4Z49A

Homo sapiens fatty acid synthetase, thioesterase domain at 1.7 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
262
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Estimation of Hydrogen-Exchange Protection Factors from MD Simulation Based on Amide Hydrogen Bonding Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fatty acid synthase
total genus 95
structure length 262
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 4z49A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z49A01
4AMYA 2Y6UA 4OYYA 1P0IA 1Y7HA 4YX9A 1SOMA 4G8DA 1U8EA 3C8HA 3CXUA 1JJBA 1AUOA 1XRLA 5E4TA 2QM0A 1THTA 1JU4A 4DNPA 3R3WA 4KJXA 1JJIA 3G8YA 1LBSA 1CUCA 1WM1A 1YAJA 3G0CA 3LLCA 5HF8A 4MQLA 2ZYRA 2JIDA 4BCCA 4Y2RA 5ALNA 4ZREA 5EHNA 5AKHA 3I1IA 4HRYA 1XZMA 5HK8A 4S0XA 4WJLA 4UHEA 1QLWA 5SYMA 1VXOA 3N0TA 2WUEA 4QDUA 3ICWA 2HFKA 4Q82A 1R3DA 5ALZA 1TCBA 1EDEA 1L7QA 4OSEA 1NU8A 3I6ZA 4Y2QA 1UK9A 5ALOA 1QIDA 5KWJA 1XZAA 1MO2A 1TIBA 1MPXA 1QOZA 4F0JA 4BDTA 4LKOA 2ZVDA 2YH2A 3IURA 1EH5A 4B81A 2I78A 1BCRA 2IITA 5AM2A 2G5PA 1XRRA 4INZA 2WFMA 3A2MA 3I28A 1K5PA 4BC1A 1CVLA 4J0CA 2Y2UA 1QIEA 3K6KA 1HPLA 3FYUA 4ZXFA 4X91A 3BDVA 2ZYSA 2XQKA 1FSSA 1UFOA 3KWJA 3OOSA 1NX9A 5IKXA 4PNZA 1R9MA 3DKRA 3IUNA 2XDWA 2XI4A 5D3ZA 2JF0A 4C6HA 2JEYA 3F8SA 1LPMA 3CCBA 1QIIA 4DNOA 2H7CA 4BZWA 2H7XA 3DQZA 3KD2A 5KBYA 2B20A 4BC0A 5A7GA 3C6XA 2Y1KA 3YASA 4E11A 1EA5A 4DLNA 3ESBA 4H7JA 5C7YA 3QH4A 3HJUA 1WB5A 4B82A 1KU0A 1DWQA 5ALEA 4AX4A 3STWA 1J06A 2H7YA 3OM8A 2ZJFA 2OCIA 1E89A 3H2KA 3KSRA 2ZYIA 1C7JA 2PSDA 3G0DA 5A6VA 4HXGA 3F67A 1GKKA 3A70A 4MYSA 4P93A 2C7BA 5HCUA 2OXEA 3WYDA 2W22A 3I2JA 3F9CA 5JADA 3FLBA 1MTZA 3DL7A 1ODSA 1SC9A 3I2IA 4KAJA 3WL5A 4DMKA 2WG0A 4M0FA 4PSCA 4HZGA 5DWDA 1XQVA 3R3XA 1QO7A 1MX1A 3AIOA 5CT9A 1E8DA 3WWDA 4P9NA 3E4DA 5DTJA 5A7FA 2XUPA 4J0IA 3BL8A 4BBZA 1KEZA 5BOVA 1XFDA 1EI9A 3RARA 3OURA 3DNMA 4YK7A 3GFFA 1TAHA 2HA5A 4KAAA 3HEAA 1DWOA 1YCDA 4Z49A 4AO7A 2BUBA 4H7DA 3EQ7A 5ALXA 4LIPD 4U2EA 4X94A 5A2GA 4IHAA 4A16A 4J0GA 1AZWA 4QDXA 4Y2JA 3IBTA 2GBFA 4WY8A 1XZEA 3X3HA 4JYMA 1USWA 1GKLA 2WFLB 2CMFA 1XROA 4K5QA 3DL4A 2OPHA 3OC0A 4ETWA 5DTIA 1XZBA 3SK0A 3B5EA 1QIFA 3DLTA 4X95A 5K3FA 4MJ3A 2BFNA 2G63A 3M82A 3AZPA 1QIHA 1XZIA 1UOOA 3WWOA 4JH0A 4B6GA 3O95A 3SWWA 3KOOA 3I6MA 1MAHA 3V1MA 4KRYA 1JJFA 4N8EA 3T52A 4ZI5A 1X70A 2HA0A 1QZ3A 1CRLA 3R41A 4Y2XA 3ICVA 4L0CA 1EHYA 5DYWA 3TGLA 1AKNA 2C5GA 4Q34A 1GQSA 3FOBA 3IUMA 4G4JA 4FOLA 5JARA 4EY8A 3FYUB 4MEBA 4MYDA 3ILSA 1CUZA 4M0EA 2X5XA 4B80A 3G9UA 5CURA 2PU7A 1TQHA 1F0NA 4AZ0A 3H2IA 5AH0A 3C6YA 5AM5A 2XB6A 1QJ4A 3STTA 5ALMA 4FBLA 4J0JA 1LZLA 4X6UA 5ALYA 4X97A 1MU0A 2XUJA 1BROA 2XE4A 1ODTC 1QONA 2XUKA 3M83A 3NWOA 3O4IA 3D4LA 3C6BA 5JZSA 3GZJA 1PFQA 2CJPA 4AZ3A 1F8UA 4OYLA 3ZI7A 1X2EA 5HKBA 5CW2A 3H0CA 4Q3KA 2VJBA 4YPVA 4UBIA 4W9RA 3T4UA 4FKBA 3FNBA 1A8QA 1JFRA 3QM1A 3IUJA 3L1HA 4CIBA 3C6ZA 2DHDA 1UT6A 1UWCA 4GDMA 3DOHA 2BUAA 3E0XA 5C8XA 1CPYA 3WIOA 5EHZA 3BIWA 3VJKA 4HS9A 3ZPXA 2CZQA 2D5LA 4KACA 4X3CA 4BATA 4DTCA 4OB6A 2DSNA 5HFNA 1A7UA 3WK4A 4O08A 2XUGA 4QDTA 3MGAA 4G8CA 3WA6A 1QFMA 1UK7A 2QOEA 3B3QA 4PW0A 4U2CA 4WFJA 1ZGCA 5JD5A 4FFWA 1QIMA 1CUSA 4GHWA 4A5SA 1XZDA 1H2WA 4UHHA 5AI9A 1HQDA 1EK1A 4PF1A 2C0QA 3FLEA 3CN9A 2AJ8A 3HZOA 2YXPX 4E46A 2PKYX 4BTVA 3K2IA 2V9ZA 1XKTA 1U65A 3C45A 1VA5A 2R8BA 3PI6A 4OU5A 3EQ9A 3WA7A 3ZLUA 4BAGA 4FTWA 4UBLA 2WSLA 1OILA 4CCYB 4QWWA 1YA8A 2NW6A 3G0GA 1ZI8A 2GYVA 2RIPA 4XWGA 5AOBA 1XRQA 2HA6A 2QT9A 2K2QB 2QKYA 1B6GA 4UFPA 5AKXA 3F96A 1VZ3A 2JEZA 1XLUA 5K3FB 1BN6A 3SC2A 2B9VA 2ROQA 2XUOA 4AMZA 1F6WA 3WK5A 1UKAA 2QS9A 2DQYA 1ZJ5A 3GA7A 5K5EA 1W6RA 2GYWA 2GZRA 1ETHA 4BYMA 1E5TA 1MX9A 1EVEA 2Q0XA 2XUIA 3NUZA 3L1IA 4UPDA 3QITA 4MXDA 1N5MA 1IVYA 2WIGA 3PFCA 3HXKA 3I6YA 1IUNA 4G1FA 1LPPA 4KEAA 2XQJA 3ZLVA 4EY6A 1XQXA 3GROA 5LZ2A 5AOAA 3H2GA 2Z3ZA 1LPSA 1P0PA 2J3DA 2WU3A 5HZGA 5AKIA 5FKJA 1QFSA 2AJBA 2ONCA 1J07A 1AX9A 2BGRA 4FWBA 1G4HA 5I8PA 2Z8XA 3SX4A 4EBBA 3AIMA 3HSSA 3LCRA 3BJMA 1L7RA 1Q84A 5BWCA 4D9JA 2AXEA 4H18A 4ROTA 3IDAA 2BJHA 4BVJA 1QIKA 3D2CA 4RGYA 2XMRA 2X76A 4N5IX 1U2EA 1BN7A 1KU6A 1N5RA 1W76A 2VJCA 2VT7A 1VA4A 4EHBA 1J2EA 1A8UA 3D5EA 5BV7A 1WB6A 2QZPA 2C5FA 4GXNA 3ESDA 1W52X 3WZMA 1DQZA 2FJPA 1ZD3A 5FP0A 3G0IA 1WCYA 2WM2A 1LPBB 2WIDA 4MQMA 3AJAA 1W4LA 2C4HA 2VJAA 4I3FA 5FRDA 2AJDA 3ANTA 5HQ3A 4W1PA 4LXHA 1XZCA 3O0DA 1NU6A 1O6FA 4U2BA 2LIPA 6YASA 2PBLA 1RWQA 3FSGA 1UZAA 3O4GA 3WKAA 3O9MA 5AOCA 4Y2TA 1HLGA 4FMPA 4AQDA 1JKMA 3OPMA 3I2KA 3FAKA 4K6KA 5JAPA 4BRSA 4K2AA 1Q83A 1CV2A 2HA7A 3V9AA 3OG9A 5CT4A 2WQZA 3E3AA 1A88A 3G0BA 1P0MA 1S8OA 2FJ0A 3CCCA 4CI9A 1CQWA 1YAHA 1L7AA 3FVRA 4X6YA 4J0DA 3IIIA 1DX6A 5ISMA 2XLCA 1VE7A 3DD5A 1FFAA 5EHQA 1VZ2A 1QIGA 3TRDA 3HLKA 4DNFA 2HFJA 5DYTA 5ALLA 4B84A 5CT6A 1DINA 1RP1A 4C01A 3PUHA 1CFJA 1ZD5A 4CCWA 4G9GA 4W1RA 3QBJA 5ALFA 4FFVA 3W04A 1C4XA 1Z68A 4EUSA 4XVCA 5H3HA 3K9BA 1XZKA 2XUAA 3IB3A 1H2ZA 3H18A 5K3DA 5ALTA 1AC5A 5AK4A 1ZI6A 3R3YA 1Y7IA 4UUQA 5AI6A 5LIPA 4G8BA 4Y7DA 3DOIA 2WKWA 4AB1A 2QMQA 4KRXA 4DYHA 1FJ2A 5CT5A 3A2LA 1IZ7A 4MEAA 1VKHA 4BP8A 3B12A 2P8SA 3C5WP 3FCYA 1XLVA 3VKFA 3VJLA 3L1JA 3WIBA 5LZ7A 1VOTA 5AHXA 5AM4A 1JT2A 2QVBA 1XQYA 2BKLA 3D2BA 1R4ZA 4N8SA 3I2HA 4OCZA 3PE6A 3PUIA 1AURA 3D59A 2HDWA 4QWMA 1UXOA 4RNCA 5AO9A 2VATA 5ALHA 4TGLA 2OG1A 4J7AA 4ZRDA 2PUHA 3WYNA 1XRMA 1IUPA 4IO0A 3ZV7A 1HL7A 2PSEA 5AICA 5D7BA 4AN1A 3KDAA 4I4CA 1XZFA 2HHAA 4GI1A 3IA2A 4M0MA 1K8QA 3VVLA 2IX9A 4J03A 3G9TA 5E4YA 1XZLA 4ZV7A 5EGNA 4X93A 3W06A 4B9EA 4V2IA 1AQLA 5ALDA 4LXIA 2PL5A 2VEOA 4EA6A 2DHEA 3C43A 4Y2PA 1YR2A 3W2TA 5AM3A 2BCEA 1AGYA 2XMZA 1D07A 3V48A 3LIIA 5DJ5A 2ES4A 1UOPA 5FLKA 4GECA 4KE7A 3STYA 3ANSA 4QE3A 4KE9A 5T4BA 1BEZA 4UHDA 1C7IA 2D0DA 2ORYA 2OAEA 4H7EA 4NMWA 4UHBA 3R3UA 1TCCA 3QPCA 1ORVA 1WPXA 2OLEA 3QMVA 5DNUA 2AJLI 2XT0A 1MAAA 2B4KA 2QJWA 1CUGA 1G42A 1YB6A 1IZ8A 3QMMA 1LZKA 2I03A 3VJMA 5JATA 5FPQA 3BDIA 3QYJA 3DKKA 1R50A 3GUUA 4ZV9A 5ALUA 2XQGA 2HRQA 4Y9SA 1XLWA 4UBJA 5JANA 2VJDA 3V1KA 4JNCA 1PV1A 2YASA 3FBWA 3WL6A 3LP5A 3FYUC 5HKAA 3C5VA 4WDRA 4XX1A 3R40A 4DM7A 2DHCA 2VAXA 3DJYA 4DMFA 2PPLA 3I2GA 2XUHA 5IVKA 3WWEA 1YA4A 5JIBA 2WUGA 5LZ8A 5JD6A 1MT3A 2XMSA 3IULA 4OU4A 2YYSA 3O4JA 4CIAA 3AILA 4QEKA 1EB8A 2GBIA 2PU5A 3BJRA 4EY7A 2JGIA 2PVSA 5AKLA 1J1IA 5LZ9A 1UKCA 1QE3A 3WZLA 4KYVA 2J4CA 5EFZA 1THGA 1YS2X 2CUTA 1LPNA 3UUFA 1CR6A 4F60A 1CLEA 1EVQA 1YS1X 2UZ0A 3NOXA 3W05A 5CXXA 4H77A 1IUOA 5AKGA 5JAUA 2V96A 2HM7A 4HXFB 1U4NA 4YASA 2HADA 2X8BA 1QTIA 3TEJA 4KAFA 3V1LA 1Y37A 1MNQA 4JYPA 4W1QA 4HRXA 3U1TA 5D6OA 4N8DA 2PX6A 2XMGA 5AKZA 5EIEA 4BVLA 4TVKA 3RM3A 3D7RA 1GGVA 2O2HA 5T4HA 2PSFA 4J3JA 4KR0A 1K63A 4AO8A 4UBNA 1LPOA 4BCDA 3S8YA 1XRPA 3WI7A 4WY5A 4ZGBA 4A23A 1XZJA 2O2IA 2H9YA 1F0PA 2C58A 4H7IA 2QUAA 2XLBA 4BP9A 2RI6A 5ALRA 4J0KA 1R88A 2CEKA 1T2NA 5FOQA 3ESCA 4BCBA 2PUJA 2QRUA 4LHEA 4ARAA 3VVMA 3O9VA 3KWFA 3WKBA 2H1IA 3PF9A 4OPMA 2XUFA 3H04A 1ORWA 4WFIA 2JGMA 2WILA 4UBKA 3BXPA 5DNVA 3D3NA 2FUKA 2RHWA 4N5HX 1GXSA 3GBSA 4H7KA 3ZWQA 1CUHA 2JGEA 2XUDA 4QNNA 3CN7A 4LXGA 3ESAA 2OCGA 4DIUA 4RE5A 4G4IA 1CIJA 2GYUA 4IH9A 4IH1A 2ACEA 3EF3A 5C8ZA 1FFDA 3D2AA 5CH8A 3BF8A 5FUMA 2HA2A 3WMRA 1ZIXA 2OGSA 5JYCA 4Q3OA 4H35A 4PQEA 4EZIA 2E3JA 4QLOA 1OXMA 2JGJA 1CUVA 2QJRA 4FDMA 4GLBA 5T4FA 5A62A 1N1MA 2G5TA 3AUKA 1CUBA 1K6EA 4B85A 4U2DA 4MWSA 5AK6A 5HK9A 3WWCA 4Q1VA 5HFAA 5AJHA 4C4ZA 3JYHA 1WHTA 5ALVA 5F4ZA 1FFBA 5FPPA 2HU8A 2XMBA 3AIKA 3M81A 4OUKX 5FXMA 2QXUA 4X71A 5JALA 5D3KA 5IVDA 2OQVA 5ALGA 1JMKC 4K6GA 5AKJA 4MWTA 2RHTA 3MUNA 2OGZA 2PSJA 3UUEA 4C4YA 4KE8A 2BAGA 2RAUA 3G02A 2WHPB 4H7FA 4WFKA 2IIVA 5LZ4A 3C70A 5K3CA 3WKCA 5ALKA 5KREA 2WIFA 2WHRA 3BIXA 4F21A 5LKRA 2Z5GA 2RONA 2WHQA 4EY4A 2WUDA 3LS2A 4CCYA 4NS4A 3V1NA 2ZSHA 1ZICA 4X90A 3DYIA 4FBMA 2XUQA 4XJVA 2WG1A 5ALIA 1QO9A 5EIHA 1JI3A 3F97A 4FLEA 5IVHA 4ITVA 5JAHA 1R9NA 1XZGA 2VF2A 2XQFA 3WJ1A 2DFPA 3EQ8A 1Q0RA 1XZHA 3STXA 5K3AA 4QDOA 3WKDA 2ZSIA 2WFZA 2XQIA 2HA3A 5A71A 3HC7A 2QTBA 3H2HA 4Y2YA 2OCKA 3STUA 4W1SA 4PSDA 3VXKA 3HYSA 1ZI9A 1QGED 1E66A 2QR5A 1H2XA 1UK8A 2OQIA 2HRRA 1GT6A 2GZSA 3G9XA 4BVKA 1DX4A 1SCQA 4JUIA 3QVMA 1BU8A 2WUFA 3WK8A 2PSHA 1G66A 3JW8A 5JD4A 4DGQA 2ZJ7A 2RGUA 2WU4A 1WHSA 3FCXA 5LKAA 5J3JA 2WJ4A 4Q3LA 1YSCA 3KXPA 3C8DA 2VSQA 3STVA 3W9BA 2J3QA 2VQ6A 2WFLA 5KWIA 4OB8A 1EXWA 3ED1A 4G9EA 5AM0A 1E8NA 4H0CA 2CBGA 1DQYA 1PJAA 5AI0A 3I1YA 5FV4A 3PDCA 3FLAA 4L72A 3RKSA 2WTMA 4Y2SA 3HACA 2ACKA 1TK3A 1ZGBA 3WK7A 2BUCA 1FFEA 4AO6A 3R3VA 2WIKA 4X00A 1W75A 2VTVA 3IVMA 1JMYA 1MN6A 4U2FA 3GELA 3WQHA 5JASA 1EINA 3C87A 5ALWA 1JU3A 2WJ3A 2R11A 4HXEB 4U2GA 5CXUA 1O6GA 3JWEA 5K3BA 2JGKA 3BWXA 2HL6A 1ZD2P 3R3ZA 4UFOA 4Y2VA 3WL7A 1CUJA 5C8VA 1CUUA 1CUEA 2GBGA 1SCIA 3TJMA 4E15A 3ZLTA 4EY5A 4BE4A 4X6XA 5JZ9A 5ALQA 1E8MA 4HTAA 5AKEA 3G9ZA 5AI8A 2PM8A 2W6CX 3QPAA 4AXBA 5DNWA 3DDUA 4QZVA 5T4EA 3W9UA 5AIAA 1ACJA 1WOMA 3AZQA 4B83A 4WDQA 4C87A 1ZD4A 4GBGA 2XMDA 5AP9A 2DQZA 5EHXA 4FHZA 4FLMA 3AINA 3DCNA 1GPKA 5ALSA 3IUQA 5A7HA 1CUXA 4HVTA 3H1AA 3DYVA 4BDSA 4C4XA 4UBMA 3VDXA 1X2BA 1VE6A 2EDCA 1MJ5A 2V98A 2WHPA 4B0OA 4DMHA 4QLAA 1CQZA 3WK6A 1DT5A 3HABA 1CUYA 4UHCA 4WCVA 1BCSA 1AMNA 4ARBA 4OB7A 3H19A 2I3ZA 3DEAA 3EBLA 5AM1A 2WJ6A 3WL8A 1H23A 3WKEA 1DT3A 3H1BA 5AKKA 1EB9A 3QMWA 4B9AA 1XKLA 2DCMA 1DTEA 4IQ4A 4G5XA 2OGTA 1ZOIA 4FLFA 4HAIA 1N8SA 1ODCA 4Y2UA 5AIBA 2Y2VA 4C89A 1GZ7A 3BE8A 3UMJA 2QXTA 5K3EA 1LBTA 3WLAA 4GEGA 1W1IA 1BS9A 4DSZA 2VAVA 5BWBA 5SYNA 4I19A 5DLPA 5JZBA 4W63A 3FWHA 1LPAB 2J4FA 1BE0A 1FFCA 1A8SA 4H7HA 3EIOA 1TKRA 1VLQA 1DU4A 4RPCA 2FX5A 4BZZA 3I2FA 5IVIA 4ZWNA 2DR0A 3PFBA 5AI4A 3H2JA 1H2YA 1BRTA 4P92A 2CKMA 4DSAA 1GPNA 2B61A 1ISPA 4BAZA 2I3DA 4QA9A 1XQWA 5LYYA 4GW3A 3FYTA 3MUOA 5ESRA 1MX5A 4DNQA 5CTAA 1VXRA 1QIJA 4BRZA 3FVTA 2C0PA 2Z8ZA 3Q8WA 5JAOA 2VT6A 5EIAA 3QZUA 2JGFA 1EDBA 1CUWA 1HKHA 1LGYA 4UHFA 3PF8A 1CUAA 1LLFA 1VJ5A 3F98A 4PV7A 1MNAA 1WB4A 2Z3WA 5CBKA 4QDZA 4F5ZA 3FSGD 1UOQA 4E14A 4IH4A 3Q0TA 4BAUA 4G4GA 1CUFA 3NGMA 5CMLA 3HRHA 5FDFA 4TPKA 3P2MA 5YASA 2BGNA 3S2ZA 1Q0ZA 4B0PA 2HU7A 2WIJA 4UBOA 3AFIA 1M33A 4PO3X 2V97A 1T4MA 1G5FA 5E4JA 2WLSA 5HF5A 1E3QA 2ZYHA 5I7UA 1EDDA 3E1GA 3A6ZA 2JBWA 4FNMA 3BF7A 1SFRA 2XMQA 2EEPA 5LP1A 1H22A 3RK4A 3HI4A 2EDAA 4B7ZA 1EX9A 4AN0A 4KE6A 4X7BA 1HDEA 2JGLA 2O7VA 4BB0A 4GWLA 5EI5A 2WTNA 4P08A 1CUDA 5CH3A 3N2ZB 1B41A 5AK5A 1LNSA 2AJCA 1EK2A 4PSUA 1UK6A 1QTRA 4CG2A 4NVRA 3A2NA 3R0VA 1ZJ4A 4LYDA 1P0QA 5CH5A 4DMCA 4BTLA 3RLIA 2G4LA 3O4HA 5ALPA 4BE9A 3VISA 3H17A 4L9AA 4OD0A 2HU5A 2CB9A 3LIPA 1CEXA 4UFNA 5HF9A 2O2GA 5IH7A 5AKYA 4XIIA 4RE6A 1ZIYA 1SCKA 5LZ5A 1YASA 1YB7A 1UKBA 5HQ3B 1ACLA 1OCEA 1R1DA 3WJ2A 5C81A 3PICA 3OTQA 2OCLA 5ALJA 2GBCA 4CG3A 4J0HA 2ZJ6A 2WG2A 3QPDA 2QUBA 1K4YA 2ECFA 7YASA 4NZZA 5AK3A 3MVEA 4L3WA 1DWPA 4K6HA 2VA9A 1I6WA 4JEIA 2HA4A 1WPRA 3D0KA 5CRIA 5I9IA 1GPLA 4LYEA 3M3DA 2O7RA 4CG1A 2XMCA 4CFSA 4EB0A 5LLSA 2OAGA 1GQRA 1HBJA 3DS8A 3WWPA 3U0VA 5HF6A 3AZOA 2HIHA 4Q05A 3G7NA 1RYYA 1BEEA 5CT8A 2Y6VA 1TCAA 1TRHA 1CUIA 5E2IA 5DYYA 1XRNA 5AI5A 4X92A 3WK9A 4X85A 4FNGA 1IMJA 4C88A
chains in the Genus database with same CATH superfamily
2ZJ0A 3R9XA 4DEYA 5B12A 1SIBE 1TO6A 4OYYA 1YFLA 2WINI 2QP4A 2QJTA 1N1GA 1P0IA 3LY9A 1RI1A 2CMDA 2IF0A 1SOMA 1DRUA 2R1VA 3JVVA 5CLLA 3TIIA 3SJUA 3M6IA 1QC5A 2JJ1D 2GX6A 4E12A 1JDPA 5F2EA 1QYXA 4DCCA 4H1UA 4PYMA 1AUOA 4GYJA 1B93A 5E4TA 5INTA 2QM0A 1THTA 2QPAA 1FZQA 3BXHA 4Q4AA 4ER5A 1N34B 4DNPA 4X1YB 3VHLB 4QICA 2QZZA 1PUJA 1XJQA 2ZR8A 2QYSA 3AXSA 3RK1A 3T3PB 1OAKA 4EG6A 5HE8A 4GKKB 1G9XA 3LHDA 2TSYB 5AUNB 1XTSA 3KT8A 1K68A 1FMLA 1WM1A 4LHXA 3G0CA 4R8KA 3PR1A 4MUHA 2DPGA 2I6GA 5CGZA 2QTHA 1TJPB 4DCJA 3CF6R 1VI6A 3INRA 1V4NA 3ROZA 5AKHA 5JCJA 2HRCA 4HRYA 3AI7A 2JDID 4KO3S 3W9YA 3WGYA 2UYQA 2WWRA 4Q66C 5DWVA 3V42A 4Q02A 1EWKA 3U09A 4JLSA 3L82B 2M1XA 5BN3A 3MWJA 5I7EA 1CRPA 2Y4OA 2WUEA 1LFDB 1ZSVA 3R74A 4DYDA 1MBZA 4TTSA 5B1YA 3BTSA 3IQDB 4CG0A 4TKMA 3MJEA 4E22A 5LN1A 4OATA 2TYSB 4LVNA 3PGA1 2VPYA 3VQTA 4LF4B 4XYBA 1UK9A 3PJFA 3SLRA 1PW5A 1RWPA 3I3OA 3JYQA 4GLOA 1O0SA 2D1YA 5EPUA 5KWJA 3SC4A 1FS4A 5E7MA 4HH3C 1KA9H 5F7ZA 2PGLA 3N5KA 4KXQA 5B55A 5JDCA 3CEAA 1C9EA 4IEFB 3WGZA 1QOZA 4UNIA 3M34A 3LYHA 4LKOA 4FGKA 4NZPA 4QXPA 2AYYA 1XNHA 1PT5A 2WM8A 2IITA 3MJHA 4KH0A 3FTDA 4R2KA 4X1OA 2IHYA 5AM2A 4MAFA 5BSRA 4INOA 3I5YA 1WZ2A 4YJHB 3SIPA 1Z4QA 2X22A 4YR7A 3T7JA 1JG7A 1GNSA 2D2FA 3LNCA 1PT6A 4F4CA 1CXZA 3O8CA 3EH1A 3CH4B 1S8FA 3IHTA 4TMTA 3TG8A 1R5BA 1CVLA 2JVIA 5HMLA 5SYAA 3G59A 2GLUA 2XRFA 1NBAA 1OH8A 1DIRA 3JSXA 3RD5A 5F7OA 1T6YA 2ZTVA 3K6KA 4OIMA 4ACBA 3DTNA 3FYUA 4RIEA 4DQ0A 1H4VB 1Z6AA 2ZBGA 3DDNA 3P0RA 2IWHA 1DQRA 2ZYSA 5ES3A 1V3VA 2XQKA 1N0WA 4XD2A 4D2IA 4D6YA 4W5TA 4JP3A 3INYA 3B6KA 1V1JA 1N4DA 1V1MA 2COEA 1P17A 3HE3A 1J23A 2PH5A 1QG2A 3ZTYA 1XL1A 3OOSA 5CX4A 2K87A 2BGKA 2X9QA 4NFLA 3KOZA 3QKSB 2C2MA 5EMKA 2C2XA 2J9GA 3NNDA 4MQ4A 2XDWA 4K81B 5KYXB 2YMMA 4E2YA 2XWQA 1I3NA 1DJLA 2HPZA 1LTQA 2IBMA 4HGNA 1TOAA 1Z8NA 3EXHC 4BN5A 3CCBA 2WWWA 2NYAA 1MMFB 2F17A 4B8WA 4DNOA 5KJ1A 2H7XA 2ZIVB 4Q4HB 1HZJA 1JSZA 2B20A 3NTXA 2E4XA 2FMXA 2UKDA 1WSBA 2XX3A 2YZMA 5EZSA 2ZWMA 2WM3A 3C6XA 5A4FS 1MDBA 2Q6KA 2KHZA 4E11A 3I9JA 3NHWA 3A0UA 4YAWA 5HMMA 4DLNA 1NJ8A 3ESBA 4H7JA 4A1OA 3QH4A 1A2BA 4NJOA 3O0TA 3N6VA 1T13A 1CE8B 1DOAA 2JFVA 3GGJA 4EHIA 3JQCA 1M8FA 4KU4A 1JHDA 1VB5A 1YBVA 2FUG1 4YB8A 3TH5A 5JRZA 3RFTA 4PLPA 5KOHA 3P94A 2CXNA 5CFLA 5GP1A 1Z47A 3UA4A 3FMOB 1EWQA 4J9UE 1O0BA 1VL5A 1DKLA 2LRHA 1WU7A 1UFVA 4LVUA 1Z6YA 1M67A 2OCIA 2XBUA 3USZA 1E89A 4GPTA 3A9WA 4L4RA 5GVRA 3KSRA 3R7WA 3VBCA 4A6EA 1XPRA 2QORA 3L4BA 2J3MA 5F1OA 4U9IS 1POWA 1ZM2A 2XKKA 1C7JA 2OV4A 4U8HA 3FGZA 2ACVA 2W7TA 3MJRA 4U7TB 2H9AA 4S1WA 2B1JA 4ZHQB 5I5EA 1PKEA 3AUSA 4WWHA 1GKKA 3CNQS 4NX2A 1PR9A 2ZRBA 1LB1B 1ZAKA 4PGAA 3OZWA 2C77A 4P93A 5D5PA 1SKUA 1KDOA 2EHDA 4U3JA 4LE1A 1JAHA 3UO8B 2OXEA 5BV1A 4QPNA 2W22A 3VAAA 2XYGA 4NY1A 3HRKA 2JHFA 4YP9A 3KSDO 1UBMS 1NJ6A 4KNWA 3KQOA 2HEIA 1FP4A 1MTZA 1G8KA 1E79A 1K5HA 1SC9A 5E2BA 3UCEA 1EJ0A 2I4TA 1B1AA 3WL5A 4MX8A 3TLMA 2XPCA 4Q5IA 4P3NA 4BV2A 5DWDA 1U3FA 1WP9A 4CDGA 1A9RA 4EB3A 4MR8B 1E6UA 3T7AA 3ZK9A 3R3XA 1TYCA 1NI4A 2BMVA 2SCUA 3O8NA 1NMSA 3AIOA 4GNKA 4N54A 1KYVA 4URUR 3A06A 5H70A 5H80A 4QREA 3RTCA 1ONOA 1EFLA 3WIDA 4B7UA 2BGWA 3J7TA 3L7DA 1VL6A 4ZEOA 5K8TA 2GD1O 1B3RA 5DTJA 1XNGA 3EXFA 1UBEA 3BXEA 3UJCA 3PX2A 3CRMA 5ALRA 1JE1A 1PJCA 4EIWA 5HRUA 5K09A 1NW4A 2F8MA 2GBLC 2XUPA 3BULA 3DE5X 1UPBA 1VIDA 2L17A 2O2SA 1Z6ZA 3FHTA 1VDMA 4FMBB 3BL8A 4O4IB 1SC3A 1K8RA 2PV0A 3UOGA 3M2PA 4OXNA 1JFFB 1RWNA 2C04A 5GGYA 1OC4A 1XFDA 1DQNA 1GA1A 2A59A 2HHCA 4UEWA 3RARA 2Q1YA 2Q5LA 3MJCA 4FUTA 3LUJA 4R98A 3GFFA 2NTEA 5FNVF 4JI0B 1VPLA 4OLAA 4YUWA 1U0JA 4FJ2A 1RAAA 3PWKA 2TS1A 2OCYC 2GRUA 3F1LA 4OA5A 3ZDXB 1DWOA 5C4MA 4S35A 4Z49A 4IVPA 3EDMA 4X8LA 1AKRA 4RF2A 2XZLA 3D43A 3D8TA 4IDHA 2MR6A 4M9UA 3RREA 1L4LA 1LK0A 1YZUA 2PYDA 3HCEA 1JHXA 3R1IA 3R7AA 3T7CA 3VMMA 3CLRD 1K3UB 3OMWA 4UXJA 1GVNB 5ALXA 3PJGA 1P2VA 4LIPD 4A3SA 2EBFX 4NQZA 3QEKA 1PJBA 2FW1A 2QDXA 4RVNA 2CUZA 1F2TB 4FQ8A 4JXJA 4U1RA 3KFXA 1J42A 3LE8A 3HZZA 1WABA 3AFGA 3DMPA 5TVGA 2C9DA 3P20A 4X94A 3ZDFA 5A2GA 3VHXB 2R8YA 1AZWA 4QDXA 1KC3A 3PCRB 4BFUA 3Q9LA 5HCIA 4X7MA 2A5FA 3RJZA 1PT7A 3ASZA 4RACA 2DLCX 1HV8A 1LDGA 1UP4A 4UJ5A 4LGVA 1DQPA 3U81A 3ZCUA 1J33A 2J31A 2X3UA 4J0FA 1V39A 3N59A 3OSUA 3V4RA 1WHTB 4XJXA 4E88A 4FMDF 3U7JA 1Y9JA 3QBVA 2NGRA 1H5NA 3RUAA 4D96A 4DMLA 4U63A 1LI7A 5DTIA 3QKRA 5CLHA 1RRPA 3GRUA 4FDLA 3KTAB 1R6UA 5K3FA 4BQEA 2H1RA 3COJA 3GVCA 1X74A 2E9SA 3U31A 5LDGA 1T6NA 3WYEA 3OY7A 3SKVA 2WAYA 1WTCA 2Y05A 4U7WA 1T8TA 3KQWA 4WCFA 2CUNA 4BJ3A 4QOHA 4IGKA 1NHGA 1OFTA 4QGAA 3VDQA 4RIFA 1XWIA 3GXBA 2Y66A 3HKCA 4EUEA 1H42A 3F5DA 4B6GA 1DLJA 1SIUA 4O2LA 1DXYA 4CM8B 5F23A 3LH5A 1R00A 4R2XA 1EGVB 3KOOA 1P7YA 3ZDYB 4YJKA 1Z0UA 3I6MA 3FIJA 3ZS8A 3GG2A 1AMUA 4NU0A 1EDOA 2UVPB 3IPAA 3NJ4A 2R2AA 3IAS6 3WWZA 2O1XA 2PNJA 2VK2A 2FETA 2IFTA 4KRYA 1HNZB 3I04A 3T52A 5TQ0B 1X70A 2EOAA 1SUIA 1TMYA 3FMIA 4CM9D 3H9GA 4YJHA 2D1TA 3BRSA 1TL7C 1VRWA 1PZXA 3WRXC 1ISJA 3EWAA 1KETA 3H9JA 4YRZA 2WTUA 2EWWA 3ICVA 2Z2YA 3TGWA 4GDFA 3HYNA 3NHZA 4FNAA 1JQAA 2DG2A 3D7NA 4MPTA 5E0KB 5JWRA 3S5JA 4Q34A 1Z5ZA 2HMVA 2QT1A 3WNQA 3H8WA 5BMVB 5AW5A 3KOUA 3KQHA 1J09A 2OXIA 1EEHA 3ETEA 3BTVA 1YQQA 3K15A 2ETXA 2OHVA 3FYUB 4DIOA 1CSEE 1ZVKA 1JEJA 1I0ZA 1B76A 3HCAA 5JJCA 1NXVA 5DEIA 1L4GA 4A8JC 5H9WA 1V2GA 2X5XA 2HMWA 2HH9A 1RHJA 2ZVJA 5ICFA 1WE2A 4G26A 4F2GA 2PN1A 3A27A 4RZ3A 3WLOA 1PBTA 2Y27A 5AH0A 5IEBA 4EX6A 4XWOA 2Q49A 1D8AA 1HI9A 5CCXA 5HG0A 1LD3A 4BV3A 1L3BA 3DO5A 1GPDG 2IUSA 1CNFA 4AJ9A 1JFTA 4RH0A 3AK4A 3LBNA 5KYXA 3NM5A 5ALMA 3AVVA 3FCCA 2FRDC 4HOYA 4YECA 4I1OA 2Z2ZA 5EKUA 3KKNA 1E18A 3T1OA 4ARZB 4RS4A 3ZWOA 1I36A 4X6UA 1F5SA 3UBTA 5IJZA 1G8JA 5FA5A 4KV7A 4R2LA 1WDKA 2I3AA 4IGEA 1KVQA 2ZM5A 4KPUB 5KKAA 4H0NA 1ODTC 2XUKA 1DUVG 1GL6A 2LP4Y 3O4IA 3CMCO 3TZHA 1I2ZA 4XSVA 1T5BA 2VZLA 4U7GA 2CHEA 4B7AA 1PG0A 3DD1A 4KPYA 3C7AA 1W0CA 1K92A 1EZZA 1FTNA 1KR5A 2D5AA 2FU5C 4GZ3A 5K8VA 2BOVA 3UV6A 1Z33A 3WYBA 3Q72A 2DPMA 2ZUVA 3NALA 4V0SA 5EWMA 1A69A 3WXBA 1GAEO 4AZ3A 1F8UA 2Q1UA 1X2EA 3NT4A 3W79A 2DRIA 3JAWA 4F9EA 5CBPA 5HKBA 3A1CA 1JFLA 3WL3A 1EXMA 3H0CA 4XI9A 4Z2YA 2C8JA 5JJLA 3F3KA 2XZTA 3KAKA 4XCXA 4TLCA 2F4NA 2IA5A 2E21A 2WRZA 4YP7A 3UCXA 4POOA 1OXBB 1QO0D 3SZUA 1H9CA 3RUPA 3IEXA 1Z6QA 3CJQA 1WHSB 4UBIA 1P62B 4B7CA 5CB6A 4IIHA 4W9RA 3KP1A 1G7TA 4FKBA 3FNBA 3HB0A 1MIHA 1SU4A 3WVNA 3I9OA 4ZDKA 3ZCSA 2B78A 4FSDA 4ZZ2A 3ZN2A 4KKXB 4Z7NB 3OE7D 3DZGA 3QM1A 1V8BA 4MICA 4EY4A 3OPNA 4EKYA 2AGVA 2GJAA 5P21A 5CA0F 3L1HA 1QSGA 3DV2A 4ED9A 1OREA 3AOEC 1TU0A 2XCOA 1EQUA 4B48A 2Z5FA 4IG9A 1B4DA 3DOEA 5J5VA 1UWCA 4GDMA 2V5AA 1G6KA 3UW1A 4IFEA 1KJZA 1Z2NX 2BBOA 1S2DA 3E0XA 3E2PA 3ONWA 2Z6UA 9GPBA 1WMAA 3VNSA 1X7DA 3T5TA 4E5DA 1FP4B 4MI6A 5J43A 1PEDA 1O77A 1XT6A 2FFJA 3D6AA 1Z2CA 1W96A 1X1RA 3HSKA 4B17A 5HQJA 4HGQA 2BFFA 1IWPB 1C8KA 4MLCA 1KI1A 2BL4A 2CZQA 3M1IA 1I33A 2C29D 4AYWA 3LQFA 4RVDA 4DTCA 5IBQA 3FUWA 3EJ6A 2MTBA 4MKZA 4DNXA 1W47A 1P8AA 3OSZA 1RAHA 1Q21A 2AN4A 1W4RA 3DFFA 1V7QA 1AA9A 3NP9A 3RSZA 1EVYA 5CVUA 2A14A 4DKXA 3E61A 4XWYA 2VS1A 4TWBA 3ACBA 4GLLA 1N7GA 2OHIA 4I14A 4C7JA 3BMXA 2Q1WA 2PS1A 2GAAA 3GQVA 5FL7D 2PGDA 4M9ZA 3WQBA 2DQ4A 3HWWA 2ZJ3A 4NENB 5F33A 1ZNYA 3QFCA 3K9CA 3PR3A 3SGLA 4LXUA 2EKZA 1QFMA 3D0RA 1KY4A 5IJXA 3B3QA 3DTVD 3TAXA 1CZKA 4U2CA 4ZAZA 3VO2A 2DAPA 1UCFA 2ZUDA 2BE7A 3F46A 4WFJA 1GQYA 2J85A 4YP0A 1B0AA 1L8AA 1Q2UA 5FWXB 1XZDA 4X1KB 1YJBA 4UHHA 4WIAA 2E18A 3LZDA 1NQUA 1Z0IA 1VJ0A 1H2HA 1RQ2A 3KQVA 1P1CA 4WLNA 3LX6A 4CCAA 4DAOA 2PS9A 5MDHA 3FLEA 4GMGA 2IDMA 4PPYA 4E7OA 5A5VA 3GRAA 1J1ZA 1CF2O 4KN9S 5EEHA 1NXQA 4FILA 3ROFA 3AF4A 2YXPX 4XUEA 4EYQA 4CFYA 1E4EB 3F3MA 3JATB 3FHLA 2MWMA 2P6MA 3PX7A 4OM8A 1DEAA 5G1PA 5KWEA 5EWLB 2IS4A 2OO5A 2QAIA 5KWVA 3PI6A 2NU7A 4WBNF 1XV5A 2CNLA 2W2QA 4DQKA 1U7XA 3KZXA 3ZLUA 4L02A 1Z4NA 4X45A 5LYJA 3UMFA 1K6IA 1R6XA 3N5CA 1WSWA 2Z3VA 1RD4A 3ET5A 3SF8A 3C14C 3MQ4A 5JSZA 1S4MA 1YB1A 2PANA 4QWWA 1BO6A 4IJ5A 3UGJA 1S3IA 3RGGA 3SIRA 4CTNA 1BFUA 2A94A 2M6RA 1AXEA 2PJUA 2B8EA 2GYVA 1S1MA 2E6KA 2Q5HA 4IO1A 1HTTA 3MGBA 3V55A 5ADHA 1OZAA 1F20A 2FN4A 1P2FA 2RIPA 1XF9A 1XRQA 4J4TA 1UPCA 2VK1A 4MRVA 4XWGA 5KYTA 3BT7A 4HNQA 5TPZA 2QT9A 2B4RO 4TKUA 2I29A 1TUBB 2K2QB 2QKYA 3QVVA 4FW9A 4P4NA 4EMUA 1B6GA 4YAOA 2BV3A 5AKXA 4X60A 5HKLA 3CF2A 1UPXA 3PCXA 5E4FA 1NTRA 4JQCA 2W8BB 3MOIA 3UMCA 4CLRA 2F1RA 5FBHA 2YICA 4TYYA 3EVGA 1XLUA 4AN4A 3BD8A 5K3FB 2LR0A 2QTMA 3EPKA 3ZCRA 5ARCA 4CXMA 3HDJA 2CLSA 4Y18A 3R8XA 1FJHA 2GSDA 3R6DA 2COUA 5LOVF 5KEIA 4MTCA 5JMPA 3F6EX 3KVRA 3M2TA 2XYQA 1DKMA 4PTZA 3ZHUA 5BUQA 4IMPA 2V1UA 1N3YA 4K87A 4LBVA 1ECPA 5ECGC 1RQPA 1ZJ5A 5I5GA 5K5EA 1E32A 1M1ZA 4ZARA 2F9MA 1H93A 2QLJA 4LGCA 4IIGA 3D02A 2AK3A 3O8OB 4FB5A 4MHOA 3JAMA 5IJAA 1DCFA 4M1WA 5BV2P 2GYWA 2GZRA 2JFOA 1ODKA 3A26A 4BYMA 4YMUA 4AKGA 1E5TA 3K0EA 3CW9A 1YFKA 3UN1A 4JSRA 1ARZA 4GX0A 4A26A 3GLRA 3NWBA 2BZ0A 2FWPA 4YDHB 4I6EA 3UJ7A 2B1RA 1BU5A 3TBFA 1P3DA 1S5PA 2LBPA 1E1YA 3AJDA 4PCAA 4XQ0A 3RSFA 1V6CA 1YMVA 1SUFA 4TL8A 4BNDA 2Y1FA 2W11A 3EWIA 3MWKA 4NKRA 3MRVA 5GM1A 4B73A 4DJJA 1P1HA 4CL0A 4MXDA 4RHTA 3WLNA 1N5MA 1IVYA 1JNYA 3ROGA 2X23A 3S6JA 4GI5A 5EP2A 4PYKA 4ZK2A 4HEA6 2F3QA 5BNTA 1YR3A 4Z8XA 4B46A 4UUNA 1LPPA 4RDHA 2RFLA 4KEAA 1HR0B 4XVHA 4AF6A 5EXXA 4IFBA 3ZLVA 2EJUA 1H3FA 2EL7A 2ZITA 3FPJA 1X0XA 3GZTB 4G0NA 5LC1A 5TS3A 3PZBA 1QWOA 2OXCA 2AF4C 4EY6A 2CD7A 3GROA 3H2GA 1Y4UA 1JR6A 3ZE1B 2CKDA 6PFKA 1BJRE 1QCYA 5EE0A 3MJFA 4ZCRA 2AZDA 3ZE6A 3RC2A 1JDNA 1L5HB 4B47A 2CZGA 8GPBA 4M49A 1LWOA 2J3DA 5COQA 1MA3A 3ULKA 4E32A 3DE6X 5AW2A 3G1WA 1XR3A 3U4QA 5FR2A 3JQPA 4XOIA 1IONA 3H5WA 3QPWA 3GGCA 4KQJA 5FOWA 5FKJA 5D7NA 1T0PA 3RVMA 1XMPA 1AKQA 3WIVA 3GRRA 3KSMA 1XSEA 1AF4A 5EKDA 2VL7A 3GAMA 3ZWVA 3HSYA 2XJ9A 1G4HA 3GB9A 5DISB 3KKEA 3KPWA 5DHAA 5I8PA 5KNBA 4W5WA 1Z28A 2A1IA 1T3HA 1ZJ6A 2D7JA 2R751 4IRXA 4M53A 3IALA 4MQEB 5T67A 2O0LA 3KR2A 3KQTA 2W6MA 3GOHA 3ICPA 5KSZA 3HSSA 5TQ2B 2EZ9A 4GFDA 3BE4A 1FMCA 2RAVA 3COWA 5AVUA 4X20A 2FY8A 2OAQ1 1U1GA 1ZN9A 5IDVA 3VHXA 1M2HA 3HZHA 3SQDA 1Q1AA 4RPJA 3BTUA 5JLJA 2BSQA 1X94A 4P7GA 1PI3A 2Y67A 3X2FA 4EKNB 3CB4A 3AFOA 1FTGA 3IDAA 4HVCA 4ZVMA 2IEGA 2ZROA 3G9QA 3INNA 4C0QC 1QIKA 4RGYA 5CBPB 1B0PA 1UXJA 2W4QA 4N5IX 1PLJA 1KU6A 2ZCUA 1N5RA 2CWDA 2JFYA 3DDHA 4CZ2A 4EJSC 2DJIA 4CHGA 1VA4A 4ND7A 5JAMA 6NULA 4X24A 4ZEVA 2HYDA 2IV3A 1WEKA 4O4HA 2I34A 4EHBA 3FRHA 3D5EA 1J2YA 2NLOA 3LKDA 3PS9A 3UWMA 1EBUA 2XOEA 3B60A 4IVRA 3EEYA 3KSUA 4O02B 3RGWS 4BQOA 1MF7A 3TL2A 4GXNA 3V8NA 4JGBA 5FUVA 1W93A 2J3JA 1S8NA 4M60A 1GG2A 1XMIA 2W6JA 1ZNXA 4MWDA 2O2CA 5EIBD 3RWBA 3EVZA 4F3YA 4LJ6A 3V80A 2AQ8A 2I4LA 2QUKA 4OSOA 5FP0A 2B8NA 4O2BA 4RFVA 1LPBB 3FNHA 2AKEA 4EWLA 5TARA 1NONA 2LVBA 3FOWA 1YS4A 2WWTA 4O6VA 4XIGS 4Y1RB 5E8RA 4E13A 2IU6A 2NTVA 3PG5A 4D0LB 1FLAA 2X4IA 1I3CA 1SVLA 1Z0KA 2HF8A 3ANTA 4HQNA 2OHFA 3JWJA 3FVWA 4ZO7A 3NDBB 4KXWA 3I01A 1XZCA 1LJLA 2I2DA 3O0DA 2X86A 1IOZA 1NU6A 1O6FA 1X8KA 3NKLA 5F1YA 4UPVA 3MLBA 4X9XA 1PO7A 4UTZA 2BFFB 4RXMA 1GJRA 2PKXA 2YWGA 3AUFA 1E2DA 2BMDA 3MAAC 2SNIE 2ZKLA 3EFOA 1NG1A 2PMBA 5KWSA 1VP9A 3WKAA 1RPAA 1M83A 3ACDA 1C1DB 1U8YA 4QUKA 4P1ZA 1DAIA 4NP6A 2HT1A 2G71A 3LUGA 2LZ0A 1AHHA 3BEOA 3SYKA 2Z6AA 3R5TA 4KYTA 1U11A 2JFFA 1ZH4A 3JQRA 1IBRA 1W5AA 2H08A 2HWXA 2WMYA 3L93A 1Z5OA 4IJVA 4ML3A 4R1QA 5BYAA 2DXIA 5E7IA 2YZNA 2I71A 1SVNA 2I7CA 2C2ZA 4YYEA 3NEYA 3R5JA 5L9AA 3A14A 1I6MA 3OA2A 1ONPA 1TQ2A 4K6KA 3HS3A 1AKMA 3L84A 1QCCA 4PIPA 4TSRA 4BRSA 1P5RA 3E84A 5ESDA 2PZAA 1N32B 4XOUA 3I9V6 3NQ41 4K9KA 1HNWB 1C14A 3DFMA 4QDKA 4DR2B 1L3IA 2AKAB 4N3NA 1NXOA 3T5MA 2FWIA 1DBRA 3MT9A 5IF3A 3R0IA 1C0LA 1O6CA 2IZ7A 4N40A 3U3ZA 4CI9A 2A0WA 3OJLA 1YAHA 2FR0A 2O57A 3V3TA 4K0KB 2LCFA 2PCJA 3VSDA 4F71A 1XK7A 5EXTA 3VZQA 2NVBA 1PL7A 2NAPA 3PQDA 5ISMA 5IK2A 3GHYA 1BIFA 5DH9A 1LSSA 3VX4A 3TUZC 4YUVA 2BFWA 2G9QA 3TQTA 4AXXA 4CJXA 4W6ZA 2RGDA 1NF8A 2NSYA 3K31A 4Q9KA 5EHQA 1U7ZA 1SBYA 3MRXA 3UNXA 5EINA 4YQYA 1QIGA 5B2ZA 5IT5A 5L6MB 3EVNA 2P3QA 3PK0A 4MAAA 3RIEA 3ZLJA 2CSXA 4CLEA 1JHYA 3GRFA 4OJMX 4AWAA 1ORHA 3TRDA 4CIDA 3HLKA 2M9MA 3HMQA 3UJDA 2PK3A 1Y3HA 1OUMA 3TIFA 3DAHA 2X0KA 4YFVA 1OV4A 2EWMA 1RP1A 4KGDA 5CFPA 5U4QA 4I55B 2F1KA 3I5UA 1QH8B 1ZJYA 2B1QA 4I4TB 5D2CA 2R65A 3RW9A 3USCS 1Y5NA 3RADC 2I7XA 1RM0A 3AF0A 4HZUB 4MYHA 2DFVA 2QL9A 3DHNA 3K6SA 4ZJUA 3L8GA 2INGX 1T24A 1XQ6A 2LCIA 5IARA 1GM5A 4C2UA 4HNUA 2I4NA 1IN4A 1ZCFA 3AR7A 1TF2A 1U8CB 3GJXC 3A2KA 5HBRA 1JI0A 3UXYA 2P9QA 5EJIA 3ELUA 4EUSA 1ECGA 3LP6A 1JIUA 4IG4A 3GAAA 2XUAA 3GH3A 5I7WA 4DC9A 2ZSFA 4B4WA 1QYCA 1CU1A 1UPUA 3HJRA 4BGDA 5LB2A 5ALTA 1AC5A 2X7XA 1XK6A 4S2UA 3R3YA 2ZYVX 3IP5A 3S44A 3ZE9A 5B4TA 1YQEA 3F6PA 1P9LA 1Y7IA 4RS3A 3P7MA 4CMCA 5JS6A 4G8BA 2A6PA 3DZBA 4M9QA 4Y7DA 5E38A 1L0BA 3QX8A 4AK9A 1O9BA 4I1RA 1GUFA 1JLLA 2WD7B 4AB1A 1Q1QA 3T1TA 1V5GA 1P9NA 2W5UA 3FX2A 2I2WA 3PNMA 5H02A 1GCIA 3FNIA 1P6QA 2FWAA 2R62A 4BFXA 1H2AS 1K4MA 5CFOA 4D9GA 4FDTA 1PR4A 3CNOA 3H8SA 1VKHA 3PB3A 3ORRA 3KQLA 2HCFA 5HXAA 3PV0A 1LC3A 2AMLA 5T8KA 4XTRA 2G76A 2IQIA 4AUMA 1EFAA 4GPD1 2EZUA 5BR4A 3VJLA 5C7OO 1V95A 5IYZB 3E9NA 2PUDA 3ERCA 4KX5A 2EHJA 1R2QA 4DA9A 4DV0B 3TVDA 1DTWB 2D0IA 4MOWA 4PM4A 5AHXA 5FBZA 4HX2A 5BQFA 1VPWA 4W9NC 1MORA 3L0DA 2Y9PB 2OM2A 3GD7A 1PZFA 4TM8A 4OF4A 4W99A 1NURA 4ZVOA 4XEHA 1DJQA 3PC4A 3R6LA 2EFEB 2ZRHA 1XDZA 4N7BA 4M9RA 3DAYA 4B2LA 3FJ1A 4JYZA 1K8YB 5KINB 2PR7A 1BQ4A 1AS2A 3THRA 1GUAA 5BSHA 5F2NA 3AQIA 1SD2A 4NYIR 1UWVA 2IVFA 2VSXA 3DV9A 1E64A 1AURA 3D59A 3NBKA 2HDWA 3NM4A 3TVYA 1UXOA 3ZE2B 1UMBB 2VJNA 1V16B 2HQSA 2BEKA 3TSZA 4RNCA 4E03A 1X14A 3PQ5A 4JYCA 1A8HA 3K09C 2VATA 3L6CA 1P39A 1U9JA 5TR9A 2OHGA 3OESA 2HIAA 1U9IC 3LG2A 3R0QA 4MUXA 2HK7A 3WGNA 2YHAA 1XNRB 2D2VA 4UEOA 3D6NB 3KBOA 4JDPA 4CDRA 3ZEAA 1P9RA 1GFIA 7GPBA 4MJ7A 4J1SA 1FB5A 2F1IA 3SIWA 2WSYB 3QBEA 5BYBA 1VSTA 2Q07A 1G5IA 4P0TA 1GSOA 5JHGB 3AB3A 1P7PA 2Q6VA 2SHKA 5TEWA 1NQAO 3E7FA 2B21A 3MTEA 1M2NA 4Q21A 2FGKA 2NU6A 5E9JA 4K3VA 5DBHX 5LR6A 3A32A 4Z4GA 3M4JA 3Q7TA 4CLDA 1TIKA 4JLKA 1ZUWA 5C9ZA 4FYIA 4IHJA 1TM4E 1VBMA 4Y1FA 1II8A 3GT0A 3U0BA 1MVNA 3WGKA 3F2VA 1U9CA 4K9MA 1TK9A 2CJWA 2H5JA 2IX9A 2NU8A 4QFMA 4C4RA 2EARA 3CWCA 1YHZA 2P65A 3E2IA 3G9TA 2A0FA 4JODA 4WESA 1WUTA 5E4YA 3RAPR 4MYTA 3MBOA 3FMFA 4TROA 1LLUA 2H48A 3EXIA 1FYWA 1Z7BA 5EGNA 3TQIA 4D3DA 2JI6A 1YRLA 3F6RA 3KKKA 2G6TA 2CLFB 3PTLA 4EKIA 5ALDA 4EAQA 4KK3A 4QYIA 1QTQA 4EKGA 2CSUA 4PFQA 3CZ9A 2XCQA 1LV8A 3NWJA 2IW3A 2J07A 1YRHA 5KUTA 4ZVPA 4EA6A 2RAPA 5FI1B 2CNDA 1YBAA 4D8YA 4BU0A 2UZ1B 4UXHA 5E1BA 2ZJ4A 1GRCA 2GT1A 3JD4A 3NFRA 3QU2A 4HY3A 2R1ZA 1ONNA 2KQUA 4TV9F 2ORWA 4GM1A 4JP8A 1L1FA 2CNWA 3FTQA 4EITA 4EG5A 5LNK6 2REOA 2KI5A 4C3OB 4Q4JB 3S40A 4I4IA 4E5SA 3MWDB 1N77A 2FUEA 5DJ5A 5FYDA 5FBRB 4C43A 1QYIA 1UOPA 1A4RA 1DAMA 3GPLA 2LTAA 1NUAA 5DMHA 1ESZA 3UT5A 5FLKA 3N86A 2C1ZA 2VYCA 1W5FA 3NM6B 4DV1B 1KP9A 4JI4B 1ZZEA 4FKZA 2ZDHA 1KAMA 2FSGA 4QX6A 4YDRA 4WN3A 1PN3A 5T4BA 1H1DA 1ZGAA 5FTLA 1IHPA 3Q6MA 3K53A 1BWRA 3UQZA 2DECA 2D0DA 3OLYA 4G1BA 3FOZA 1AK9A 3E5NA 2HCBA 1GPBA 5LOVB 1HURA 5I7OA 5FUBA 3REGA 4ZCSA 5K1ZA 2GBPA 1NRIA 4H17A 3VKHA 4UHBA 1WU8A 2BMFA 2C2BA 4G01B 4RSRA 2BKXA 5BQPA 5K6TA 4RM2A 2OORC 3AI3A 3QPCA 1ORVA 5I3ZA 1UWLA 2CLLB 1NDQA 1YJXA 3F7TA 4ZMBA 4LJ7A 1K9SA 1QZZA 1E1LA 3EZXA 4AMUA 1T9AA 4R8SA 5IAAA 1IBKB 4OHKA 4QBTA 3A28A 3A37A 1XHFA 4Q4AB 3HYLA 2V1XA 4BMOB 5IM5A 1TJ5A 5CYOA 5JZVA 3GRCA 2QJWA 1V43A 4G67A 3PDIB 4HG2A 1LZKA 4YP5A 5H3CA 1AUVA 4PPFA 3VJMA 3MS2A 4WMLA 3G0OA 3LMKA 1GV0A 3PIIA 2YFYA 3IAM1 3RTBA 1C80A 2EP8A 4YRQA 5HFJA 3DKKA 4AKIA 3SLKA 1OXSC 5KNCH 5DM0A 1JQ3A 2PMKA 1KI6A 4RZIA 3REOA 2NT4A 1D1TA 1O89A 1Z83A 4QASA 1LX7A 1N5OX 5FUYA 3T5AA 1L5GB 4EFLA 5JPDA 3DEIA 2QW0X 2RJ3A 2BN4A 2QGNA 2V9CA 2VJDA 1E0JA 3V1KA 1OWNA 1RPTA 1D2RA 2C5SA 4C7OA 1PV1A 4LFBB 1WVGA 3W2HA 4QGGA 2E82A 3B70A 2W2NA 3E7WA 1KQGA 1KMHB 4YRTA 1GG9A 2VDJA 3K09A 2BFCB 1GTZA 2FQWA 1Z38A 4BGEA 4DMMA 2NZVG 1OAOC 2NQ2C 1GPJA 3MWYW 3C5VA 1F2DA 4HH4A 1ZD1A 1IPFA 2JFWA 3LAWA 3SSNA 1Z5WA 4LHYA 4EGJA 1JVSA 1QZTA 4XX1A 1PTKA 1NW9B 4ABYA 4RV9A 2AVNA 3MXTA 5HZMA 4W5RA 1NYQA 3H3JA 4RETA 3NWPA 1XPOA 4EHNA 1WW8A 3L49A 4B4UA 4IJWA 1P7VA 2PPLA 2IP1A 3K9WA 2P35A 4EHDA 1R0RE 1NQXA 3TDKA 2HW8A 1E2GA 3IMEA 5EIFA 1MT0A 1XPJA 2UYHA 4Z99A 4ZEXA 2Q5EA 2J41A 4IWXA 4N6NA 2C2KA 3MCTA 4EFNA 4K9SA 1YVUA 4ZO9A 5ILOA 2E7ZA 1JL3A 3OZXA 4KLZA 1OB5A 3LJKA 3N0RA 2JD2A 3LQKA 1U28C 1ZQ9A 3EMVA 1R10A 3K0BA 4ND3A 5DCWA 5LZ8A 2C95A 4RIIA 5EZYB 4DQXA 1KZ7B 2YYSA 4B7XA 4FONA 4LW8A 3TZQA 3UKDA 4JA2A 5KHOC 3TJRA 1J5XA 3GUVA 4EKDA 1C1XB 4YCDA 2FZ4A 4RDXA 2QD2A 2QVGA 4ZEMA 5KNDD 1GARA 1GHTA 3PPIA 3Q3CA 3DPSA 4MQBA 2OYSA 2FZEA 1P44A 3QKTA 4WVFA 1Q19A 4NBRA 3KB2A 4DM3A 1S3GA 2IUFA 3N2GA 5G4KA 4DSUA 1Z0SA 2YXEA 4BHTA 2FW0A 2Q2VA 5F4BA 4A2PA 2X6RA 9LDBA 4Q93A 5AKLA 1KSGA 1SCNE 1J24A 4XQGA 3HVHA 4NFHA 1QE3A 3BBPA 3I04M 4C0JA 5MHTA 4KYVA 1LF5A 2J4CA 3UHAA 1THGA 1LQ2A 2QN1A 3JASA 1U1FA 3FPCA 2ONZA 3VR5D 5IKPA 4KHPB 1WTAA 1J5PA 2C00A 3UUFA 2XXAB 1CLEA 3A4TA 3WLRA 4UE6A 3SYLA 1WXFA 2ODEA 3EFEA 2GS9A 5CJ2A 2C3YA 2V96A 3BL5A 2BZGA 4U7JA 2NVWA 5ES4B 1U0GA 1I6KA 4IV5A 3BA6A 2E6UX 3LA6A 4BVFA 4HXFB 4DVGA 1UJCA 5CAEA 2O5EA 3IPXA 2HADA 4R2WA 1GTRA 1VE5A 1M1NA 3I34X 4BFLA 3DMDA 3TEJA 4A4DA 1CJBA 3F74A 4IR7A 1Y37A 4KAFA 1MNQA 4QSHA 3RVLA 4DC0A 2C4VA 3B1ZA 3U1TA 1N0HA 1O94A 4FR0A 1KI2A 2LDBA 4LZJA 4MCHA 1ZS9A 3JZAA 4JOBA 5EP4A 1QX4A 4ENUA 5L3VA 5AVOA 1NNUA 4RELA 3E82A 3M1YA 3WTCA 4TSFD 1BVYF 3UJPA 4B4OA 1TMOA 1T5HX 3GJTA 3RM3A 4BVLA 1DGQA 4XUDA 1GGVA 2EZ8A 1MQSA 5T4HA 4LYGA 1T4CB 4II7A 3WHLA 3AX6A 1U0OC 2XTJA 1D09A 4BEBA 1APBA 4J3JA 4ECEA 4NV1A 1XAGA 2FDXA 2BLLA 3BN3A 3GNTA 1WS6A 3BB4A 2GM3A 3L01A 4UTXA 3SS7X 3UICA 1TKCA 5KPJA 1KSJA 1NUSA 2O8CB 2B25A 3QUCA 2HNKA 3D3KA 3FPEA 1OX4A 4UBNA 4UUBA 1LPOA 1DIBA 1NVVQ 3KKQA 1ND5A 1XRPA 3L0ZA 4LCBA 5IDYA 3SYMA 4OGLA 5DZSA 2GSWA 5EPEA 4D0NA 1KEKA 3VO9A 4WY5A 3JY6A 2IK8A 3PNQA 3MPUA 1VHJA 3OTHA 5CB0A 5I7VA 10MHA 2QD5A 2F3TA 5AVTA 5C5CA 4IQ0A 4JX9A 4A23A 3RYCA 3OFND 1V26A 1JALA 2H9YA 2JA2A 4U3JB 4ARSA 4R6WA 1SXHA 1AG9A 1B6TA 2C58A 2RHRA 3N8KA 4MQ5A 3V7NA 3ZKAA 1T4DA 2ZQ5A 2X9NA 3KVNA 2XLBA 5J63A 1E2BA 3UY4A 4JVSB 3ZGVA 3CEHA 2GNAA 2ZR7A 1VJRA 2OSVA 3KKPA 4J0KA 4CV3A 2C9MA 2H3HA 1E3EA 4KFUA 4BCBA 4OAPA 3O75A 1TZKA 3ZW9A 3K0CC 2YV2A 3BCHA 4KVGA 4XB2A 1YKFA 1ZNQO 1R5JA 2OWEA 3O9VA 4MR8A 3CEMA 4K6CA 4TVOA 3JVEA 3J81k 3A6GA 3FPKA 3I5MA 5A9TA 3TJZA 2H0AA 2JLRA 2Q29A 1KAHA 2H18A 3TNLA 1ZESA 4R68A 3ZWAA 2H1IA 4DBLC 5CIYA 3AO0B 4XTCS 4G5SA 1F14A 2WP0A 3PF9A 4GICA 3EZGA 3IAEA 3PUYA 1QVWA 4C1BA 1OZFA 1LNZA 4DR1B 4OQ4A 3QPBA 4YT4A 2JGMA 1QH9A 2O6LA 4HGOA 4HYEA 3GZ4A 4JBYA 4OHBA 5BSFA 3QX9A 1CHDA 3DPIA 4GMDA 3KQMA 5A5GA 4NG5A 4RHYA 2MMGA 2W37A 3KJZA 3QNMA 4RFSA 3S2GA 3WWYA 3P52A 3ZWQA 5K0BA 1CUHA 4RUKA 4QNNA 4F92B 3HNOA 2C2WA 3GEBA 4DIUA 2QIPA 4G4IA 3RRXA 3SJAA 4JVLA 3U3MA 1EFRA 1DV2A 3F4BA 4GMKA 2CHUA 4IH1A 3ND8A 2EIHA 1IUKA 4L50A 5DX0A 3JV7A 5CU7A 1FFDA 5JY1A 4KXUA 1RZRA 4RPHA 4UM5A 3OZBA 4TN1A 5EXEA 5KDDA 4G0OA 1TDJA 4QO7A 5E8JA 4A6PA 4YV0A 1R8XA 2WD9A 2OTCA 5JYCA 5TPWB 4D99A 2VR1A 2H2IA 4EZIA 2QSZA 3N3BC 4S12A 1U94A 4UUMA 4TQUS 5BRAA 5IZCA 2C1XA 5HX7A 1AKYA 1J8VA 3VPSA 3Q8MA 4GQBA 1M74A 1M2GA 1OXMA 4D4KA 2JGJA 2PT5A 3GEHA 1IZ0A 3PXUA 2QJRA 4R05A 5SZKB 1RLJA 5TNXA 1W5BA 3UJNA 3QVWA 4ZVQA 4W5HA 1QP8A 4M7RA 1QE5A 3QHQA 2QMZA 1GYQA 4Z0NA 3UXEA 5JXHA 3AL0C 3HJFA 1P8JA 2PD4A 3FCAA 4KRFA 3DBRB 1RYHA 1TPYA 1G18A 1AOXA 3ZIDA 2YIDA 1ADYA 1CUBA 4G5OA 3ME5A 4GXRA 4KR3A 1E6EA 5CEEA 1MFPA 2WVJA 2GASA 2ZW9A 2GNOA 4HH0A 5KOYA 5AVJA 3AVWA 3HVJA 4ZT7A 5AJHA 4I9UA 5HFAA 3NIGB 3U9LA 4C4ZA 4XCQA 4G0VA 1WHTA 4PXYA 1PX0A 1FFBA 3EVAA 1SVMA 2PS3A 1KQFA 1UM9B 3OEWA 4PC7A 2CJFA 2VYVA 1EK6A 2VBCA 2XA2A 3O8QB 4AP9A 1C0KA 3VU0A 4P4GA 5JALA 3CNHA 5SY9A 3X1DA 3OIYA 4MVJH 4Q01A 3CISA 1MJHA 1TYAE 8OHMA 1RXUA 3STHA 4YP6A 1J90A 2VDRB 3SR4A 2WF9A 5FWNA 3ROMA 3ZBPA 3BXZA 5F1PA 5GJWC 1JAIA 4K88A 4MWTA 3UJ3X 5CK5A 4IMRA 2FFAA 1EGHA 1OV6A 4L95C 4Q47A 2QN7A 2ZIZA 4ZQBA 3TKYA 1WZNA 4HQFA 3MUNA 3I37X 3U7FB 2AWNA 4EG7A 4MUKA 4EHFA 2E4AA 5IM4A 1T29A 4RBNA 3KYBA 5DBIA 2R87A 3CE9A 3UXHA 4C4YA 4CM8A 5L45A 4A82A 5FF9A 1JVBA 3G2NA 2F62A 2BAGA 4CLOA 2DQKA 4DMUB 2Q8NA 4JOSA 1KBOA 1GYPA 3G02A 4W4TA 4WFKA 2OOSA 3B7PA 3ZE0B 4YRRA 4B6EA 4F45A 1NLYA 1W581 4MA5A 3C70A 4HLCA 1OYOA 3UXMA 2QX7A 2AUNA 2WMNB 3G2LA 3LX4A 3WGQA 4CKCA 1D0IA 4EVIA 4Q7LA 4HMOA 1NN0A 4JENA 2H7VA 1QR6A 3QSYA 3CLTD 3PLRA 5AW9A 3SY8A 1VI5A 1Y8ZA 3QFHA 3EEOA 2XB2A 2JLSA 2VT2A 5LKRA 1C41A 3T1NA 4RFLA 4RTLA 1GILA 2ZTUA 4NS1A 5C46F 2JCYA 3QLUC 1JV2B 4M9SA 2YYYA 2IPMA 3BDAA 5EEGA 5EZYA 4R8RA 4CCYA 1JWBB 4W7IA 3B13B 2FUG6 3V1NA 3QWFA 5BMVA 3AM4A 5A0TA 2CC2A 3DYIA 3EOBI 4B8YA 4XJVA 3OO1A 1N2CE 3LC1O 2Q7OE 5AVKA 4B3FX 1W9HA 2H2HA 3HDHA 5CM9C 1QU2A 4C29A 4IDDA 1L7EA 1V5WA 4NYJQ 4R9NA 2C97A 5DXAA 5I3CA 4DOMA 2W4MA 1OYVA 4KJZA 4M6WA 5FPSA 5IN5A 4D9CA 1MEOA 2X7JA 1GYRA 2D5CA 1PDOA 2ISCA 3PITA 3MG9A 4LXYA 3VU3A 3L7AA 2I87A 4WXEA 4M1KA 4L3OA 1Q0RA 1YQUA 3STXA 2NNLD 3OU6A 4KL8S 3SEAA 4RVFA 1RWXA 4DVJA 2R1TA 2F4VB 5K8UA 3H8VA 1TC2A 3K7EA 2WICA 4WZ6A 4D4HA 2GYYA 2H8GA 2GN9A 2XYPA 4PLGA 2WPDD 4RA9B 4CQNA 2XXAA 1RKBA 3SF0A 3GFPA 1VKRA 4A1FA 4L9RA 2W2PA 4FGUA 3S1LA 1VBNA 3Q8LA 2W6ID 2EGHA 1EX7A 1ZBQA 1N2BA 4C22A 2CY0A 3DWGA 4LJLA 3B48A 4R41A 1Z2DA 4W1SA 4JBGA 4R6XA 3VPFA 2RK4A 3A7EA 3GI1A 1M1NB 4PYNA 3I09A 4UMFA 5GTDA 1T5OA 1YRBA 3LCVB 4IDEA 1PFYA 3WGVA 1OH7A 5ENDA 1E66A 1FS5A 1GGHA 1N5JA 1SVWA 4ODIA 4XB1A 4Z9FA 4ENQA 2H2AA 2E4WA 3E3NA 1YULA 5CNJA 1T4BA 1XMVA 2OQIA 1JZSA 1FMFA 5DNEA 4JV5B 1ADFA 5EWMB 1GT6A 1NTOA 4AZ3B 1KSFX 3TW8A 2E1PA 3G9XA 5JHHB 1XHEA 4HFMA 1AXRA 2ZJ8A 1CZHA 4KI0A 4O33A 2HIMA 4YCMA 2H0RA 1FP2A 3NOOA 3KWMA 4F6LA 1YUBA 3QVMA 1QS0B 4FS3A 2H4YA 2VUHB 2HD4A 3OZGA 5FO0A 1X7YA 1QK4A 4ND1A 5IASA 3LBIA 1F6BA 3OQ6A 3MMPA 2BCJQ 3UQYS 1T4CA 2FZLA 3JW8A 3L8HA 5JD4A 4YMLA 3ZY4A 3R7LA 2WHYA 4DGQA 4IUCS 2BY4A 2WU4A 1WHSA 5HIKA 1KK3A 2D4HA 3FCXA 4HYQA 4N12A 5DE3A 3ZWMA 4C2BA 1KK1A 1Q1ZA 5K51A 1T1EA 2ZUCA 3WAKA 2BKUA 5L53A 5LLTA 3CV3A 2B6NA 4LHWA 4XJSA 2VA8A 3OHSX 1AB5A 3KXPA 3C8DA 1X7GA 3B53X 3FRIA 4DFDA 1RXWA 4NEHB 3VKGA 2VQ6A 1Y3IA 2CVHA 2NV0A 4Q9LA 3WV5A 4A0RA 1F48A 1ZC3A 4Z6KA 1CY6A 5KWIA 2DFTA 2FDRA 1E4VA 1EXWA 3AUUA 3Q6NA 1TT5B 3EGOA 3KKMA 4WKNA 5AM0A 3V4VB 1AA6A 3CG4A 3EYAA 1T1RA 4RAQA 1BQEA 1B8VA 5JMWA 3NS7A 2VRCA 4ZZ0A 3DTVA 5AI0A 1ISGA 1K5GA 3V8VA 2NQ8A 3WIUA 4BIIA 2IU0A 1V3TA 2I7DA 3RKSA 3EWSA 2ZRLA 2WTMA 4JELA 4Y2SA 2ZI7A 4OJTA 2QRPA 3WGGA 4AMVA 2IDJA 3PQFA 4TWRA 4RIHA 3ZHTA 3KQNA 3PFIA 1LKZA 4I6JA 3ZQUA 1ZLYA 4AO6A 3D4IA 1RZ3A 3NEPX 1Z16A 2KSQA 3KS9A 1DAFA 3VDRA 4F2WA 3OJWA 1N6NA 1S89A 1IJKA 1XYVA 2HJVA 4R83A 2O2XA 3FDZB 3KRTA 1GZSA 2FMHA 2JLCA 2WIKA 3LGXA 2IUEA 3R3VA 4C0AC 3HJTA 1XDGA 4RZXA 4I1YA 1W75A 3BWCA 1MN6A 1E7WA 2PDAA 2AQKA 1BXZA 1NBME 4U2FA 3C85A 4V39A 1T0BA 3BHMA 5ERGB 1LV7A 3WQHA 1R4NB 3ESXA 3KEOA 1KEUA 2BEVB 5CNMA 2UZIR 5JQGF 2BFOA 1J1UA 1P4GA 4JP5A 2R11A 4DL9A 3JWEA 5F2KA 4KO2S 4R54A 4B6SA 1HF3A 3GL9A 3S68A 4DLZA 4D45A 4UTNA 1KI8A 5ICSA 4DCVA 4RJ2A 5C52B 3DEZA 2ZWVA 5ECWA 3ZV6A 1J70A 2VRBA 4XUGB 4DIMA 2IC5A 3JAKA 4DUZB 1A9QA 5C8VA 4QAQA 1CUUA 1FFGA 3JD3A 3LK7A 5FTJA 2FFRA 1EIZA 1FDRA 1JQLB 1X1QA 2ZXEA 3HA3A 4TTTS 5SZIA 1W36B 2PMFA 5EWLA 1Z62A 1WY5A 4HYYA 3RRYA 3PWZA 4YO7A 3BXOA 1I24A 2CMKA 1I2AA 3GEPA 4E15A 2R5WA 2WKSA 3ZLTA 2PR2A 1M34A 1MO4A 3RVKA 3ZWWA 4X6XA 1KQNA 3VR2A 2A7XA 3FY4A 3KYDA 4CT5A 1MJFA 1YMQA 5BQ3A 4OHVA 2WT8A 5G53C 4PYLA 3SCZA 5DPMA 1FW6A 1CWUA 2WVGA 1M1YE 3ND5A 5DIFA 1II9A 1KAQA 1IN8A 3JYLA 3PXXA 2BGLA 4HN2A 4OLBA 2CL0X 2WFAA 4LSZA 4AXBA 5DNWA 4QZVA 1TMKA 5CFZA 4MAMA 1XXHB 1QVAA 1I4DD 3E18A 1VMAA 3PGKA 3PEVA 1ICIA 1SXJE 3AZQA 3TZBA 4RH3A 3GGSA 3S2IA 3T9BA 4C7VA 4YGYA 1DTSA 2I2AA 3GEIA 4Q1FA 4C7MA 5JNLA 5KVAA 2ZR0A 4GBGA 4C87A 3LNTA 1UEJA 1TM3E 2G9RA 4GU5A 2DQZA 2XVAA 3N8NA 4JL6A 2ZM6B 1SU7A 5EHXA 2QQFA 4ZVNA 2H11A 2NZWA 2QTAA 2H52A 2VHJA 3MWEA 4A91A 2I67A 4G25A 4CDNA 2HMAA 4HNAB 3DHEA 4YMSA 4EZBA 4UM9B 1KZHA 4ZMSA 5KVCA 5DM1A 5DIZA 1UINA 2CL5A 1YRQA 2GCEA 2PZLA 3EEFA 5ALSA 2G1JA 5A7HA 3I52A 4U6NA 4R1TA 1Q0SA 4GKBA 3IE1A 5B3KA 1BMDA 4F3RA 5TB5A 2JC3A 1E59A 1E6KA 4BDSA 1Y5MA 2ZEJA 3H9UA 1I7SB 1OA0A 1P4AA 1RRGA 5BR8B 2JFUA 4HNHA 4K9NA 2EDCA 1LRJA 1L1EA 2I66A 2WYWA 3L0YA 4KC0A 4L6IA 5EP1A 3REQA 2Q50A 4EPRA 2V98A 4DMHA 4B0OA 2VP5A 1D7OA 4LBYA 5BWMA 5AXCA 2DUMA 3EHEA 4ZZ1A 2V6MA 3C39A 1YU6A 4HSEA 4P36A 2IYZA 2QNIA 4HEHA 1E61A 4YEDA 4WNYA 1IQUA 1BJKA 1KXJA 2AI2A 3G13A 4JVNA 4UHCA 2VP4A 4WCVA 1JA9A 1BCSA 1AZTA 4AUEA 3PA6A 3A1WA 4OB7A 4D43A 3ADPA 5DYIA 1XNQB 5AM1A 5E6SA 1C50A 1GD1O 4AI6A 3TVTA 3WMEA 3ROTA 4LXTA 2SKEA 3WL8A 1NVXQ 4J0QA 2W00A 3QW2A 4S2EA 2GEKA 1P81A 2X9GA 2C4KA 3RVBA 3WKEA 1ND6A 3UKJA 4F4JA 3GEDA 3E70C 4ZICA 2F3UA 4IDAA 4CL3A 1NXXA 2NU9A 2VDUE 3UHJA 5J4HA 4QVGA 1Q0UA 2MU1A 3ENKA 2VHZA 4LV8B 3L1KA 4MINA 4RKFA 1GV1A 1FDTA 3WGJA 4F38A 4A36A 2EFCB 2AUMA 1SHLA 1HDXA 1YWGO 4G5XA 1IVNA 2BD0A 1J0AA 2WV7A 2R68A 1PHRA 3H9EO 1AE1A 2Q3EA 4BBAA 3BCUA 4P98A 3W5UA 1A77A 1I32A 4RENA 4E2FA 1WA5A 3RK0A 3L7YA 3BFJA 3NG1A 4JC0A 4HPXB 3GLHA 3C0KA 3BE8A 3FUUA 2QF7A 2UYYA 5EOVA 3W6OA 3HR8A 3P19A 3KTDA 5K3EA 4Y9DA 3ZW7A 2QT0A 3RODA 2AZXA 1NN1A 1OBCA 2RBKA 3QU7A 4HR7A 2F3SA 1UJMA 1L5ZA 3I01M 4ONEA 2P75A 2ZGVA 3IE2A 3OMXA 3SQLA 1KTVA 4JL8A 4PVDA 5BWBA 3MNFA 4G1CA 2JCGA 4HNSA 2PNFA 5TMEA 3CVXA 2UZ3A 5SYNA 1WBDA 1XRSB 1WV1A 1ZEMA 4GOJA 2GUWA 3PIRA 1IYZA 4UMDA 2Y0DA 3MBKA 4MKFA 5TQ2A 1LPAB 2AA3A 2O7SA 1FFCA 1T15A 3BMOB 4V0LA 5F98A 5I9MA 1E98A 2CDBA 2BR4A 3GVPA 4TMZA 5E7JA 3RS8A 5JNVA 4TS1A 3I6BA 1RYFA 3PNLA 2W2MA 1CZOA 1DU4A 4RPCA 4JI2B 4BZZA 5HJ7A 5KZMB 2BDTA 4M36A 2H2DA 2LUOA 2O59A 2WDPA 1G8HA 2RI1A 3HCNA 3T7IA 4TL6A 4O5AA 5IVIA 3CZ4A 3BWVA 1NVDA 1PYDA 3PDUA 3R0XA 2JG3A 2O0HA 3PFBA 4BO0A 3DKPA 1W36C 1BXRA 1K6JA 3KWLA 1DO0A 3HXTA 1R4MB 4KWCA 1H2YA 4M1SA 3S4YA 5IWCA 3LQYA 1WUKS 2X15A 1R0BA 3AOEA 4MW0A 4EA7A 5IN4A 3AYXB 3DVAB 2C07A 3B1JA 1GPNA 2B5OA 4LG1A 3U7IA 1N33B 4BAZA 3CE6A 2I3DA 4OQPA 3T61A 3LUDA 1NVWQ 3C1TA 3ND9A 2F6RA 4HWRA 1TFRA 5B58C 2O8VA 3MUOA 3N87A 3ZDBA 4RW0A 1MX5A 3TTTA 1MOPA 1NBMA 4UDOA 4KVFA 1R74A 3WLJA 2GXAA 2O8BA 1ZVJA 5KVVA 4M1EA 3GVIA 4QM7A 1KFKB 3BD7A 3K6JA 3H5AA 1L4HA 1QIJA 5IZ4A 3K5HA 3DKVA 2B4YA 1YIAA 4B3TB 1YU9A 2OCPA 4QOSA 3CNLA 3KLBA 5FWYB 2Z8ZA 3Q7IA 1Y4AE 2OZVA 2WMOB 2ZUWA 3SOZA 4EO7A 4J3NA 2ZUTA 5AQEA 4E5MA 2J0VA 1NE2A 3TIGA 1CUWA 1HKHA 4DAEA 2HQBA 4HWSA 3T3DA 1BWSA 3OICA 1GUZA 1KKMA 4BV8A 4CKYA 5JAZA 5KYYB 3GLFE 1AVTA 3B1VA 3NBZC 1K0UA 3LUBA 1UBHS 3OLCX 3WLMA 3OE5A 4B4KA 4DZTA 1H2BA 3EFBA 5IZCC 2CHGA 4TKLA 4OFBA 2BFDA 2HMTA 1AHNA 3P45A 4PAMA 3THYB 3IHKA 4ZCPA 5CBKA 1B2LA 3DUFB 5KTMA 4E14A 1CS4C 4S1OA 1TUEA 4DJ5X 3ZJ5A 3QLUA 3GR6A 3KB8A 2PMWB 3CVVA 3HHEA 5B3AA 2KM1A 2P79A 1XU4A 3NGMA 4TWAA 2X5NA 2PSSA 2PLWA 4QVIA 1Z17A 5FDFA 4N48A 1Q16A 2BGGA 2BGNA 1KNXA 1QHEA 3H2YA 1MAWA 3BXFA 1ZMBA 2VP0A 3BQMB 3ER6A 3QQ5A 4MB6A 5G0TA 5KIAA 3KEFA 3U1BA 1ONSA 2C2YA 1Q7CA 4UBOA 5JZOA 3AFIA 3K9NA 4ETMA 4YCSA 2VG8A 3GFBA 1HSOA 2A88A 5CVVA 3O93A 1A76A 3IBCA 3V8RA 1JN0A 3GUHA 1JLHA 1YOBA 2VKTA 3IMGA 4EW6A 5JYEA 2PUGA 3NHPA 5EUQB 5ITZB 3HN6A 1E3QA 3TD2A 4D8VA 3JQAA 1TD9A 3AFHA 3H3FA 4FFNA 4GF5A 4IYJA 4LDJA 4RCZA 2ISSD 5JMTA 3FWNA 2O3RA 2ZSEA 3GJSA 5BQ5A 1EXNA 6ABPA 2JZOA 3EIWA 5DOVA 3E1GA 5CYGA 4P84A 3IILA 4I3GA 5HUHA 5E3HA 3GGPA 1U0FA 2GWHA 3CJRA 2XCSB 2PJRA 2QNRA 1MKYA 1Q15A 1LQTA 1SFRA 3SJBA 5LDDC 5B5SA 3QXSA 1H22A 1HYHA 1HYBA 1QGAA 1Z4PX 2OAP1 1PGOA 2JAQA 4Z2AA 3KYDB 1F12A 4RMHA 4WLVA 4KPFC 3NIBA 3G8DA 4KE6A 1UBOS 3H16A 2Q41A 4X7BA 3R4VA 1HDEA 2E0IA 1KL7A 1N6LA 2CCKA 3GJ8A 4XD7A 4MI3A 3T34A 2I7VA 5AW8A 1PGJA 5LUBA 4D56A 2JFXA 1HTBA 2JIOA 2CNBA 4K6MA 2P2SA 1QM5A 4I55A 4J2OA 3OCYA 4RK4A 4XJTA 4I4TA 3P5SA 5EI5A 3U3JA 4JJ4A 3V7FA 4EI7A 2WVHA 2XODA 4ZOAA 4F3KA 4HJRA 1BD4A 4WLOA 2P1DA 2VI5A 4Y9RA 3ZHVA 4NHOA 1BGVA 1FRFS 1M8KA 5CH3A 1W73A 5C1BA 4QTTB 1A8PA 1WQ1R 2P3LA 3H6HA 3MW8A 2O14A 4RY2A 1HDRA 5AK5A 1OFIA 2FPIB 5TQJA 2BBSA 1MG0A 1W29A 1OY1A 4OBBA 2PUVA 4PS1A 2AJCA 5FLYA 2AN1A 2WYHA 3PEWA 1IXKA 1FDWA 1R27A 4MUYA 2QX6A 2FVXA 4FZRA 5F76A 4IP0A 4X61A 4LYFA 1UK6A 3CSDA 1RXYA 3CUUA 5I47A 5IXJA 2VXCA 3QY9A 4EL5A 4UU1A 5I48A 3KU4A 2FF5A 3K4QA 3GJ0A 3DO8A 2HQOA 4DIDA 4WCFC 1PWEA 3OOEA 1N6HA 1XA0A 3KZKA 3NRCA 3HL0A 1A9OA 3LLUA 4ZRNA 4QPZA 1A96A 3RVJA 2ICAA 3FSRA 1FW8A 2C4MA 5EQTA 1XMOB 3CX3A 3FH0A 4J8PA 1NNSA 4TUYF 3GCGA 2VOJA 1XLTA 3H87A 2G9UA 3H17A 4PFSA 3P9YA 3UGKA 3IRUA 1NRJB 4XIFA 3VUEA 3KLPX 5CR9A 2GD6A 5BW6B 3WICA 4HX9A 4NAUA 3UH0A 1UP7A 2C61A 1QG6A 3LIPA 2KW5A 4IPTA 3PWSA 3IP8A 5EP3A 3ZK8A 4UFNA 4KDCA 5HF9A 2EU8A 5DP1A 4HDCA 2O2GA 4O4LF 1WVIA 2PE5A 2BYTA 4XIIA 2ZPTX 5I6DA 5DGXA 1SCKA 5L3ZA 1Q2XA 2JLAA 2FRVA 2UUPA 3QFFA 3VPBA 3N39C 3HDTA 5IDXA 5K4HA 3QG1A 5AOVA 4FJ1A 1SUCA 1UJ2A 2L18A 3VSAA 1ZG3A 3PEFA 5FI5A 1G5HA 2R5NA 5DN6D 4QARA 1ZJWA 1T9DA 5HGXA 4E3WA 1Y8RA 4E33A 3HXMA 4FIZA 4TT8A 4XGQA 3KQKA 2I2XB 4MIKA 1N1EA 5HS4A 5KB3A 3WJ2A 3ONFA 4F5EA 1YD7A 4KN5A 5EMMA 1MW9X 1S3SA 3WJAA 3KLNA 2PAAA 4MJXA 5A9RA 3PKZA 2G3YA 3KJXA 3I30X 1US8B 3FAZA 3MGGA 3OTQA 4I0WB 5EPOA 5CLJA 4R8MA 3ELWA 1A04A 1NF2A 1XWWA 3S28A 1G8FA 3ITDA 4A8TA 5AVZA 4KLCA 3QPDA 3G2KA 4OO3A 2O4CA 2V4ZA 3BD9A 3PBKA 3TLJA 4Q00A 2BISA 4GX1A 3M3HA 1K2VN 4KCGA 1JJAA 3GDHA 3AR5A 1DXOA 1K66A 1A5AB 2HPHA 1V16A 1NBIA 1AIPA 2QU7A 4K6HA 9ATCA 1NR1A 2H0QA 2ZAYA 5EIOA 2P0EA 3LL4A 4JEIA 1C3EA 2YN2A 2HA4A 2ORVA 5B7PA 1QK5A 4ZIRB 1DELA 4URXR 3CZQA 3HBJA 3ODPA 5C5IA 4IX1A 3CR3C 1Q0HA 3IOYA 4LY3A 3E9DA 5FYQA 2HCRA 1VE1A 3WHIA 5I9IA 2ZSJA 4JT4A 4LYEA 4WFQA 3SZLA 1V4VA 3QIAA 2FCAA 3DP9A 1GZ5A 3V4PB 4CT0A 1KYYA 2G04A 1W25A 2F43B 2O7RA 2R47A 3HCFA 3NVMB 4F8YA 6AT1A 1TC1A 1NSTA