYA 1ZM2A 1J56A 2R6GA 2AG5A 3AF6A 2VAVA 3BAFA 4INPA 1Y7TA 2CLEB 5CNMA 5HOEA 1GZ7A 3H86A 3L9XA 4HY3A 4B40A 3OQIB 2X2PA 2X2FA 3DYBA 6ABPA 2ACKA 4GKJB 2QLTA 1TEHA 5DTMA 4A27A 2PU5A 4ZDIA 1EXMA 4YJ3B 4RD1A 1I36A 2AFHA 4O4HA 2R8EA 3EW9A 2W8BB 3F73A 3GH3A 1SURA 3PEEA 4U6NA 4YCMA 4FDUA 5BOSB 5LQKA 1SUFA 2PUWA 1JDNA 3SEZA 5G02A 1E5TA 1SBYA 2Y77A 3EXHC 2JFXA 3WJAA 4OQFA 2EJBA 2B4KA 2W70A 2G6BA 5EE9A 3W7BA 4N6OA 4UE3S 3RBAA 3D6FA 4IV0A 5BYBA 3AR8A 3EVTA 5TQ2A 2X6QA 2VBGA 2XOXA 2QLFA 3GUCA 4Y2PA 3A04A 1UC9A 4QFDA 2H4FA 3D2AA 1EX7A 5BN1A 3L7MA 3EC2A 4LJ8A 2HHJA 3COZA 3PITA 2EQBA 4IXWA 3LIPA 4MV1A 2JHAA 4LK2A 1T5TA 2ZULA 3AKCA 4FBMA 1C7IA 1NKVA 1PJAA 1WZEA 3MTIA 2IZ7A 2Z8YA 3M6AA 1ZXBA 1ISGA 2QZPA 1TNDA 2CFRA 3R7SA 1PUJA 2R3SA 1R0LA 1YR6A 3TLYA 5KJ6A 1Y4ZA 4KN8A 5CPBA 4DLKA 3H8VA 4EKNB 1C3XA 2OE2A 5SZKB 3SM3A 2ZRLA 1Z0UA 2VSNA 1IDOA 1D1SA 5HCIA 3EEYA 4JBXA 4J16A 3IEXA 5HBGA 1QQ6A 4MWSA 2V45A 4Z53A 4R9RA 2V6GA 1B3RA 1S2DA 3MINB 4GLBA 2SKEA 3IMEA 3SQWA 4MJ7A 1M34E 1XYGA 3IOYA 4HJXA 3C6XA 3NETA 4FJ1A 4XWYA 1D5CA 3U62A 1NSFA 4D80A 1DOHA 2XIJA 1KE2A 4PAWA 2ZYGA 4ES6A 3QRWA 3WLJA 1C30A 1GO2A 2IYUA 4LQLA 4DJ5X 4GX0A 3ZCTA 1GAEO 1EFDN 1AHNA 3DMRA 3IVRA 3V33A 1Z0KA 2RH5A 2AK3A 3CNEA 1VKRA 5HTOA 3G5LA 1YZTA 3W04A 5TT0A 3LY7A 1FX0A 1SVLA 4FMDB 5EMMA 4MYHA 4EG8A 3C85A 3H8JA 3EIEA 4RLSA 2J0QA 5FL7A 1GU0A 2SKCA 3JQ7B 1FTQA 4TRMA 5JYBA 2DBQA 5ED0A 2OG2A 3H2IA 4KPUA 2FPGA 2PG3A 5D51S 3T4XA 3NM6B 4J1TC 1L9KA 2XCIA 1WHSB 3L6RA 4ENVA 1QMPA 1LZLA 2AMFA 5G0VA 5IF9A 5TJ9A 1G6KA 2E55A 2YWBA 4KTVE 3AY3A 3VPDA 2Z83A 3DG9A 4Z4QA 2DR2A 1D8AA 4JASB 3KQWA 1JLSA 2C4VA 4J75A 3UAXA 2IA5A 2XMSA 1RI1A 1UM9A 3C3AA 1SVUA 4W9NC 1JFSA 1RHKA 3AERB 1IY9A 3LDUA 3R23A 3FWYA 4FHGA 4A16A 2IW1A 4E07A 4EEZA 2IPNA 3KPYA 2C96A 4NDAA 1D03A 4J76A 4X1IA 1PW7A 3F6EX 3JQ9A 3OHSX 4I1IA 1BXRA 4TV9B 5KINB 3T99A 1HZZC 1MX1A 4IAOA 3I8SA 1YZHA 4JSTA 5CMLA 4KJXA 3SYNA 1S96A 4FDLA 5K5EA 3ZYCA 1FA9A 4G0UA 3CUSA 1IHUA 4KNVA 3PD0A 2ZANA 3QF4A 2XNDA 2FR8A 4QO8A 2CN1A 1SB9A 3GLHA 3IP1A 3UBMA 3C48A 1T0PA 1J1IA 1LPNA 3GFPA 3GH1A 1J09A 3HUTA 3T3MB 5A3SA 4TXNA 2X23A 2O54A 4KR2A 1SCBA 2H0QA 3CEAA 3LLMA 2GAAA 4BJHB 2V4UA 1JIQA 4OHWA 1AQNA 3TLXA 4OREX 2R85A 3TUIC 2H2DA 3D3KA 3OD1A 3RE1A 4QARA 3TSZA 1NX6A 3NJRA 3QI7A 2IXAA 4PPQA 1SC6A 2R97A 3CUKA 5JAIA 1LK7A 5EZSA 2J7PA 2G80A 4DUGA 3VR2D 1V45E 5IM5A 1T24A 2ZB8A 4RDXA 6GPBA 4FXOA 3ZQ6A 3ZCVA 4FYPA 5EIFA 4DNQA 3FMVA 3SD7A 3GF4A 2I7TA 1X80B 3L0PA 3H9GA 4Q01A 1N2ZA 3QOYA 4LA4A 1DKLA 4LC0A 1SFRA 5K09A 4MDYA 1ZUNB 1I5RA 3VOTA 1PR0A 2ZVQX 1RXIA 2P11A 5DCLA 3W4IA 2NZUG 3PQ5A 5C5IA 4JUCA 1GKKA 2H07A 5GOZA 3W2GA 1DX9A 1J5XA 2A5FA 2J67A 2P9FA 3U7QB 2QL6A 2AV6A 5LQSA 1V11B 3S68A 1WXGA 3BA6A 4A8JA 2WHEA 4YJHB 3E7DA 2YUIA 2C59A 3AP2A 3AIOA 1YDMA 4RQTA 4JWKA 2OILA 3G9UA 1Y9JA 5DM2A 1NY6A 1UFVA 3FMIA 1Z5OA 4QTUB 4YJ3A 3U3MA 1KI3A 4PN7A 3IQIX 4WBXC 5LWQA 4RKEA 3VDXA 1A2OA 2GI4A 1WNTA 1U0OC 5FAKA 3MCVA 3I45A 3TMYA 3BX1A 1IIBA 3DE7X 5IAEA 1G3RA 3A7EA 4JZYA 3PE3A 1GPNA 3LPDA 4H1HA 3OU6A 1Q22A 3DZJA 1G6OA 1KU0A 1RACA 3KQSA 3OEWA 4ZZ1A 3B70A 3E70C 1WJGA 1X0VA 3PXXA 2VYCA 2G83A 3S27A 1YRBA 2HQRA 1A8UA 3MTQA 3RC1A 2XE8A 3ZWBA 4CM3A 1K0FA 3B6IA 3F4KA 5JO9A 1DU4A 5HS6A 3AU8A 1L4GA 1N1GA 4RF3A 3A4LA 1Z22A 1OTHA 3QVSA 4YAEA 3I34X 1JTFA 2O19A 1EGQA 3HUUA 3QUCA 5JWOA 3OBBA 1EYZA 1YA8A 5H4GA 3DBOB 6NULA 4WBNB 1KR5A 2B7CA 1R8YA 3DKVA 4PC1A 3JRXA 8ADHA 1YB2A 5K8IA 1G2PA 1PWEA 3VZRA 1AQJA 1H93A 1W6UA 2ZIWB 4OUKX 5CTAA 5KVVA 2IS2A 1N6NA 1X9IA 5I4CA 3QWAA 1G8HA 1IFXA 3U2QA 1RWMA 3Q1KA 2W90A 3HMQA 5FTKA 2HLDA 1QQAA 1P9LA 1SUBA 1XVLA 2DLDA 4XGQA 5I7SA 4X6YA 1HDOA 2VH5R 3EY9A 2DFTA 3TGWA 3VJMA 2G72A 1RM5A 4ZGWA 1IULA 1KPHA 2R8ZA 1D2NA 3HJTA 4FYWA 2PMFA 4R4JA 3JY6A 4ND1A 5AO9A 5AOBA 1U3DA 3ZKWA 4UBOA 4EPVA 2EX1A 7MHTA 3UKDA 2JAWA 3MJCA 1F6WA 1G2QA 1GAJA 1HGXA 3FMFA 4PGAA 1LBEA 2WJZB 5JWRA 5KBYA 4HHEA 4DV0B 2F1HA 4ZP1A 4MVJM 3TVDA 2XZPA 4F2GA 3IQFA 4W8GA 1ZLYA 2EZTA 3NHZA 4IOJA 1S9HA 3B1VA 4AURA 4CKWA 1UKZA 2GJAA 2BIFA 3VUEA 1SC4A 2GO1A 3LVQE 1JP7A 2Y4NA 3UAYA 1QR2A 1FQOA 3SR3A 2HJ9A 3NEJA 3PNVA 5J1SB 3ZLJA 4YH1A 3WK6A 5F98A 3CJQA 3DGFC 2VOEA 3FWZA 4LVOA 4NJEA 4RJLA 1K2VN 3ZI4A 1GCIA 3EAGA 3DE6X 5ILQA 1LBIA 3N2GB 1L5HB 2BGUA 3HZOA 2BT4A 3DJYA 3K30A 2H5JA 4O2BB 5FOVA 1GA4A 4GH5A 2P9YA 3O82A 1VGQA 4BNGA 3F1LA 4HDCA 3RIGA 1JMYA 4EFDA 3O2JA 3TECE 1GTSA 1QG0A 2FETA 2F55A 1Q2XA 4J4BA 4PX3A 2O1WA 1PT7A 4D6XA 2ZSIA 3WSWA 1LW6E 1MOSA 2X0JA 1U0JA 2E37A 3H4MA 1XZNA 3MERA 5D00A 5E2BA 1OV4A 3ESDA 5CJ2A 4JB0A 4YN3A 4WLFA 4I4NA 4A5SA 5EFOA 4ARSA 1T1RA 3TXYA 8OHMA 4MVJG 1ZW6A 1GTG1 3Q0TA 4IXMA 2IDKA 5CD9A 5DRTA 4MVJF 1ZNQO 3SIRA 4BNVA 4JJGA 4BPBA 3ZZUA 4QDKA 3I9OA 1TVEA 2EERA 1KEPA 4X0EA 2B7LA 2OXEA 3NBAA 5B7QA 4ZICA 3WYDA 3LOUA 1OFUA 1QE0A 4D1YA 3U4QB 3T1OA 4YJFB 1E9DA 4TN1A 1OYOA 3L8YA 2VYQA 4Y1EA 5L4SA 1IN7A 4KWHA 2AVDA 2V0CA 5JSZB 2QTNA 3GCGA 2IW3A 2GBPA 2PV7A 5TGDA 1YVEI 5CXQA 4C7OA 2OAQ1 4ZZIA 1W9HA 2JGLA 1DIAA 3A31A 4BNKA 4ZOLA 4B2IA 3TH5A 3WLIA 2PVSA 2JLXA 1E6WA 4BTEA 1E1MA 1MBZA 4ZMSA 1VLZA 1C3VA 3HGTA 1RAAA 2VDJA 4BQPA 1YHZA 5MFPA 5BRNA 2YS7A 5FBWB 2IX3A 1LPOA 3TE6A 3TTSA 5KMGB 5LMNB 4QEKA 2XCLA 1NNEA 3WADA 4HNHA 5JE8A 3KUXA 3WDLA 3A6EA 3BGOS 4KUHA 4REOA 3RC3A 4L73A 2O07A 1G3MA 3ND5A 5BQ5A 4GR4A 1BMFA 3EDQA 3S8MA 2J45A 4AJHA 4AG5A 4YCLA 3RUIA 5BV1A 3TQCA 4ZAGA 2CJPA 2EP5A 3B82A 2HSDA 5F21A 3VPFA 2HY7A 4JOCA 1Y6JA 3ZXSA 4EG4A 4PHTA 1VJRA 3O3NB 3WNVA 1B41A 3WO1A 1XEAA 1OHHA 4QTZA 5LUBA 3IKTA 1K8RA 1PR3A 1QORA 5BV8A 3W5AA 1RBYA 2WJJA 4KK3A 4BDTA 1Z39A 2OFFA 3VMMA