4Z49A

Homo sapiens fatty acid synthetase, thioesterase domain at 1.7 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
262
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Estimation of Hydrogen-Exchange Protection Factors from MD Simulation Based on Amide Hydrogen Bonding Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fatty acid synthase
total genus 95
structure length 262
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 4z49A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z49A01
1JJIA 2B61A 1NU8A 2JGFA 1PV1A 1F0PA 4TGLA 3VDXA 5DTJA 4G8CA 1LPMA 5SYNA 2CB9A 5CT8A 1VA5A 2ECFA 3AZPA 3IA2A 3V48A 2G63A 3H1BA 2WKWA 5HFNA 2V97A 1XLWA 4AQDA 2WG2A 4PSUA 4QDXA 3QH4A 3D4LA 3X3HA 2JGJA 2PX6A 3LS2A 3GZJA 4OB6A 4F60A 1USWA 4H7EA 1AMNA 1IUPA 1NX9A 3WK4A 1XQYA 3W9UA 4G1FA 4BDTA 3WIBA 1GQSA 5IVDA 3WWCA 1QIEA 2RHTA 2AJBA 5JAPA 1W76A 4BP8A 1K8QA 1R9MA 2Z3ZA 1Q0ZA 2AJDA 1CLEA 3ILSA 2QOEA 1GT6A 5ALIA 1E5TA 1QJ4A 3TRDA 1G42A 4PNZA 1AQLA 3TEJA 1QO7A 4UBNA 1T4MA 4BZWA 2GYWA 3C45A 4DSZA 3D3NA 3KOOA 1EK2A 2XQIA 4AO7A 2FX5A 1ACLA 3R0VA 3T4UA 1WB5A 2PVSA 3CN7A 1QOZA 1QTIA 2Q0XA 4X91A 5KBYA 2XQJA 3RARA 4Z49A 1EHYA 3NWOA 2OG1A 3SC2A 1P0PA 1KU6A 4LKOA 2OPHA 4B6GA 4J3JA 3K2IA 3G0BA 2QS9A 3F8SA 5KWJA 4DMCA 5HF9A 4L9AA 1DT3A 1EXWA 4M0MA 4OUKX 5AKKA 1CQWA 5ALDA 1YAJA 1Q0RA 3F97A 2CMFA 2QMQA 4UPDA 1GPKA 2XMGA 1AX9A 3ZV7A 4DNPA 2PSDA 5AM2A 1JI3A 4KRYA 4H7KA 1CVLA 4LYDA 1BN7A 4EY6A 4Y2PA 3I2GA 1TKRA 2XQGA 2HIHA 3KXPA 1P0MA 3HXKA 4BAUA 5AOAA 5JYCA 3O4GA 1AGYA 2CZQA 4MJ3A 1JKMA 1AKNA 1XRMA 4B81A 2AJCA 1ODSA 4WY5A 5K3DA 2JEYA 1CUCA 4Q82A 1RP1A 4NZZA 3WL6A 2XUQA 5ALZA 5CXXA 1DTEA 4Y2JA 5DNWA 2ZYRA 3O95A 3G0CA 2WJ3A 4GW3A 4A23A 2WFMA 1RWQA 1ZGCA 4Q1VA 3H2KA 2ZJ7A 3WKBA 4HXEB 3EBLA 1VLQA 5HKBA 1LPPA 1ISPA 4DNQA 1VKHA 1FSSA 4E15A 4WJLA 1FJ2A 3BJRA 5AM5A 4XX1A 2QVBA 5AK6A 4N5IX 4UBKA 2HU5A 4FNMA 3HSSA 1FFBA 4OSEA 3TGLA 3HZOA 3I6MA 2AJLI 4J0KA 3GFFA 3GROA 3O9VA 1FFEA 4IH9A 3FSGA 3A70A 1UKCA 3IBTA 1EB9A 2C5FA 2XLCA 2DCMA 5ALPA 3WZLA 5HKAA 1ODCA 4PO3X 4JEIA 1R3DA 3BL8A 1NU6A 4J7AA 1GGVA 4KRXA 3WK6A 1AZWA 1HDEA 5A7FA 1OXMA 3SWWA 2ZVDA 5AM1A 4J03A 2B4KA 4DSAA 5JAOA 1K5PA 1E8NA 4ZV7A 5AKYA 3PUHA 5CT6A 1CQZA 1JU3A 3C70A 2EDAA 1W6RA 1XLVA 4BTLA 1YCDA 2QJRA 5KWIA 3C6ZA 1K63A 2OQVA 4CFSA 3E1GA 1DX4A 3QVMA 3EQ9A 2ZJ6A 1VXRA 2Z8ZA 4UBIA 4F21A 4DLNA 2YXPX 3I2HA 3C6BA 2PSEA 2HA6A 1H2YA 1P0IA 5CT5A 3HYSA 3QPCA 5EIEA 1XROA 3OPMA 1JJFA 1L7RA 1SCIA 4KE6A 1WM1A 3WWPA 2WILA 1TIBA 5DJ5A 2C5GA 4OYLA 2ONCA 4EY5A 3PE6A 1XKLA 1BCSA 4N8DA 1CUHA 4PSDA 1L7QA 4BVLA 5BOVA 1SOMA 4B82A 3IURA 2XMRA 1HPLA 1HBJA 2PM8A 1BROA 1PFQA 2WUGA 5CH5A 4GECA 1TCBA 5JASA 3VISA 4KACA 1UXOA 4GBGA 3RK4A 4XIIA 2H9YA 1IMJA 4DMKA 1H23A 5ALTA 5ALNA 1I6WA 1WOMA 3C6XA 5ALFA 2XUFA 4W9RA 3OURA 2G4LA 5HF6A 3EQ8A 2VJDA 4QDTA 4X90A 5JIBA 1X70A 4LIPD 5HCUA 1H2WA 2OGSA 3H0CA 5JANA 5K3FB 5ALHA 1IVYA 1CUJA 4N8SA 3OC0A 2OGTA 1TAHA 1BEEA 3L1IA 2ROQA 3AIKA 2D0DA 2GBGA 5HFAA 2QJWA 1Y37A 1LBSA 2HA0A 4U2GA 3G9TA 3WK9A 3VKFA 4EBBA 4JUIA 2OCGA 1B6GA 3AIOA 5A7HA 2RAUA 3R3ZA 5AHXA 1C7IA 2G5PA 1XQWA 4OB7A 1LPSA 3C43A 2JF0A 3T52A 4U2BA 4NVRA 3BJMA 4EY7A 2HM7A 2OQIA 1CUBA 4QLOA 1CUSA 2XMCA 1UZAA 4UFOA 4M0FA 4CG3A 4X3CA 1P0QA 3G0IA 4HZGA 3M81A 1R4ZA 3OOSA 3C5VA 5CH8A 4X00A 1CUGA 1Y7IA 5AKHA 1W1IA 4KJXA 4RNCA 4JYMA 3VXKA 4UHFA 4N5HX 4UBMA 5J3JA 5ALJA 1DWPA 4HS9A 1CUEA 1VXOA 3C8HA 4GXNA 1XZDA 4DGQA 4BYMA 3ANTA 1J06A 5FKJA 4B80A 3H18A 4Q3KA 5ALSA 4QEKA 3AJAA 1KEZA 2B20A 5LIPA 1QIHA 2EEPA 5EHXA 3QPAA 4NMWA 5AO9A 2RHWA 1XQVA 4U2FA 1R88A 3WK8A 3ZLVA 1HL7A 2PU7A 2ZJFA 4X95A 5IH7A 3W04A 1WHTA 1O6GA 1YB6A 4LXHA 2R8BA 4KR0A 2PKYX 1FFCA 5ALQA 4KE9A 4B84A 4FDMA 3VJKA 3O4IA 1C7JA 3M83A 3ZPXA 3ESDA 1K6EA 3DJYA 4MEAA 3FSGD 1MX5A 4B7ZA 2WG0A 3FLAA 3WL8A 3ED1A 5FPPA 2GBCA 3R40A 4ZREA 3FVTA 3FWHA 1VOTA 4CCYA 5BWCA 2FJ0A 4KEAA 6YASA 4J0GA 1ACJA 4H35A 3QPDA 2VEOA 5AKJA 4H77A 3R3WA 4P92A 4HXGA 5AI4A 1WPRA 2FUKA 4FLFA 3PDCA 5ALOA 4K6KA 3OG9A 3PFCA 1EH5A 4UBJA 1R9NA 2FJPA 5A2GA 2BKLA 2WU3A 5JZ9A 1N5MA 1A88A 4W1PA 3G9ZA 4W1QA 1FFDA 3A6ZA 2XQKA 4S0XA 2PUJA 1QZ3A 1QGED 4XVCA 5ALYA 2YYSA 2JIDA 2B9VA 4H7DA 1B41A 3STWA 3R41A 3WKDA 2P8SA 2V9ZA 4AZ0A 5LKAA 3BDIA 1SFRA 2WIDA 5JALA 5HK8A 2GZSA 1ZI6A 1BCRA 1XZIA 1CUFA 4HAIA 3EIOA 5HQ3B 5EI5A 3IUJA 2HA4A 4H7HA 1WCYA 3N2ZB 4C4ZA 3STXA 4JNCA 3CN9A 5K3EA 4ZXFA 1XRRA 4QE3A 5AK3A 3S8YA 5JAUA 4AO8A 3G0DA 5AP9A 4BBZA 4FLEA 4FWBA 4K2AA 3FYTA 3GUUA 4G5XA 2OCIA 1XRLA 1PJAA 4H18A 3V9AA 3WWEA 5EHQA 4BCBA 1OILA 2XUPA 3BF7A 3N0TA 5AOBA 1KU0A 4RE6A 5AK5A 1XZEA 4Y7DA 1YAHA 1EDBA 4A5SA 3STTA 3VVMA 5LZ8A 2ZYIA 1DU4A 2HL6A 2PBLA 2O2GA 3FVRA 4ARAA 2GYUA 3FYUC 3WWDA 2I78A 5BWBA 4H0CA 2IITA 2J3QA 4X93A 3AUKA 4UHBA 3BDVA 4UUQA 4CCWA 1UK6A 4AZ3A 5DLPA 1ZGBA 1QFMA 4UFNA 1TQHA 5JADA 1EDDA 3QMVA 3AINA 2DQYA 1XZKA 1CUVA 5FRDA 2WFZA 4Q3OA 3FBWA 4HXFB 3OTQA 5EHNA 2VJBA 4O08A 4BRSA 2QUBA 3TJMA 3G02A 1WB4A 2WM2A 4AX4A 1N8SA 3R3XA 4UFPA 4P08A 1L7AA 3STYA 1DQZA 5BV7A 4ZGBA 2JGIA 1XRQA 3I2JA 3VJMA 4IQ4A 3LIPA 2QT9A 2HA3A 4K6GA 4AMZA 2WG1A 3H2IA 5I8PA 3DEAA 4ETWA 3QMMA 5T4FA 2XDWA 1ORWA 4YASA 1EINA 4ZRDA 4L72A 4OCZA 5ISMA 1X2EA 3HJUA 2G5TA 4ROTA 2I3ZA 4AO6A 4E46A 1BS9A 1EI9A 4ZWNA 3V1LA 5H3HA 3FYUA 4FLMA 4WDQA 2ZSHA 3FAKA 3PFBA 2DHEA 2GZRA 1QO9A 5CXUA 5K3AA 3RM3A 4BP9A 4GHWA 5DYWA 1G5FA 5ALLA 2WHPA 2ZSIA 4DIUA 1XZBA 1JU4A 3R3YA 1ZOIA 1EX9A 4X6YA 1VZ2A 1GZ7A 3DCNA 4GI1A 3F67A 1UOPA 2WQZA 4ZV9A 5D7BA 3WYNA 1A8QA 4N8EA 1LNSA 3A2LA 2H7CA 2IIVA 1U8EA 3IUNA 3O0DA 2C58A 2WJ6A 1THTA 1DWQA 5EGNA 1E3QA 3G8YA 4OB8A 4X94A 2PL5A 1EA5A 1S8OA 2RONA 4I3FA 3CCBA 1UOOA 1UFOA 4BAGA 4FBLA 1SCQA 4GWLA 2XT0A 1XQXA 1CRLA 3MVEA 5AKZA 2V98A 5CW2A 3M3DA 2UZ0A 2DR0A 3BIWA 1F0NA 5E4YA 4LXIA 2XE4A 4Y2VA 3H1AA 5C7YA 5FUMA 4MQLA 2WIFA 2DHCA 2ZYHA 4QDUA 5ESRA 5AI5A 1CUDA 2E3JA 2J4FA 1DINA 4CG2A 3DL4A 2PSHA 3C87A 3IULA 3HABA 1U4NA 1MO2A 3FCXA 1CR6A 4YX9A 2ACKA 3HRHA 4IO0A 4WFJA 1CPYA 5CTAA 4OPMA 3BF8A 4UHDA 3W06A 2QKYA 4KE7A 2VT6A 3QMWA 2PSJA 1ODTC 2V96A 3H17A 5ALRA 2CEKA 4G4GA 3LCRA 3PF8A 5IVIA 1HQDA 3DQZA 3WYDA 3AZQA 4DMFA 4P93A 4EZIA 4DM7A 2ACEA 2WIGA 1VA4A 1EVQA 4KAJA 2XUDA 2Z8XA 2WTNA 1WPXA 3IDAA 5AIBA 3ZLUA 2BGNA 4Y9SA 1JMYA 4C89A 1WB6A 5IKXA 1QIIA 5CT9A 1F8UA 1C4XA 2I03A 4A16A 4GDMA 1FFAA 1XZMA 4QDZA 1QTRA 4PF1A 4BZZA 4QZVA 1CUUA 5ALGA 4W63A 4LXGA 1QIJA 4C88A 4X7BA 1MNQA 1J07A 3DOHA 5E4JA 4W1SA 4JH0A 1H22A 5K3FA 1J1IA 2XMQA 3DKKA 4KAAA 5ALUA 3WJ2A 1YASA 1F6WA 2Z5GA 1LBTA 5EHZA 4IH1A 2W6CX 2ZYSA 1DWOA 4CIBA 2NW6A 2I3DA 4FKBA 3GA7A 3I1IA 3EF3A 4YK7A 3DS8A 5F4ZA 2VAVA 1TCCA 3BWXA 1W4LA 2QRUA 3V1MA 1Y7HA 1IUNA 2CJPA 3DOIA 2LIPA 2QUAA 2WUEA 3FCYA 5C81A 5FV4A 2XUGA 5AM0A 4QA9A 5AKGA 2OXEA 3HACA 5C8VA 4P9NA 1MTZA 2WIKA 4QWMA 5DNUA 2HADA 1ZJ5A 4J0HA 4TVKA 5LZ5A 5LZ2A 5LZ4A 5E4TA 1JT2A 3H19A 2EDCA 3BE8A 5HZGA 2WIJA 5AM4A 5A7GA 4Y2QA 1EK1A 1XZGA 1IZ7A 4DYHA 5A62A 2C7BA 4UBOA 3FLBA 5A6VA 1QIDA 1YS2X 1ZD5A 1SC9A 2PSFA 5EIHA 1MAHA 5D3ZA 1UKBA 1BRTA 1CIJA 1U2EA 2VF2A 4BC1A 1MX1A 2C0PA 5ALMA 2JGEA 5C8ZA 4UHCA 3DL7A 3B5EA 5LZ9A 4MYSA 1AUOA 5EFZA 3H2JA 2WFLA 3AZOA 5CRIA 3MGAA 4G8DA 1GPLA 2WFLB 2Y6UA 3EQ7A 3IUMA 2J3DA 2WTMA 4RPCA 2BUBA 5AI0A 1DQYA 3AFIA 4LYEA 2HHAA 3D2AA 1G4HA 4FNGA 1UOQA 4QWWA 1VE7A 1XZAA 2CBGA 2OLEA 3WQHA 4B83A 2Y1KA 2HFKA 2BAGA 3DLTA 4BATA 5T4HA 3G0GA 1LLFA 4FTWA 1H2ZA 1K4YA 3FNBA 1MU0A 4AXBA 3W05A 4OD0A 2O2HA 3C6YA 4KE8A 3ICVA 3E4DA 1ZI9A 2HDWA 1THGA 3QZUA 4C4XA 2XMSA 3ZLTA 2XUJA 1JJBA 1UK7A 4PQEA 2DQZA 4V2IA 3CXUA 5K3CA 4OU4A 5JZBA 5HF5A 4Y2SA 5AICA 1O6FA 3RKSA 4PSCA 3WJ1A 4D9JA 5C8XA 3RLIA 4I19A 4CG1A 2WHPB 5JARA 3H2HA 5ALXA 4QLAA 2H7YA 2Z3WA 2CKMA 3IUQA 3LIIA 4X6UA 5FPQA 4J0CA 1BN6A 1QIKA 4KYVA 1T2NA 4AN1A 1YSCA 2HU8A 2GYVA 3WL5A 3UUFA 3UUEA 3H2GA 1TCAA 1H2XA 2QXUA 2VATA 5IVKA 5YASA 4YPVA 3B3QA 1XLUA 3UMJA 2JGKA 4G4JA 3U0VA 3FLEA 5LLSA 4B0PA 1A7UA 1A8SA 2X76A 4Y2TA 5DNVA 4ARBA 1UK9A 1TRHA 4G4IA 1X2BA 5FLKA 4BRZA 3BIXA 2VT7A 1UT6A 3D0KA 1MPXA 5CURA 3VVLA 2BCEA 4FBMA 4PW0A 5FXMA 4C4YA 2XUKA 3FOBA 3CCCA 3B12A 3U1TA 4BE9A 2QM0A 4EA6A 5DYTA 3HC7A 2AXEA 1J2EA 4BCCA 3G9XA 3WKEA 4ITVA 1MAAA 1MT3A 4BTVA 1CUAA 5A71A 1HKHA 4AB1A 5SYMA 3KWFA 5JZSA 1GXSA 2CUTA 4ZI5A 1GQRA 4W1RA 1XKTA 1ZI8A 3JWEA 2XMDA 3STUA 3OM8A 3ESBA 1GKLA 1LPOA 4IHAA 3NUZA 3YASA 5ALVA 4Q3LA 1QONA 1W75A 1MNAA 4FMPA 3IIIA 2WUDA 3PI6A 4U2EA 1LZKA 2DFPA 1E8DA 4X92A 3AILA 3ZI7A 2C4HA 4WCVA 1ZICA 4EY8A 1WHSA 1QE3A 1EVEA 3D2CA 4BVKA 2BFNA 3I2KA 5AM3A 5CT4A 5LKRA 2Y2UA 5FP0A 3I1YA 3I2FA 3W9BA 2WHRA 2VJCA 3WKAA 4C6HA 2JGLA 4UHEA 4EUSA 3I2IA 1R1DA 2QTBA 1XZHA 3KD2A 5JD6A 3DYVA 4L3WA 1MX9A 5DYYA 3WL7A 5IVHA 4MWTA 3D7RA 1XRNA 3PF9A 1ZD4A 3LP5A 3WA7A 2DSNA 3L1JA 1Q84A 3K9BA 2Y6VA 3KSRA 2K2QB 3R3VA 3V1KA 3HLKA 2GBIA 5T4BA 1RYYA 1U65A 3VJLA 4WY8A 1ZIXA 2GBFA 2XUOA 4UBLA 2XUAA 5CH3A 2VSQA 5HK9A 3D5EA 3DNMA 2J4CA 3WIOA 3WWOA 3DYIA 3QYJA 4B9EA 4DNOA 4G8BA 4U2DA 1Q83A 1CUZA 4OU5A 3AIMA 2VA9A 3JYHA 4MQMA 2OCLA 4DNFA 2H7XA 4HTAA 2PPLA 3PICA 3S2ZA 1SCKA 4BAZA 3C8DA 1XZLA 3IB3A 5JATA 4CCYB 4GEGA 1N1MA 1W52X 4HRYA 4TPKA 3GELA 3O4JA 4BCDA 5LYYA 2JBWA 2HU7A 4BC0A 2QR5A 2O2IA 1LPNA 1MN6A 7YASA 2H1IA 2VAXA 1YA4A 3E0XA 4DTCA 4CI9A 4PV7A 3ICWA 5ALWA 3HEAA 4OYYA 4IH4A 1R50A 4GLBA 3A2MA 1GKKA 2VQ6A 3O4HA 1G66A 5CMLA 3F9CA 1XFDA 2PUHA 3G7NA 3ZWQA 1E8MA 4UHHA 5EIAA 2X8BA 5D6OA 2BUCA 4FOLA 4BDSA 4G9GA 1EB8A 2W22A 3WKCA 3E3AA 2XUIA 1LPBB 5AKEA 1QIGA 4Q34A 1AC5A 2JGMA 2XI4A 1ZD2P 2WLSA 4JYPA 4EY4A 3F96A 3DKRA 5K5EA 4FFVA 4E14A 2DHDA 1EDEA 2RGUA 4RE5A 4XJVA 4X6XA 2XMBA 3I6YA 2WU4A 4AN0A 3K6KA 4HRXA 5K3BA 1VJ5A 1QIMA 3WI7A 3I28A 3O9MA 4DMHA 2AJ8A 3H04A 3D59A 4X97A 5AKXA 3SX4A 1DX6A 2WHQA 4M0EA 2ORYA 1UWCA 2RIPA 5HF8A 3GBSA 2HRRA 5AKLA 4B85A 1ZJ4A 2OGZA 4FFWA 5AK4A 4H7IA 1E89A 3MUNA 4F0JA 3ESCA 5I9IA 4L0CA 1ORVA 1UKAA 2OCKA 4QDOA 1IZ8A 3Q0TA 4C01A 4J0DA 2QZPA 5I7UA 1Z68A 4E11A 4G9EA 2OAGA 3ANSA 5KREA 4QNNA 3C5WP 1BU8A 1CUYA 2D5LA 5AI6A 4MWSA 2HFJA 1A8UA 2JEZA 1LGYA 1OCEA 4BVJA 3A2NA 2IX9A 1D07A 1JMKC 1HLGA 2XUHA 4F5ZA 3PUIA 3STVA 4Y2XA 4EHBA 4Y2YA 1AURA 3WA6A 4X85A 5AH0A 2XQFA 4I4CA 4U2CA 2O7RA 1ETHA 1BEZA 1TK3A 4MXDA 5LZ7A 5DWDA 2HA7A 2WJ4A 4Y2RA 2OAEA 2VJAA 4WFKA 3G9UA 5FOQA 2WUFA 3KDAA 5LP1A 2XLBA 4CIAA 2XMZA 3F98A 1CUXA 1YR2A 2HA2A 4X71A 5AIAA 3Q8WA 2BGRA 4H7FA 5E2IA 1YS1X 4INZA 1CV2A 3DDUA 3LLCA 2R11A 2Y2VA 2HRQA 4BE4A 1YA8A 5ALEA 1CUIA 5CBKA 1CUWA 4AMYA 4B9AA 3KWJA 1ZIYA 2QXTA 4B0OA 3DD5A 3WZMA 5AOCA 3ESAA 1LPAB 2PU5A 4K5QA 4C87A 1JFRA 2RI6A 3V1NA 4FHZA 2ES4A 1MJ5A 3WK5A 2VTVA 3W2TA 1ZD3A 1UK8A 5AI9A 2WSLA 3D2BA 4BB0A 1XZFA 2X5XA 3HI4A 5D3KA 5ALKA 3NGMA 5AI8A 4Y2UA 4NS4A 3FYUB 3NOXA 4MEBA 2BJHA 3BXPA 1VE6A 4Q05A 1VZ3A 3SK0A 3QITA 4XWGA 1LZLA 1QIFA 4MYDA 2HA5A 3L1HA 1XZCA 3I6ZA 2O7VA 5DTIA 4K6HA 1BE0A 4WDRA 4H7JA 3JW8A 3M82A 5JAHA 2XB6A 5AJHA 3MUOA 1YB7A 1GPNA 1CFJA 4RGYA 1CEXA 3QM1A 3WK7A 1N5RA 1QFSA 4WFIA 3WLAA 5JD5A 1DT5A 3QBJA 4HVTA 3P2MA 3R3UA 1M33A 3IVMA 5AKIA 5HQ3A 2BUAA 5FDFA 4J0JA 3WMRA 1XZJA 1QLWA 2YH2A 1E66A 4KAFA 4J0IA 5JD4A 1IUOA 1XRPA 2YASA 4LHEA 4EB0A 5T4EA 2C0QA
chains in the Genus database with same CATH superfamily
1D8AA 4HZIA 3LMKA 1TEXA 1NRIA 3EMVA 3UJNA 3A7DA 4EKIA 1EESA 2UUOA 2H7VA 2JGFA 3ZI0A 3PWSA 4I4IA 1EQ2A 3LFUA 4KXMA 3B5IA 4MV8A 4PS0A 4Y9TA 3FPJA 3QPVA 1XPJA 3VDXA 1DAFA 1N2HA 2C5AA 2O06A 2ZE8A 4IHJA 4KNWA 1W5AA 2QE7A 3NVAA 5IT5A 5LXTA 1P75A 4LZLA 1M5UA 2IIQA 3LF1A 1KJ8A 1P4RA 1VHQA 5AHWA 1Q1ZA 2C9OA 3OETA 5HILA 2CL5A 2PV0A 1WZIA 3BL6A 1PSDA 1ZKMA 2DLDA 5DCYA 1OQAA 3CB2A 3E18A 2ZTVA 2W2QA 3LQ4A 2GS9A 3P97A 1JL3A 5B3AA 3ZK8A 2IEAA 1W0CA 1E2MA 4QGBA 2ZJAA 4IRMA 1G38A 3ON5A 1L5FA 2BC9A 2AZ4A 2P9YA 3KJIA 4XOUA 3RC9A 2WKWA 4QGFA 3JQ8A 1RTKA 4RJKA 5HFNA 1TECE 1CQIB 2ID4A 2V97A 1Z7BA 4ZHSA 4HNRA 1XAGA 1XLWA 1PRYA 4IDPA 5CP8A 4KIFA 2WG2A 4PSUA 3OZ7A 2PMCA 3D0RA 5JNRA 2IPOA 1NBEA 2ODAA 5I9TA 1DJMA 3QPUA 3C7CB 2PWPA 2R751 4JWTA 3EE6A 3X3HA 3DEYX 1JIXA 1WUHS 1GG9A 1ZL0A 3MRXA 4Z3DA 4F9FA 1V43A 2WSIA 2GNOA 4HQOA 4MZDA 4IFTA 4AJLA 1HSZA 2G17A 4RABA 5J47A 2GEFA 2KWIA 5EQFA 1Y5MA 1C41A 1LRLA 2WAAA 3SLRA 3MCUA 4E5YA 3OD5A 4NATA 1WG8A 3BSFA 3DGFC 4HH0A 1LS6A 3W1EA 1JWAB 1HEYA 3T0IA 2FV8A 3O94A 2QY6A 2C9DA 3L07A 1SXGA 3V32A 2HDNB 1EVKA 2RHTA 2YV5A 2SKDA 2ZI3A 4KIWA 1GUBA 4NOKA 2JVJA 3PGA1 3HXTA 4JB2A 4DV6B 3GF4A 2RHJA 3IUBA 2AJBA 4RPHA 2GH1A 5IZ4A 3PRKE 4YH1A 3KE9A 3EPRA 2G9QA 1K8QA 4M0KA 4YDSA 4PZAA 1N36B 4YLGA 3TX6A 3BCHA 3JAWA 3V6MA 1T9KA 2AQIA 1LLQA 1DE0A 2ERYA 2QOEA 3DF7A 4A36A 1IEQA 2NAFA 3RTAA 4MW9A 1D9ZA 1JS1X 1BS1A 4TXLA 5LQMA 1AUQA 4CLOB 3H3JA 1QJ4A 3GPBA 1OYOA 1CIVA 1YTLA 2DFDA 2NZ2A 4K28A 1U8XX 4RHYA 4UXJA 4X7RA 1M76A 1ZEJA 5LBUA 4AZSA 1XEWY 2ORWA 4HEA1 3FVQA 1OA0A 1G42A 4PNZA 1K5GA 3RVJA 5CU7A 4A03A 4UQLA 4EI2A 4NENA 4QRHA 1I4OA 4BZWA 3PDIB 1U9IA 3C15C 4HZUA 2VYQA 4P2GA 3WLPA 4DSZA 2AX4A 2YJNA 4AZWA 4HGRA 4AJNA 5EY5B 1RWKA 5HZMA 3QU5A 3OQNA 4NZOA 5J59A 5B7PA 4TKUB 5JWOA 1ODKA 3OOJA 2PTHA 4HZUB 4FE4A 1LV7A 2XQIA 1O97D 2ZK7A 5SYAA 1HRDA 3TIGA 4B4UA 4M7RA 4N5NA 3GIWA 3MMPA 1C1YA 4CL8A 3T6KA 5JS1A 5IN4A 1U2RA 1NVMB 1X38A 1FX1A 4CMKA 2FW6A 4MKIA 3VYRB 2EERA 4NI5A 1WB5A 1YB4A 5BRAA 2OHVA 1RVDA 1UZNA 3NYIA 4K2HA 3QTLA 4GKVA 4WZ6A 3WNZA 5A04A 5C37A 3KVVA 3HKCA 4JSYA 1M72A 3WLIA 1SXIA 3ELWA 5EMNA 2ZR0A 1UJMA 2POQX 2WV7A 4Z0PA 3T61A 1JHRA 2NNWB 3TR0A 2XQJA 4L57A 4PG5A 1CJTC 3WWZA 3RTBA 2RHCA 3JZIA 2BJWA 3QFCA 3F7OA 4ND1A 1YR8A 4UTVA 4A8JC 3HCCA 5JSZB 1P0PA 1KU6A 3HYLA 2DXIA 3S40A 4LKOA 3F7TA 2OPHA 1GP2A 3DTVA 4GYKA 5H02A 3OCCA 2NIPA 2PR2A 2VAMA 1Y1QA 4WLNA 4URVR 7ADHA 3EY9A 4C5BA 4EKDA 2ASEA 3GH1A 3OZGA 4ND7A 1NF2A 3KAJA 3RSOA 1ID8A 3NNSA 2JZNA 4REQA 5E6UB 5CB4B 2R2GA 3UAYA 4DLTA 2FFAA 2B92A 4G1CA 5CFZA 2GNPA 2W2PA 4L9AA 1V35A 3A1CA 1DGQA 1XJWA 5EXTA 2OXTA 1DT3A 4UVGA 5KWEA 3F4BA 1ZLXA 4NBKA 3VUFA 4EHJA 4M0MA 5ECGC 2VK8A 4MR7B 1OAKA 1H3FA 5EHGA 4AJIA 2GZMA 4IM7A 1UJ5A 3B9RA 1KMMA 3B6JA 4MWEA 3F97A 3H2SA 1N6RA 4P3NA 2B34A 1ZBQA 3ZV7A 6PFKA 1KEUA 3SE7A 3MN1A 2P0EA 4L08A 4LYDA 3Q3IA 3KE8A 2ZYUX 5AVJA 4EY6A 5BR8B 3KB6A 4Y2PA 5E9AA 4BLPA 3UBTA 1JSCA 2ZRCA 3EGEA 1E7MA 2XQGA 3MELA 4WXMA 4Z4FA 4PGGA 2O1SA 4YMLA 3HDTA 3WNVA 3GD7A 2FW0A 3GN1A 4CDMA 3HNOA 3UKOA 5GIOE 2PS3A 1YI8A 5A3RA 2O48X 4UMEA 3ZHYA 1RCFA 1V3VA 2P41A 2GEBA 2PY6A 2WMNB 3H5WA 4MYTA 1RHUA 4MAAA 5B3LA 3PQ6A 1LK5A 1P6XA 1M6EX 1RRFA 3EAGA 2C4WA 1GLNA 3TW8A 3W0LB 2I7XA 3ZIAD 2P3QA 1PJ3A 3TZHA 4AROA 3BFPA 2BEJA 1CQJB 4HB2A 1ODSA 3JQ6A 4WY5A 5FTWA 4N9WA 3LBYA 2CMKA 3N87A 2EF0A 3FI9A 1L9KA 1ONPA 1W88A 2LPMA 5BNWA 1B23P 1CUCA 1RM3A 2H31A 4P0TA 5HJ5A 1XMOB 2FR1A 4J0FA 3CINA 4Q82A 1L5LA 4CETA 4OGWA 3WL6A 1SR8A 1MHPA 4C0XA 1UEIA 3FDFA 4GYJA 4KRGA 1AU9A 5KX5F 1CRPA 1TQ2A 1KFJB 1XJ0A 2VDNB 1I1QB 3DEIA 4A3SA 4NYJR 1EXDA 3WGIA 1VM6A 5G0SA 4UE3S 2WJ3A 4GW3A 3ZXIA 4NE7A 4LXXA 2Q1YA 4DPLA 1DC8A 4LOKA 1XKXA 2C9ZA 2WYWA 2BN4A 4JVMA 1TT7A 3O26A 2FPLA 4DCVA 1JJVA 3DE7X 3TQIA 3WLRA 5C51B 3Q1LA 2DZDA 2WQ7A 2XDQA 2ZJ7A 2DUNA 3O03A 1JQEA 1Z33A 3GDFA 3ZYZA 4R0MA 5KNCH 1LU9A 2XKKA 3MGCA 1LPPA 3ZWNA 4BO0A 1VB5A 2RJ3A 1BWRA 2VNHA 1D6MA 5JVDA 2MR6A 4C7OA 3IHLA 4IEEA 1FSSA 1QGUB 3ZW9A 5CEJA 5HA5A 4E15A 3RAFC 1SIWA 2A57A 3G2OA 2FVXA 2ZI6A 3CF6R 4XYBA 1QRRA 3BJRA 3QKRA 2VP6A 4H3VA 1DXYA 1EFDN 4N6GA 4Z7NB 5G0VA 2HU5A 3CXRA 4FNMA 4K46A 2BGTA 2PN1A 3AUJB 3PU6A 4MDFA 3HP7A 3VTAA 1FXWF 2FZ4A 2QTNA 3I34X 3OJLA 3GJ0A 2O8CB 1GPH1 1UDAA 2D4AA 3GL9A 1XR3A 3QVGA 4HV4A 5LOVF 4LRSB 3OOWA 3V1TC 5BVHB 2AJLI 2H52A 4J0KA 1GPAA 3CE9A 3GROA 3UQZA 4GKJB 3O9VA 1UXJA 4C2TA 3QYAA 2B6HA 5CM9C 2A0KA 1TEHA 5F3RA 3UAZA 3IP6A 3Q5DA 3FTEA 2IY7A 2IV3A 2I6TA 4IIJF 3IBTA 1QFYA 4RD4A 2DCMA 5ALPA 3F5QA 3WZLA 2EATA 2WRZA 2QN3A 3K16A 1WTAA 1JRLA 2XT9A 4DUGD 3ER6A 2OCXA 2I7DA 3BTVA 2XVAA 1E1KA 3QUSA 4H08A 2O1EA 5HKAA 4L8WB 2HJSA 4TWRA 2QL9A 3L7OA 3AR9A 4HAYA 2X0JA 2JIRA 4PO3X 5BY2A 3QA3E 1L4HA 1OXTA 1K86A 5C8DA 2BFCA 1LVGA 1Z88A 1AXEA 1GFIA 2X0NA 3B1JA 2VJPA 4J7AA 4Q4LA 3EZYA 3G5LA 1O0SA 3THYA 1UAAA 4ZIRA 3WGLA 4C14A 5A7FA 2H4ZA 4TLAA 3SWWA 1ZKDA 4OKSA 1Z18A 1ENZA 4WEQA 4J03A 4UVHA 1PJ2A 3F74A 5JAOA 1N9KA 1V4NA 1UODA 4NY1A 4EYOA 4CKZA 1YS9A 4JQSA 4PFSA 3AVVA 2YIVX 5IZCA 1BMFA 2VJLA 4LSGA 1P7VA 1CQZA 1JU3A 1TPZA 5HF5A 3GT7A 2UXDB 4U6QA 3UV7A 1QCDA 2NO1A 3CLRD 1Z74A 2AYYA 2V7XA 2Q2WA 4LHVA 5JJKA 1KJ9A 3IT3A 5TQVA 3U13A 1XLVA 2WP8J 5D5HA 2E89A 4PCVA 5ES3A 4CTOA 2QJRA 1GRQA 3UYLA 3ZU5A 4ZOCA 1W44A 2D7JA 3G2NA 1YFLA 5KWIA 1HYHA 4RTMA 3CZ9A 2IUTA 4LCJA 1KI8A 4BVFA 3E1GA 3E9NA 3L84A 4MGEA 4LVNA 2BHSA 4R8LA 2ENWA 1CR0A 3OLYA 2PT6A 2QTFA 4HDCA 4PYMA 3UB4A 4EMBA 1PQUA 2ZJ6A 2N75A 2W9XA 3CEPB 1PBNA 2R4TA 5JXIA 1L4KA 4C4SA 1CHDA 1E1DA 2ZZMA 1O8BA 4XM0A 2YXPX 4RGVA 1T2DA 2E4AA 3I2HA 3AB7A 4G1VA 1XQ6A 1RRKA 3E61A 2A8YA 3HYSA 2P5UA 2VDOB 3LYHA 3OTIA 1NVTA 1SCUB 3A11A 1CW2B 1SA0B 3QOXA 2NM0A 3UT5B 4R1SA 1QRTA 4QOHA 2HLDD 4KW7A 3EY4A 1N2GA 1ZD1A 3QI7A 2C94A 3FHJA 5L4LA 1L7RA 1D6SA 1SCIA 3CE6A 1RZRA 4KE6A 1WM1A 2ZBFA 3ZCQA 2FUG6 3Q8LA 3QELB 1P44A 5EXDA 5F2OA 1VSQA 2BFDB 2VHVA 4DA9A 3NKFA 4S05A 2C5GA 1CR4A 4OL0A 5HKOA 1G6HA 3TTVA 4G1EB 3IUPA 1PCXA 2P91A 1E92A 4D6YA 1C9MA 3VHQA 2WWXA 2BR5A 2Q62A 2I4TA 1RWPA 2P2CA 3TR6A 1N0IA 4KR6A 1NATA 1ULZA 2VTKA 1L7QA 4CF6A 4JQCA 3LK7A 1RHQA 3S29A 3EVFA 5BP7A 3S70A 2A67A 3VNQA 3HKDB 3IURA 4B82A 1PS0A 4DIEA 3LI2A 4NG5A 2YZGA 3NHBA 2NP6A 3LL7A 1V25A 1WLSA 1CVIA 2J5KA 1MAWA 2YBEA 2QIOA 3O4FA 4GQAA 4C2AA 3KQNA 1FP4A 1BROA 3HVUA 1U7XA 1SXJB 5BQFA 5FULA 1TA9A 2WUGA 2FHSA 2YHUA 3L92A 5CA1F 1G21B 2IHZA 5CLHA 2UXBB 3DVAA 4U7JA 1OW3B 2H5LA 2HLHA 3BH6A 3BMOA 4WT7A 3V4VB 4YRJA 5DDIP 4BMCA 4COOA 5GGXA 3VISA 3IEVA 4KVFA 5K0LA 4GBGA 1XTBA 2QX6A 4JLUA 3LLVA 3ZVNA 2XNHA 3OTHA 4L8FA 4TS9A 3NGXA 4DMKA 5EWJA 2OEPA 1V9SA 4RJ2A 5LDDC 5EJMA 4B6FA 3NBAA 1DZIA 3RBXA 1SUAA 3SN6A 1RBMA 2FN4A 3ZW8A 1PL8A 1ML4A 2RJNA 3GA0A 2R2AA 5HF6A 3EQ8A 4OSOA 3FKSD 3O83A 4QYTA 2QL6A 3MAGA 5FPSA 1LY1A 1S8AA 3OKCA 4WK2B 1E6KA 2VJDA 1FNCA 1XXHE 5JIBA 3INYA 4C3OB 2IKQA 1PJBA 3CLSC 3QOFA 4OKIA 4FMDF 2I2CA 3KZXA 4JXKA 4MQFB 4R41A 5DX8A 4B5LA 5K99A 4LY6A 2OGSA 5LR6A 1HNZB 2I67A 3H0CA 1JGTA 4YS6A 5JANA 1VLLA 3CZ4A 2QQ0A 3PD7A 4HN4B 4OIFA 4PHHA 3AMVA 5BV0A 5JJCA 1IVYA 1C7RA 3TEFA 4LC0A 4N8SA 1O77A 3ANLA 5FBHA 5HE8A 1JIKA 4AM8A 4AVYA 5HDBB 3ROEA 1Z0JA 2NU7B 3T3PB 3GJQA 2WQ6A 3K6RA 4UUAA 3RTDA 3BSWA 3UH0A 3C1AA 2RE8A 4HPXB 1TAHA 1AHHA 1N8NA 3L1IA 2ROQA 1K7YA 3AIKA 5H3CA 4D0SA 3H5AA 2VTDA 2B4QA 4FCTA 3DLBA 2GBGA 2OQRA 4RK6A 2QRVA 2YHIA 2UZ1B 4JLMA 1Y37A 2WUWE 5HFAA 5I6DA 3AI7A 4QRDA 5E0KB 4EHAA 2ZR8A 2HA0A 4GUDA 1K06A 2WVAA 1J00A 1V6SA 1XOIA 1ZFNA 3G9TA 1TC2A 4G0VA 2O59A 3GRPA 4EBBA 1ZGHA 1KMHA 4XGNA 1BOFA 3GJSA 5KNCA 2EQAA 4KUHA 1N2SA 3OWOA 5GZ6A 1T1SA 2UYOA 1ZOSA 1GFSA 4MLCA 1Q77A 5K9ZA 5AHXA 1C7IA 2XTNA 4PM4A 1FX0B 3GPDG 1XQWA 2JIMA 1A7AA 3IMGA 2OFWA 1QRAA 1JLLA 2H65A 1RQ7A 2DFNA 3C43A 3H86A 4BMDA 1B00A 1ZMTA 1IXZA 1SAYA 3I3SR 3U80A 2BFOA 4B6QA 5IG2A 1WY5A 4HDKA 2G9RA 2HM7A 1GV1A 2RCNA 3OFJA 3CVUA 4UREA 4Y6OA 2XW6A 3TWOA 4DCUA 1C1HA 4XVHA 3LNCA 3T3NA 1JTVA 4PPNA 4TTVA 1XU9A 1HSOA 3OBBA 5K8LA 4LG1A 5TQ2B 1ATZA 3QLJA 4X3CA 3SJUA 3TE7A 3U7JA 3UK6A 4FHFA 3KAPA 4XUEA 1P0QA 3G0IA 4RHUA 2GSWA 4DGSA 2FDCA 2F1HA 1CRWG 2GK7A 5C7OO 1OHHD 5LB2A 3I4FA 5F2EA 1U0NA 1GZ3A 1Z29A 4N47A 4AYWA 4B44A 1R4ZA 2WI8A 2ZUSA 3KZCA 4BEBA 4YAUA 4DR2B 1SIOA 5I5EA 1VHTA 4CIYA 3KEGA 2TMKA 1DQRA 1XALA 3VYUB 4DPMA 1OREA 2IZ6A 4DFDA 1G4AE 1H5UA 1KI7A 4U5XA 4X00A 2ZSAA 3KC2A 5EWMA 2P9ZA 4KG7A 4MUFA 5CDFE 3OZSA 4YT2A 3PDIA 4M9RA 2EW2A 4RTSA 4DEXA 3O84A 3JZDA 1I0ZA 1T9DA 3VXKA 1JHDA 1QCYA 2OXRA 4H3HB 2OD2A 4ZAWA 1NX6A 3K72B 3ZW7A 1SGWA 4UBMA 3OQIB 5JS2A 2HY7A 1LDMA 13PKA 2P9HA 4R68A 2IKSA 3SD7A 4YP1A 2PS1A 2C2MA 1XZDA 3GUYA 4BYMA 2A33A 1GLVA 2DT5A 2FPXA 4WOBA 5ALSA 3ESZA 1WZ2A 1KEZA 2B20A 3K5IA 3NYWA 5LIPA 3PFFA 3ZBQA 1SUBA 5CX1A 4R1OA 2K2WA 4U9IS 4FFPA 5D7NA 2VBFA 2OXFA 2QM7A 2YN2A 3QPAA 2CCGA 2IT1A 3PXXA 4EPWA 3JVIA 1D2MA 1K6IA 5IWAB 4RA6B 1TMGE 5A02A 1NASA 2V7TA 1M83A 4V1CI 3NKLA 2OZLB 3M0EA 3ZLVA 1SELA 5ENVA 3OAAD 4YUXA 2GPNA 4FD2A 4J2HA 1UPXA 2VCEA 3GB9A 2AOUB 2ZI9A 4X95A 2LV8A 5E1OA 1NURA 2F90A 4CCAA 1Z35A 2JA1A 1AA9A 3K0CA 2O8NA 2ZVPX 3K96A 4KR0A 5A1TA 5BVHA 4OP1A 5I48A 2BMVA 3KIPA 4MW0A 4NH0A 1UBJS 5ALQA 2GEUA 3AR3A 3OE7A 4Y18A 5CJ2A 3C6QA 3GRVA 4Z0TA 1NYTA 5K0CA 5DH9A 1UJ6A 2X22A 1DELA 2RBKA 3DKVA 3GA5A 1WDLA 2A9JA 2OA0A 2WTBA 2ZETA 4UUNA 5BN3A 4IXWA 2Y3IA 5TR9A 1O54A 4EG1A 1COWD 1BVUA 5IN5A 2IYOA 1GHTA 3TW4A 3ZPXA 4NBLA 1U04A 1HOTA 2BMWA 3CEJA 1RYNA 4E5VA 1U7TA 1W4RA 1P1HA 1WVGA 2GR9A 3FSGD 3W6ZA 4C7KA 2R8EA 2VPTA 4AU1A 3WL8A 1JJAA 5A1JA 2REXB 1WE2A 1KH3A 2RBEA 3HB9A 4ZREA 3INRA 5AVSA 4Z4QA 2DECA 4GMGA 1O6CA 4MYCA 4R4JA 4A8TA 3VNRA 3FWHA 4G25A 1VOTA 5EE3A 5ES4B 3B7GA 4J2OA 1IG0A 5BWCA 1H8ED 1RRMA 2DY1A 4U9HS 3T7DA 2AVNA 2NG1A 1DADA 1PFGA 3K8OE 1XT6A 1PG2A 3H5LA 2VRCD 3LXMA 1XCBA 2PANA 2VLIA 4KEAA 4RCYA 4BBPA 4IG4A 3U7QA 1L5HB 4J0GA 1ACJA 1GA6A 4MW5A 5BN1A 2MR5A 1QB7A 1RJDA 1BU5A 1I14A 3IPXA 4KLZA 1OVMA 1KSJA 3ZCSA 1OI3A 4KQCA 4GLOA 3I92A 3QXJA 4BFTA 4EB8A 4P92A 3I9KA 4P34A 2IZZA 1NG9A 1G8MA 4R98A 2D6FA 5AI4A 4CKWA 2IHYA 2PYZA 1PL0A 5BT8A 4WK4B 4FLFA 3S0JA 4BGUA 2HMYB 2ECQA 1RI5A 3LKBA 1RZUA 4MGZR 2NYVA 4ATNA 2AOTA 1F5SA 3BMQA 2I33A 1K3FA 3PFCA 4CKWB 3FPBA 3A4VA 4D74A 4RK5A 3FTCA 2AMYA 1RZ3A 4RFSB 1IN4A 5DLQC 1Y5RA 1F2VA 2HLNA 4PYKA 1G8YA 1T25A 1IZ0A 2YJ5A 2GN1A 4R7ZA 3TUZC 5A2GA 3W5AA 4BECA 1DAMA 2BKLA 2IOQA 3EDQA 3QKSB 5A4MS 1JDTA 2D0OB 1OZAA 1N5MA 1IJFA 1H8EA 1A88A 4HLNA 2M6KA 5GJVC 4W1PA 5CHYA 4W1QA 4YY3B 5DYIA 3A9CA 2C20A 3L6DA 4WN3A 4XCVA 2YW2A 4WASA 4L07A 4TMFA 3AG6A 2PUJA 1YQUA 1DJPA 4DQ0A 4MVJG 3RIYA 4R9RA 1E79A 1C3EA 1QMPA 3KB1A 1UMDA 2ZRJA 4D8WA 1JDPA 1P4JA 2QRZA 4JX8A 2QU7A 4D6XA 2KX7A 3DL0A 3EAFA 1CX9B 2FI1A 3K15A 1P0CA 1N8TA 4LBYA 1TIKA 3PEWA 3X1WA 4RVGA 3EIHA 3NFYA 3SFZA 1W0JA 2VJNA 4B87A 5EP3A 2VTBB 5LLTA 1LVUA 3HKCB 4LYYA 1P5FA 1KERA 1V16A 2MT9A 4R05A 1CEEA 2B9VA 3K8ZA 3GOHA 1NZFA 2R97A 4CM9A 4F97A 2HWYA 4X60A 2WEKA 4G26A 3WKDA 1HNXB 3VKGA 4YXFA 4KKXB 4P4UA 4FZRA 4MKFA 4CMIA 1F9AA 1BCSB 1PF7E 4CKEA 3BDIA 3KUXA 4MUAA 1QU3A 1SFRA 2WIDA 2XYRA 3SC2B 1U2DA 2A5LA 5A4IS 5JALA 1Z07A 4Q7QA 1ZI6A 2QTTA 5FBVB 2MSLA 5EIXA 4J6FA 1BCRA 1YZLA 5JAQA 2I2DA 4ZCSA 3N8KA 3S2YA 1PR0A 3EIOA 4G56A 1X8KA 1NGSA 1JAIA 3A9WA 3FROA 7REQB 3THWB 4PLTA 2HU2A 2HZBA 3OCYA 1KIFA 3W8EA 3PC8A 1F2DA 4Y1EA 2JCBA 1N9GA 4DUYB 1VCOA 3RAJA 2QD1A 3N2ZB 4JP8A 3OIDA 4C4ZA 2C98A 3KTOA 3CN9A 4EYQA 3OC6A 3ISJA 1HDZA 4O4LB 1XF1A 5CDYA 2MTBA 1XRRA 3K1ZA 5LQDA 1S89A 5AK3A 3S8YA 1NF3A 1OYWA 1WV1A 4B4OA 1ISRA 4YCJA 4MUEA 1BXGA 2GK4A 3JQAD 1UPAA 2FQXA 3N0XA 2WWTA 1Q6YA 1UBHS 2Z98A 3NBXX 4L5AA 4LZZA 4Y6GB 2Y67A 4LGYA 3X2SA 5K8CA 2N46A 3EHDA 4G5XA 1KAQA 1NPDA 3AONB 5G3YA 2ZG6A 4C29A 1L1FA 4BNMA 4I1SA 3WWEA 3AUAA 1JQ5A 5DEIA 3ZUPA 1BMDA 3H7IA 4JMPA 5CIQA 3IS3A 1N6NA 4WESA 1K5HA 5D84A 4PZDA 3RAEC 1HE4A 1KRXA 4FX5A 1OILA 1Z5VA 2H2AA 2QG9A 3D7LA 1C4OA 1I4EB 4IJWA 4JBLA 3WG9A 5KOYA 1S2LA 1PUIA 3M49A 4Q9IA 4LHZA 4GMXA 1E9CA 4QATA 5B5SA 1YONA 3N0TA 3V00A 2JFQA 1KU0A 2I9KA 1EGVB 1NI5A 4HEHA 4HQ0A 1DCMA 3H5IA 1OFGA 1YAHA 3FMFA 4MGKR 4Y7DA 3RAPR 5EIWA 5BSRA 5TSDA 4A5SA 4DG9A 3ADCA 3STTA 4K8RB 4LK3A 3EQ6A 1KETA 5LZ8A 1U8YA 2ZYIA 3I58A 1D2HA 1HY3A 3P71T 4EKNB 3FCUB 1KEEB 1W5SA 4O3MA 1C4KA 2F62A 3GX1A 3OESA 3QLEA 2DVMA 4DABA 1O4WA 3A9TA 3P0JA 3PL5A 4HNVA 2QR2A 2H5JA 2I78A 5JJLA 1WHSB 4OLJA 5BWBA 4H0CA 2IITA 1ESNA 4HLQB 2Y71A 3MTIA 1XGKA 3ND8A 4D5GA 2H16A 5L40A 1Q7BA 3AUKA 4UHBA 2Z08A 1WEHA 3BDVA 3AF3A 3AO0B 3PITA 4JJ8A 4CCWA 1QF6A 1G3QA 2ADOA 1VYTA 4HUQB 4AZ3A 2IUEA 3FPAA 1CDEA 3RRXA 1BAPA 2C1ZA 1M1YE 1RSZA 1DUVG 3TKAA 4QOGA 4FZ3A 1IY0A 1L4FA 3LRXA 2F55A 4ZT3A 1XCJA 1NVGA 2ZIEA 5COBA 3EXAA 3EXHC 3KDSE 2FLWA 1A5ZA 1HGXA 2A1TR 1I9CA 3AINA 1QZZA 1XZKA 2OMKA 1CUVA 2JIBA 2JFFA 4UNIA 4AMBA 4MR9A 5JXJA 2IXEA 2JCXA 4MI6A 4Q3OA 2IUUA 4D9EA 3TDNA 1NM5A 1MO6A 1SN7A 2I4OA 4I9NA 3FZQA 3NUGA 3MCZA 3FOEC 1XYGA 4DILA 1EM8A 5LSAA 1LJLA 3C5EA 2WBLC 4XARA 4EW1A 4GNKA 3LOQA 4YIHA 3SJ7A 3CX7A 3TJMA 2VYNA 1KQFA 2QV0A 4P98A 2JL1A 3QLVC 3EZXA 3TLGB 3SJCA 4B3DA 4AX4A 3SX0A 3QW2A 4FNAA 1XZ8A 1I6MA 1L7AA 2EWWA 1CNFA 4ENPA 3PNLA 2H9AA 1FZQA 1TQ6A 3VSEA 4UDOA 5JCZA 1HM5A 2Q6TA 1GZSA 1I3LA 4FYYA 3UJPA 2O8FB 1ENOA 2TYSB 3W3ZB 4BGIA 5DVZA 3VJMA 1P7CA 2XGJA 4RQAA 1GPYA 3COZA 4YROA 5BVGB 1NIPA 4IQ4A 2FPGA 3HB0A 2K87A 2FG7C 3K9NA 1GN8A 3EULA 1SNYA 1FRNA 3TF5A 1M1XB 3JR3A 1NZDA 4TL9A 5T3UA 4UM9D 3F9IA 5AJWA 3AR7A 1X39A 2HQBA 1M34B 3PQEA 1R6TA 2XV1A 4QTZA 2EHJA 3LK6A 2P4EA 3Q7IA 3GG9A 2R60A 4E12A 4M46A 4MTCA 3UJ9A 1A4XA 3H9JA 3LBFA 1VPEA 5K51A 1D4OA 4ONEA 4FFRA 2W48A 3OOHA 2QNBA 1H2EA 1BE6A 3K31A 4OFZA 4RGBA 3IQFA 4RSHA 1IAVA 3MW8A 5B53A 3I64A 3JCZA 5EQTA 4YJDA 4KOEC 1CLUA 4UXIA 1T10A 3ZVMA 1KHTA 1QBKC 1GPJA 1XN1A 1IVNA 2RHMA 1EUCB 4DM3A 2OZKA 3HJUA 3LQ2A 3ZLBA 4XFJA 2ZYDA 4C5CA 3ECSA 4KO8A 4D0GA 3GBPA 1ECJA 2R5NA 3EGOA 3EA4A 3JD1A 3K32A 3O5AA 4E46A 5H3LA 4NZYA 1T35A 2V5UA 3BD9A 4G81A 1E9VA 2YFKA 3B6IA 4GX1A 1MZVA 1Z56C 1H6BA 3ZJYA 1V6CA 1WZEA 3U26A 4PWYA 1XTKA 5H3HA 4X1YA 1I4LD 2WAMA 2XHZA 2VDJA 1JV2B 3MD0A 5JAMA 1WVMA 3T9DA 1O6ZA 2ZSHA 4JKOA 1R0YA 2NSYA 3SBXA 1N0VC 2HWXA 5B4TA 1EUYA 3FXAA 3PFBA 1Z9BA 2DBRA 3N2GA 1HZZA 4OJYA 3ZTYA 2AOWA 3BJZA 4XQGA 4INAA 2GF9A 3K7EA 1GSAA 5AFSA 4BY9E 4S04A 1Y82A 3FZYA 1F6BA 4X1OA 1T24A 2HQSA 2JFOA 3RM3A 9ATCA 2WC1A 5DYWA 1G5FA 3EXG1 4RSRA 1L5SA 1XZBA 3KTFA 2OECA 1Y3BE 2W2XA 2WJJA 5HNKA 3R3YA 3AL0C 4FINA 2VQDA 3DFKA 1EX9A 3VH1A 1BKDR 2IA5A 4AKGA 1GZ7A 3ZHCA 3NT2A 1IQPA 1REQA 4IXMA 5BN5B 1I4TD 3F6BX 2VUUA 1OASA 2CLMB 3MIIA 4GI1A 4NZ9A 3VJRA 5G3ZA 3EXHB 4LYGA 2WA1A 2XH8A 1M5RA 3E27A 1JLMA 2Q3JA 2WQZA 2QQEA 4KQHA 5AUQA 4IKPA 4ZV9A 1YI1A 4XUCA 2C92A 1MV8A 1HLFA 1SUIA 5K0EA 4OI0A 2I1VB 3NEJA 1HYQA 4YCAA 3S7TA 4OQEA 3WYNA 4YMVA 5JI2E 4BQPA 3N6RA 2VH2A 2LCIA 4OH7A 4N8EA 2TMYA 2XCSB 3OIVA 1QYDA 4FGUA 4QUBA 2W58A 4F4HA 4OUDA 3OJOA 1N5JA 2C58A 4QXPA 5EZYA 3VZSA 4GQIA 1WKVA 3KOMA 1NBMA 4S35A 2A0YA 1DRJA 1DWQA 2RGYA 2W8BA 1NUHA 3OWXA 4UASA 4DV2B 4FSDA 1MAVA 1M0TA 2FSIA 2VK1A 2PL5A 1NSYA 1TZBA 1QQBA 3DB1A 4LZPA 4JWKA 1HYGA 4AP5A 3CCBA 4CQLB 2FEOA 4C4PA 3KHUA 2V74B 2AD1A 3EJWA 4I1PA 3OCJA 4FBLA 1SCQA 1VMKA 2P7HA 4H6WA 2OFXA 4M1MA 4Y3UA 1FU7A 3RVQA 1P2VA 1CRLA 3G13A 3MVEA 3P9QA 2CDAA 1GA1A 3OLQA 4CKBA 3BXFA 4PRZA 5KDDA 1JEAA 4EW3A 1P7YA 2V0NA 2JBAB 5A4AA 3U3JA 1I7QB 2HXSA 4W5RA 4GF5A 4YP9A 5TVGA 4ZIRB 1YXMA 2FG5A 3WO0A 3ZE0B 4TZ6A 5KX5B 2GQ0A 3R5HA 4LXYA 1GTRA 2XE4A 1A9ZA 5TMEA 4M1KA 4RVUA 3ROZA 4TLDA 4Y2VA 2X5KO 5C35A 4URXR 4FHEA 1Z15A 2IYNA 1UMCB 1ZVQA 2J7PA 2JFHA 1K75A 1X7ZB 2LKDA 3COYA 3GJZA 4MS4B 4OGFA 4PG8A 4AK9A 4B75A 5FTLA 5FUMA 5KSZA 5I7SA 1CJSA 1SUPA 1E96A 2DHCA 4HLUA 4UEJA 3ADBA 1GITA 5IM4A 1OWMA 4ZZIA 4DJJA 4ZVLA 3T15A 1X9IA 5IXSA 3MT0A 1MFPA 1JSXA 1KFEB 2J85A 4DQKA 1UEXC 4CG2A 3WFIA 4O4IA 1XAIA 4WBNA 3GVHA 4BRUA 1ICIA 2XGSA 4AY2A 1YRBA 3IBCA 3OJWA 4PZEA 8LDHA 3HFSA 5DN6D 3MTEA 3VR2A 1I24A 1RM4A 2FUNB 1EK6A 5AHRA 2LP4Y 3QI2A 4C7XA 1KO8A 1U4NA 2VYVA 3AVPA 1TO2E 4JC4A 1DG1G 1ADBA 4PZCA 2ACKA 3HRHA 4BQEA 2IZ7A 5G1OA 3T1NA 3RS5A 3DDNA 5JFGA 2VT3A 5J58A 4W9MC 2EL7A 2PXCA 3G8DA 1OT3A 4D42A 1NJFA 3ZBPA 3H75A 2CHGA 2QTLA 4M8KA 3P8ZA 3S4YA 1YZVA 1GVNB 3P2EA 4DYVA 5DCWA 2MMGA 2RJOA 4P84A 4EJ6A 5EKDA 4YXWD 3ICQB 3UZUA 2P4UA 3QMWA 5LQJA 1PR6A 1UBGA 2D3WA 5SZJA 4YR9A 3CZRA 5C80A 4JLVA 4NMMA 4BB5A 4DC0A 3SICE 4KMRA 3I9LA 4CMHA 5ADHA 5SZIA 2JHPA 1NBHA 3H17A 2NZYA 3GZTB 2QAJA 4G09A 4X6LA 3ZN2A 1Y1RA 4C6TB 3EIUA 4I66A 3VVCA 1UKYA 4ZOQI 3B7WA 3LCRA 3KQMA 1NQOA 1JB1A 2LVBA 5IVIA 5A3VA 5F7JA 1X7DA 2ZUVA 3PJGA 3VR2D 4TTSA 1RQRA 4UM9B 4LZAA 4Y98A 3VSAA 2EJUA 3RGGA 2H07A 2C84A 3I04A 4DMFA 3PQ5A 3T12A 4ADSG 4FM9A 4Q6BA 2FN9A 5CHEA 3IJEB 2NTEA 1EVQA 3FCOA 4D0LB 1K0UA 2J5RA 2PNFA 3NAQA 4IYRA 4MA0A 1EIWA 2IYVA 3LW8A 4OM7A 2YOHA 4GZMA 3TM5A 4YAOA 3ZE9A 1ZJWA 2WTNA 5DHUA 2PCJA 5LNK1 4YRQA 2AFRA 2A14A 3ZWYA 4NENB 4XYLA 1T29A 5AIBA 2I6FA 3TLZA 2D5BA 5TVKA 3SI7A 1IHDA 3PXUA 5BRNA 4AJJA 2P35A 3D4IA 4RPGA 1JE1A 4HS4A 3IO3A 1LWNA 1OFHA 1WB6A 4Q1DA 1Y3HA 4Z0HO 1IH8A 2JATA 4PZPA 2H17A 1F8UA 3INNA 1QHSA 3OZXA 1CVRA 3IT0A 4MH0R 1S8NA 5CT9A 1ZR2A 4KLNA 3HY3A 1TC1A 3GQBB 3KO8A 1PSWA 4FYJA 2OFFA 4Z4EA 4A16A 3KBBA 3NP7A 1OIXA 4EIWA 3V8BA 2QAGC 1JFVA 2LBPA 3R1IA 2XA9A 2HHJA 3A58B 1PHRA 4QZVA 5KTMA 5ALGA 4JLKA 5I8ZA 5TIIA 3IP5A 5TT1A 4LBVA 4LXGA 2AFIA 1MB0A 3CW2A 4X7BA 4BASA 3G17A 1MNQA 2IZ0A 4PLYA 5TPWA 3AVTA 3LGSA 1NFFA 1DBQA 2YXDA 3OY2A 4UEKA 1K7CA 2PVPA 2ZJ3A 1WPGA 2JHAA 3IX7A 4HGOA 4RF2A 5IUJC 3MJTA 1CR1A 3ROKA 1T8YA 4Z4CA 4FOSA 3EXFA 4ZO7A 5K3FA 2AZTA 1J1IA 1HDIA 1PQ4A 2VAPA 1TT5B 3TMKA 5CXQA 1G0OA 2A9OA 3QWFA 4BX9A 1L8OA 2RB5A 4KXVA 4AZ0B 2IYZA 2PRKA 3ZWPA 2HXYA 3DOFA 4X9XA 3UQYS 3NS7A 5BN4A 2X8JB 4W5NA 1NBOA 5HZHA 1PTKA 2AG5A 2ZYSA 5CVTA 5HTOA 1TKAA 1N2CA 2IU4A 3KNZA 2WMYA 1PYOA 3JYOA 2PMDA 2O9JA 4G0MA 3A6GA 1E32A 4ABYA 2GN0A 3NLLA 4K6CA 4PHGA 2GBPA 4AG6A 1WMBA 1CS4C 2BFEA 3ZHOA 1GZUA 1GCGA 3U19A 4MCJA 4P33A 3ZCRA 2PKWA 4F2DA 1EP9A 1N8KA 1PZFA 4I81A 4OHMA 3ZWCA 3ZNOA 1U7WA 1XXHB 1Z8FA 2JCGA 4IDNA 4BO8A 3DFUA 4ZVOA 3I9V6 1PWEA 5J23A 1TUIA 1K7XB 1D0VA 1MKYA 3OJCA 1U8ZA 4HUJA 3TMAA 4D9FA 3PNSA 3OFND 1QV6A 1H8HA 4X1KA 2F64A 3AXSA 1ZP6A 1BHO1 1JAHA 3DHWC 4PS1A 5E9JA 3OZWA 4BNVA 4ZGWA 1SQSA 2PQ2A 1KAHA 2CJPA 4QYIB 4TSKA 5BYKA 4E30A 3FMOB 4RAQA 1E58A 4W5HA 1BJTA 1FTNA 1R6VA 1T6XA 3C85A 3LSYA 4H4CA 4U6NA 5TGTA 1GQOA 1KH1A 2QUAA 1EYZA 1P31A 4AKIA 2Z1DA 3H1TA 1BMFD 3SPXA 3C4VA 3RUEA 4DLXA 2GKSA 4JB8A 3LQRA 3GFGA 4NNOA 1KA9H 3G49A 4E4TA 2RI0A 1YZFA 2C82A 4HKTA 4ALNA 1SXJE 5AKGA 1LWOA 1MOZA 1K08A 3KPJA 4OHCA 1ORIA 1M2WA 3LY7A 1MTZA 1EX7A 1XWWA 1K8ZB 2QYSA 4EW2A 1K9SA 2WIKA 3LNTA 3NYRA 5DNUA 3FI0A 4TVKA 2C4VA 2EL9A 3DUFB 1V6AA 5EIFA 3DE4X 1AA6A 1NYLA 1TF7A 2O0LA 5LZ5A 1U5BB 3JYLA 3QTBA 1NVUQ 4P35A 4IOLA 5KSOA 5LZ2A 3N7AA 2V6MA 1OTXA 4HFRA 5E4TA 1ZK2A 2CV0A 1IZYA 3VHXB 1JEDA 2SKCA 3BE8A 2OFPA 1OZFA 4GDFA 4RW0A 3P9PA 1ZMRA 2GZDA 5SV2A 3WFZA 3GGPA 1YBAA 5AM4A 1QK3A 3GUZA 1TM5E 4DM4A 1SCJA 3HKEA 4JJ6A 5J5CA 3NHZA 3VOTA 1UP4A 3PENA 4Y0VA 3PXCX 1G6OA 4WIAA 3DZIA 2H9IA 2ZB7A 5DLEA 5A62A 4UBOA 4FC6A 5FCDA 1NI4B 2B7BA 3GG2A 3KFVA 1Z8NA 5CVCA 1PUXA 1TJPB 2GVNA 2R6ZA 3U7IA 2ZQZA 3P9IA 4ZVUA 4ECAA 1G55A 4KV7A 4RKRA 1M6VB 5AVTA 2PSFA 4QDKA 2RGAA 1ZCFA 3OWHA 4AJ9A 3R5JA 4ZZ3A 4P31A 3DB2A 5B6IA 1TM2A 2FETA 1M1UA 1GGMA 1TYCA 2VF5X 3BWEA 1OX5A 4F9EA 1U3DA 1XI2A 1BRTA 2VDQB 1PGJA 3ZK9A 5IWCA 1EFPB 4NMXB 5J2UA 1CC1S 3V46A 3TXAA 4TTQA 3ZWXA 4N7JA 3SXPA 2BTEA 4YJ2B 5L3QB 1WU8A 1I33A 2VPWA 3H7AA 2DFTA 1GN9A 2C0PA 1BRMA 1T8UA 3B1XA 2AEFA 3HPRA 2JGEA 4HDMA 4LQCA 1JQ3A 4OVKA 3U1VA 1HLPA 3D7SA 1CY7A 2G04A 5IUKC 2WF5A 5M2QA 1J25A 2A0WA 1JXMA 1MLDA 1FYFA 3DL7A 5EFZA 3RT9A 5HWSA 2WFLA 1UJBA 3DCYA 3FHLA 3PZRA 2IYPA 4AT1A 3NVDA 3WDMA 4GOXA 5D85A 1DEKA 1QK4A 1SG6A 1GPLA 4G8DA 5BNFA 4QTYA 1U1EA 3AEYA 3FTPA 4JP2A 3HDYA 4JT8A 3TZ6A 3P4XA 2CUZA 3FWYA 4S0ZA 3IQEA 4JVSB 3E5NA 5AI0A 2FWJA 1FS4A 4AY4A 3AFIA 3SYRA 3LCVB 2XE8A 3AI2A 2XTAA 1GNPA 3LJKA 1G4HA 5BN3B 4AY6A 4MV4A 5IBQA 1M2JA 4DV7B 5EMKA 2AZMA 5T8KA 4DAOA 2OLEA 1NVEA 1J8YF 2HWKA 3T5TA 1V0JA 5HUJA 1WUJS 3CTPA 3ZR4B 3I76A 5JLAA 2D5AA 2HFKA 2BAGA 2HWWA 5LC1A 3K9HA 4UE6A 1N9GB 4Y67A 3TSZA 1P1CA 1M2EA 1ONSA 3I5UA 5FAXA 5C8YF 2DWCA 5T4HA 1DO8A 3OIFA 1M6WA 1NPTO 5FUVA 3B1WA 3O2JA 4FTWA 2Q0SA 5F73A 3RYCA 1H2ZA 1X3SA 1EWKA 1K4YA 3MWJA 4CTKA 1ZN8A 4JI0B 1C2YA 3MHTA 3MMXA 4X3OA 1NQVA 2Q1SA 2WOJA 3DDCA 3HI6A 2ZWMA 4PONA 1DKRA 1I0LA 5CFPA 2PS0A 4RJLA 4H6PA 5BT9A 1P74A 4MUKA 1ZVJA 4KPUB 4ZI7A 3BILA 1OOEA 1L5KA 2V6FA 1R5OA 3W05A 4YCNA 2I3AA 3C6YA 4UZEA 3FIJA 2BHTA 1OFVA 2R8XA 2ZR9A 4KE8A 3VZCA 4LJ4A 3A3YA 1XU7A 4MDYA 1TE2A 1O0CA 4M9SA 4JL5A 2JAHA 5KWVA 5DK6A 3SG0A 1NUTA 2XMSA 1FCJA 2X13A 3GXOA 5DRYA 2FWPA 5IH3A 2PGJA 3TQRA 1CY0A 2CHVA 3D4BA 3JQAA 5JW6A 2CBXA 1E2HA 2QLBA 5FPTA 1UK7A 2IXDA 4V2IA 3UWMA 1Y6QA 4PWZA 2XTJA 3JWJA 3CNHA 1U98A 5FBKA 3R7FA 4M0LA 2ZRFA 3TLJA 2O8EA 4F4JA 1I7DA 3SQWA 3DTYA 3CZQA 3OQHA 2H4XA 1NW6A 4PSCA 4V03A 2ETXA 5HOEA 3R9XA 3WQBA 4JODA 2VDWB 4PX9A 3WJ1A 3KB8A 4NCAA 3BSYA 3CF2A 5C8XA 2ZAMA 2C9CA 3MLAA 4JC0A 1YC2A 5I4BA 2AD5A 1JBQA 5DHTA 1B8VA 2Q5JA 2WHPB 1BX1A 3PXEA 3PQCA 2GM9A 4PHFA 3O7MA 5C5DA 3EMDA 3N8NA 2GF0A 1J70A 4FMDB 1DARA 2CNNA 1JKIA 3BKXA 3IOMA 4IDDA 4EVRA 4FI3C 2C3OA 2ZVJA 2CKMA 3GQBA 3IBSA 3DHVA 1OBCA 1VMAA 1DIBA 4KWEA 1R4NB 2VWQA 3HB4X 4Q4JB 3Q5EA 3WGJA 4X6UA 2CE7A 4PC7A 1QIKA 5LMCA 3RVKA 4PFKA 1KMQA 3ANNA 1KI9A 5GP1A 2PRIA 2ANCA 2GAOA 1S02A 2PGNA 1YSCA 2GETA 3K09A 4P4SA 4KXQA 4G0ZA 4BMXA 3I39X 4WGGA 4RWEA 4YV7A 3BJIC 2D2VA 2GYVA 3WL5A 2JJYA 2ILTA 4PYOA 5CLLA 3UUEA 5K3OA 1H05A 2FPPB 1DLJA 2QTHA 3HRIA 1H2XA 3LG2A 3M6MD 4I9UA 2QYOA 3W6UA 4RIIA 5BSGA 4IR7A 2XVYA 4BMVA 3RREA 1TT5A 3HCWA 2PMEA 5KYTA 4R8KA 4LMBA 2UUAB 1T3GA 4YPVA 5FNZA 3AU8A 2IY8A 4MVJD 4R01A 4QBFA 2P5YA 4BO4A 4DMGA 3WB2A 3AF0A 3UMJA 4RIGA 1N0UA 3KL2A 4TYQA 3WISA 4JI2B 4ENUA 2WLTA 3DEKA 1HL3A 3WSVA 4I5DA 3QSYA 4Y2TA 2Y1LA 4OOEA 4MRMA 1YZGA 4URHA 1C5KA 3QKTA 4ARBA 1TRHA 5IMBA 1QAQA 2PKQP 3TW6A 1VTKA 1X2BA 3OX1A 1CHNA 3P0HA 4HGZA 2RG7A 2J9FB 4QULA 3BIXA 4O4LA 2OMEA 3DP9A 3RIHA 4C2BA 3ESRA 3AT1A 2VYND 2VT7A 5JAZA 4RD0A 2JJ1D 1UT6A 1M10A 2JJ8A 5F4BA 5CURA 1PVOA 3DT8A 4KAXA 5HW0A 2C8VA 2X9LA 4E22A 3ZWDA 3AL3A 1QGZA 4QQNA 2HLPA 4FFBA 4FBMA 2PJRA 4BJ1A 2QMZA 3PHCA 1H0SA 2ECPA 2J9GA 1O2DA 2Y93A 4NKRA 4HNGA 5WRFA 4RLSA 2QVYX 3UAXA 3ZWMA 3EWNA 4C1BA 5JBNA 1RKVA 1RXCA 2XUKA 3WHPA 4BPRA 2X4IA 3KSMA 1GUAA 4ZQCB 3Q3EA 3QE2A 3B12A 3EHEA 1R66A 1XHEA 2I0FA 4BE9A 5I7AA 2GD6A 2PGIA 3IKJA 4X66B 2QM0A 4WBNB 2P11A 3QVVA 4KZPA 1C8VB 4JJFA 4X64B 1J39A 1B16A 3ODPA 1O95D 5AUPB 3HC7A 4WNYA 3ASZA 4IHQA 1E4EA 4MKGA 2UYGA 3V8VA 1PN3A 4YJGB 1OA1A 2J8ZA 1YZNA 4RADA 2VQ3A 1OH7A 2HTEA 1PG0A 3RPEA 4BTVA 4P58A 1WX1A 5NLLA 1CUAA 5BV8A 5LQAA 4J4BA 3AP1A 5BYBA 3U9TA 5A71A 4FSHA 1DMRA 2V65A 5FPHA 2Z2YA 2VNAA 3ZWKA 2D06A 1R7RA 1X15A 2DWPA 3EA5A 5SYMA 3DOUA 2YJTD 3R5TA 4DIOA 3GFVA 1P5ZB 1Z26A 1QHFA 3T1OA 5JZSA 1U3FA 1JXAA 2H57A 2B7LA 4O4JB 2YJZA 5BUZA 1TLLA 2VCYA 3LBNA 3N05A 1Q57A 1HDCA 2ZUCA 2FZGA 1GQRA 1ZGAA 3AWIA 1KDVA 3JRWA 3U9LA 3L6BA 3BPSA 2ZYVX 1Z4QA 1ZI8A 1PSZA 2ZJ5A 4LPKA 4U3JA 3PUYA 3TSOA 1UADA 1DUSA 3JWEA 1QHEA 4I0WB 1NXSA 4MWBA 4R8MA 2AI3A 3STUA 4PZYA 4AFNA 5CFQA 3JTMA 2VQFB 4M1TA 4OM8A 4WQMA 3L8DA 4PBTA 1Q15A 3ESBA 2NTNA 1UM9A 1GKLA 2CF5A 1SURA 2P69A 4E08A 1HQCA 3N5KA 4QQKA 1I3OA 4BO7A 1NI3A 3DKPA 3PFKA 3WP0A 5ALVA 2ODWA 5FUQA 1TYZA 2WNHA 3JZFA 3RT7A 3SQNA 3HZRA 3TUJC 3U31A 2X7JA 4RDHA 3W2HA 4FMPA 2HCRA 5F21A 2WUDA 1T9GR 4BXOA 1OKKA 1JYSA 2X4LA 3A1WA 1PR5A 3KQTA 3QEKA 1LZKA 3HU3A 3FUTA 2DFPA 2EKDA 3MJVA 2YIMA 1KOFA 3AILA 1Y3CE 3K4HA 3MCWA 5B1IA 4HAZA 4U7TB 3U48A 3PFGA 1H1LA 5TQ2A 5BW5A 2DQKA 3EEOA 3VOSA 2B2CA 4HLUC 3AM4A 4QHTA 1EQAA 3B3FA 3FIUA 4DWOA 9GPBA 4HRAA 1NOIA 1VRCA 4FDAA 1UWKA 3PEUA 4QYXA 2PUFA 2CLEB 2Z6AA 1Q91A 4BVKA 4CR7A 4R83A 3VGJA 3FPEA 5EJAA 3UWKA 2BTQB 4HLDA 5JRDS 1ZVVA 4PAWA 1RZVA 1Z47A 1E99A 1MEJA 1U3WA 2AUTA 4F96A 4D8UA 4TT8A 1KIAA 1UT5A 2D1QA 2ID9A 4DIMA 1MXFA 1VKNA 3MSCA 5MHTA 2C2BA 5CT4A 3TZKA 4CUZA 2WKPA 1DOZA 1ZM3A 2JAOA 1BYUA 4BKQA 2O2EA 1V3QE 1ZZEA 2R8OA 4MV3A 5FQOA 2VJCA 4JCOA 4PZ0A 3WKAA 3GPCA 2JGLA 2JLAA 2OM6A 4PQRA 2WJVA 4UHEA 3HJBA 4KI0A 4EUSA 3Q3GE 3COVA 3V3KA 1W85B 1Z5PA 3KD2A 4GNRA 5JD6A 1GG8A 3H4MA 3VKWA 4BVEA 3JASB 4HDSB 4KBFA 3L9WA 3T3MB 3WP1B 2Z6QA 3SHFA 3O2QB 4TQAA 1W5EA 2PZFA 4FEGA 2Q3EA 1FDUA 3PF9A 3UNXA 4HDMB 3LP5A 2C2YA 4NSNA 4PZ9A 3WA7A 2ZULA 3I5AA 4LZJA 3I8SA 3LO5A 1FDVA 3EEQA 3L1JA 3EGVA 4CDGA 3NAGA 1T9GS 3F8WA 1OH5A 4HY3A 2FPWA 3BH0A 3K1TA 3MLEA 2IS6A 2A3NA 2WHEA 2C4UA 1SVUA 3R3VA 1BC5A 4QQ8A 3RQIA 4D3SA 4Z1MD 1DVRA 5LXTB 3DZDA 2TRSB 1CZOA 2NQTA 3AY7A 2CJYA 1G3MA 2BLNA 1GU0A 4N82A 4W6ZA 1U65A 3D7NA 4H6VA 4XSGA 2RGXA 5H0IA 3WDLA 2O3TA 4AY3A 1USKA 3PDUA 3UCEA 5JU6A 3JD2A 1M6YA 1ZIXA 2EZUA 2PJUA 3FBGA 5K6AA 1VIAA 2DP4E 1ST3A 4Z9BA 4IXNA 4PZZA 2ZBEA 4G85A 5A5EA 1NMEA 2XQVA 2O8DA 4ESVA 3NXSA 1XD2B 5HK9A 1X9HA 1KO4A 2G6BA 2JZCA 3PUWA 4ML3A 4DEVA 2NT4A 3FZNA 3IP7A 5DM60 2B7CA 3DYIA 4FS3A 3Q7EA 4PIPA 1UPBA 4B9EA 4D4KA 2BKVA 2JLCA 4RHFA 4FX2A 3WLEA 1KJIA 2DOKA 1JX6A 1A9RA 1KDTA 5EPOA 1JPUA 2AF4C 3W78A 3U39A 4N0PA 1VPWA 621PA 2IDKA 2V3VA 4ZVRA 3JYHA 5K0NA 1E3DA 4HTAA 5K2OA 4JBWA 2FUEA 1DTWA 4IHKA 4Q37A 3S2ZA 1CRQA 1T2AA 3FNGA 4BJHB 1XEWX 1F4PA 1CKEA 3C8DA 1EK0A 4M38A 4TUYF 4YMTA 2OYSA 1V5IA 3L6EA 3MXTA 1RHJA 3RV4A 2VJYA 3S27A 2HUNA 1E9SA 3RH0A 4GL4A 3FRIA 1R27A 1YMVA 4ZPXA 1H94A 2MDTA 4D92A 1JAYA 5K8UA 5BPFA 2SNIE 3DL2A 4GX5A 3B5JA 1UPUA 5K8VA 4WN9A 1GAQA 5F5NA 1RQLA 1S01A 1TO6A 1V2GA 3SZ3A 5HX7A 1AO0A 3OCWA 3ZY2A 3C8ZA 1MN6A 1ZQ1A 5TEWA 3DM5A 2BKXA 4I1RA 3E0XA 2JJ2D 1BVRA 1EG2A 2J6BA 2WYUA 3C3AA 4P81A 5JPIA 1E3WB 2VNKA 2OG2A 3IEXA 1YVEI 4DA8A 3ICWA 4B7XA 3QKSA 3PUVA 3EVAA 1GNQA 1IQ0A 4YJ3F 4P4TA 4QUKA 1FXSA 2WD9A 1SXJC 4OYYA 3TM4A 2AMVA 3BTUA 3FDJA 2FCRA 3A2MA 3GNSA 4NWIA 1G8FA 1LTHR 3O4HA 1G66A 5CMLA 5SZKB 5JSFA 1XFDA 3LX5A 3TLKA 4QEDA 4Y9RA 3ZWQA 2VDWA 2XWSA 4IPTA 4V0LA 2GPJA 1T34A 1HNWB 2WJAA 1RPNA 3VOAA 5D6OA 3ZE7A 2I1QA 2PX5A 4FOLA 2COUA 2H1VA 3KHTA 5TXGA 2CNKA 3RUCA 1EB8A 4GGOA 4BDSA 3E3AA 2OZPA 4YMWA 3G8AA 4FJ1A 4KOAA 5HSGA 5KQGA 1QIGA 1HYBA 4EGCB 3CF4G 1AC5A 4D6PA 1XFAA 1Q3TA 4ENWA 4L6CA 4DUPA 2V3CC 3EXIB 1ZEMA 2JGMA 2QJOA 3V55A 1YQDA 3K0KA 4E4YA 3R8XA 3SF8A 3T94A 1PP4A 4EWLA 4IZ6A 4DSUA 2A0XA 2UYQA 2C42A 3LT2A 4MQBA 3PVZA 1U0LA 2D54A 5DBIA 5DGHA 1PK7A 2R7MA 1DRVA 1Z6QA 4XB2A 1PU2A 1ONOA 4IJKA 4OHFA 2G5CA 2DHDA 4LQLA 3TD9A 4S24A 4Q48A 1Y6RA 1PR1A 4I6EA 5CFLA 4O1IA 2FPPA 3B1VA 5EYPA 1N32B 2GHRA 2XMBA 3IHTA 4X6XA 1EP3B 3BX1A 4F4FA 2WU4A 4HYYA 4R0VA 3GD5A 5HZKA 1X9GA 3H9EO 4GAEA 4RV9A 3K6KA 3KAKA 4WX2B 4ACAA 2OCAA 1U28C 4BLRA 4IMIB 1E62A 1QIMA 2BISA 3VAAA 4AKSA 5K0BA 2H85A 2AJ8A 1ZESA 2GPTA 3GEGA 1ZOPA 1WSBA 3DFMA 4JA0A 5IJXA 2G0AA 5A3QA 3AGPA 2V7VA 2JLVA 2WHQA 2L82A 3T3IA 1Y7TA 3OF3A 1PG5A 5CCBA 5I9LA 4DLYA 1KAGA 4GI5A 5DIZA 3SYNA 3GZNA 3WS7A 4QUAA 2XBMA 2YTZA 3H13A 3QLUC 4CM8A 3WGVA 1ZJ4A 2IHUA 2OGZA 2ETVA 4OAOA 1E89A 2GMWA 3UPDA 3DHYA 1TYDE 3ESCA 4IL5A 4XE5A 4IILA 4OREX 3KYIB 1QO0A 3OT4A 4MUIA 5I9IA 3PLAE 1RBYA 4WCFB 2YQZA 2OCKA 3H5RA 4ZCMA 5A9SB 3GJ6A 3QXHA 1EWTA 2GO7A 5IAGA 3MTQA 4GH5A 4W82A 3ZE1B 4KP7A 4NHOA 4MI1A 4UUBA 4BYGA 5I7UA 1WW2A 2FMIA 1Z68A 2B2XA 3DULA 3FKQA 3RYFB 3I62A 4IXDA 2B36A 2OAGA 2E5LB 4ROSA 4DBLC 1PEKE 2B8JA 1SXHA 2HPZA 1M5TA 1GNTA 2Y1EA 5CLGA 3RKRA 4EG7A 1H1TA 1H5NA 1PS9A 1CUYA 4EZBA 5K09A 3K0FB 4YYEA 2WWGA 4A2WA 2JEZA 2FX3A 4QTUB 4BFLA 2ZAOA 2V4ZA 4TXJA 5B3KA 3VX3A 1I6LA 1QJCA 2PIAA 5MN5A 2JJQA 2OBMA 2WTXA 4DV0B 1UPCA 2HR1A 4GKKB 1Q7CA 3QXCA 2IDMA 5LOVA 3LPAA 3SHQA 4OX9B 3ZDRA 1KZ4A 3A36A 3A2NA 4DIBA 1BWPA 2HGSA 5LL6P 1FU8A 4DR4B 3TO5A 1Z2NX 4Z7OB 1ZINA 3ICPA 3NH9A 3R7AA 3TDKA 3PUIA 1NMQA 1U2TA 2CFTA 1XEXA 3STVA 4KGVA 4Y2XA 5CG1A 3KLMX 4Y2YA 4FOOA 1GTJ1 4RSMA 1M1YB 2HH9A 4TLBA 4D56A 4X85A 4LJYA 4I4CA 4FYPA 3PPXA 1VI5A 3ZWAA 2PD3A 1ETHA 1BEZA 4IGFA 4UQOA 5LA6F 1TK3A 1QAOA 5CA0B 3LWNA 2FRXA 1L2TA 2QLFA 3K2QA 4CRWB 6GPBA 3GLTA 3Q10A 2QN1A 3CLKA 2WJ4A 4KHZA 4Y2RA 1YIAA 5A5DA 1Z6GA 3VR6D 3NHKA 4TQ9A 5K1ZA 3UUGA 5H16A 5JCXA 4IX9A 4M76B 3GT3A 4AJOA 2G09A 2QPOA 1E2KA 2XLBA 3UC5A 4KR2A 2ZE6A 3QVXA 3U0BA 1WL8A 4EB6A 3K5PA 2G83A 3NHSA 4B6PA 2XMZA 5IDWA 2I2XB 2GN2A 3F98A 2O5EA 3RVPA 4NOMA 1YACA 3DD1A 4RVCA 2FHPA 3VKHA 2PG3A 1CXZA 3U6BA 1AS2A 2BGRA 3ZU2A 5JZMA 2AF3C 3X43A 2BKAA 5E2IA 5F78A 1H6CA 1YS1X 4XR4A 1CT9A 3SC4A 4JZYA 1O4VA 1XO1A 1Y8QA 3HUEA 1ST2A 1HG0A 4FFNA 4INZA 4ZQBA 1SEVA 2ODTX 3A4TA 3RTCA 2YS6A 1POWA 1FNSA 1Y4ZA 2FPGB 4I1IA 1CV2A 5C3MA 4N01A 3JD3A 1MGOA 4MRMB 5C2JB 1P2DA 1ZMBA 4I6JA 4Z7QB 1U7PA 4OMCA 4BE4A 3TNYA 1UBTS 3SY8A 1CUWA 4I8XA 4ZAZA 4C0WA 5F12A 3CRVA 1HFEL 1AH2A 1QHYA 3WYCA 1NJ8A 3FGNA 3MTBA 4KQFA 4BNDB 4BLWA 1R64A 4K0KB 5IEBA 3I9JA 3RSHA 3NT5A 2ZTSA 1VMIA 2ANBA 4NBTA 3FNFA 3WGGA 1AJEA 1WSAA 4LF6B 3HBJA 3UHFA 3PJRA 1PKEA 3AEQB 3BGSA 2RGCA 3CSUA 1PO7A 4G89A 4K03A 1QUFA 3OKAA 1PEDA 5AMXA 2NT3A 3SYTA 3L8YA 2PU5A 3EIQA 1KVTA 3PX2A 4KNVA 1E94E 4XM1A 3FD8A 1QYWA 2OBXA 1AUVA 3DZBA 3H3FA 2ZJOA 4YVFA 3FHOA 5DBGA 2ZS7A 3DE3X 2DERA 2QJFA 3SCZA 3MT7A 2F43A 5KU7A 1Z7WA 2ZQ5A 2NU7A 3ZHBA 6LDHA 4DKXA 2BFEB 5M7EA 1KP3A 4D99A 4BNIA 2EF1A 4WZBE 3NAMA 1SUEA 4EF5A 3R6LA 1KQOA 4QSMA 2OFOA 3NAZA 4MQEB 3DCJA 3PC7A 1SB9A 2PAFA 4TKMA 3HUDA 3AI3A 3A1FA 4ND4A 2QMOA 4PAOA 1TKBA 4AKTA 1UK8A 2RKWA 3BHIA 3AR5A 3PKJA 2BM0A 1YR7A 3BA6A 3VDRA 1PZHA 3TQTA 5ABPA 1CRZA 1A9QA 1CY6A 4Z4HA 1B42A 4MV7A 5D3KA 1JECA 5AI8A 1GKIA 2J07A 1T9AA 1K7FB 1RXIA 3FYUB 1K4MA 4TMWA 1AQIA 2HNAA 4TT3D 3ZWBA 3Q98A 3CSSA 2NXCA 4BNUA 1J0DA 1IJKA 1VE6A 4R8RA 3VR1A 1R74A 2PDAA 3GFTA 3LVBA 4LJ6A 4Q05A 3TB6A 3QITA 4XWGA 1IN6A 2DU8A 4U39A 4OBEA 4ZT6A 3ORHA 1TM7E 3RFFA 2OO3A 3FF4A 3R5KA 4JLAA 5KYWA 1B6TA 5JYDA