4Z49A

Homo sapiens fatty acid synthetase, thioesterase domain at 1.7 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
262
Chain Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Fatty acid synthase
publication title Estimation of Hydrogen-Exchange Protection Factors from MD Simulation Based on Amide Hydrogen Bonding Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 262
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 4z49A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z49A01
5C8ZA 3C5VA 4OU4A 3DYIA 5JATA 3O9MA 1EINA 3CXUA 3D2CA 2J4FA 1UT6A 2XT0A 4F60A 2QVBA 3F96A 1KEZA 5AM0A 4DNPA 1W75A 1BN7A 4FDMA 3CCCA 1J1IA 4E46A 2DSNA 3WKEA 2HA6A 5EIAA 4YX9A 3KD2A 2QT9A 5ALNA 2XLBA 3C6BA 1VKHA 4RGYA 3RKSA 3EQ7A 4MWSA 2XQGA 1JI3A 4UBMA 1CUEA 5F4ZA 4Y2PA 3VXKA 4U2BA 1EXWA 4G5XA 2HA4A 2O7RA 2HHAA 4PSUA 4BCBA 3C6YA 3I2GA 3D5EA 4JYPA 5JZBA 5A7GA 1CUAA 1DWPA 4U2DA 3PF9A 1P0PA 1QGED 4BDTA 5ALEA 1XZAA 3D4LA 4GBGA 4OD0A 1YCDA 2WG0A 2H1IA 4P92A 5IVDA 2O7VA 2DR0A 1Z68A 4C89A 4KAFA 1XRRA 2HA5A 5E4TA 4U2CA 1AKNA 4FBLA 3ZWQA 2PSDA 5AHXA 1CV2A 2R8BA 4X7BA 4Y2UA 3R3UA 4RNCA 5SYNA 2PSJA 5BWBA 4QWMA 4H35A 3C43A 3QH4A 1XQYA 1FFCA 2OGZA 2JEZA 3C45A 4B81A 2Y2UA 3GROA 2GZSA 1E8MA 3Q0TA 2RHTA 1TCBA 2OXEA 4IH9A 4MXDA 4Y2TA 1H2ZA 3C8DA 1T4MA 1R1DA 1XZHA 1JU4A 3FWHA 3WIBA 5LZ4A 2ZJFA 4Q3KA 3ICWA 3LIPA 5ISMA 4DNQA 4J0CA 5CH3A 3P2MA 5AI9A 1XZCA 2H7CA 4L9AA 2XMRA 1GKLA 4A5SA 1CEXA 2NW6A 1MPXA 1ZIXA 1XRPA 3R41A 4H18A 5AKIA 2JGJA 5AI8A 1H2YA 4X93A 3WZLA 3D7RA 1ORVA 2CMFA 4QDOA 3B5EA 1QZ3A 4JEIA 2GYWA 5I8PA 2OQVA 2XQIA 4DMHA 5C8VA 1XQVA 1YASA 2JBWA 1UK9A 3WWOA 3B12A 3FCYA 3VDXA 1H2WA 3W05A 3H2HA 1LPAB 3FCXA 4Q82A 3WWEA 5JD5A 1LPBB 3LIIA 3D2AA 4Y2RA 4PNZA 2QKYA 4J0GA 1CUWA 2C0PA 3E0XA 1CRLA 3PFBA 5KBYA 3GFFA 4FKBA 1GKKA 2FJ0A 3F97A 4IQ4A 5IKXA 2G5PA 4K6KA 4LIPD 3DLTA 2ECFA 4ZWNA 4UBKA 4LKOA 2XUGA 2GYVA 3DNMA 2C5FA 2Y2VA 4WJLA 2WFLA 5AJHA 4CG1A 5EI5A 3VKFA 5BV7A 2ZYHA 3W04A 3V1KA 3I28A 4DMKA 2RIPA 1GQRA 3QYJA 1VA4A 5AOBA 3HC7A 2E3JA 4K5QA 5AP9A 4EB0A 3STYA 4X3CA 4BE4A 2QS9A 1UOOA 3G9UA 5LLSA 1BS9A 2AJCA 3QBJA 4OYLA 4P08A 5DJ5A 3WKCA 1DWOA 5ALKA 4X90A 2V98A 2XLCA 2WU4A 1THTA 4DLNA 2VT7A 5ALJA 5H3HA 2R11A 1MAHA 2CEKA 5AI6A 3FBWA 1UKAA 4I4CA 4FLEA 1VA5A 4UFNA 2XUJA 5KWJA 4H7EA 3E4DA 4DNFA 5CURA 2Z8ZA 1LPOA 3M81A 1AGYA 2OAGA 1QJ4A 1NX9A 4KEAA 1GGVA 2JGFA 3WIOA 2WG2A 5DYWA 4WY8A 2PUHA 1MJ5A 4L3WA 1QIEA 3VISA 3C70A 4L72A 3WK7A 1N1MA 2WUDA 2D5LA 3BWXA 4J0KA 2WTMA 5BWCA 4BAUA 1AMNA 4BDSA 2D0DA 5A7HA 4BP9A 3FSGD 1CUSA 2ACEA 4FBMA 4UBIA 4G4JA 3AUKA 4C4YA 1DX6A 4ARAA 1USWA 3ZV7A 2VJAA 5LYYA 1CUVA 3AZQA 4B9EA 5HK8A 5EGNA 3FOBA 4P93A 4CCWA 1CQWA 3CN7A 5AM1A 5HK9A 1K8QA 1QO9A 1R9NA 2XUQA 4X94A 5DYYA 1WHSA 4PSDA 3G9ZA 1MX5A 1CUHA 2RI6A 1X70A 1FJ2A 3G02A 4Y2QA 4L0CA 2WIKA 4J0JA 3HYSA 1QIGA 4MYDA 4A16A 5DTJA 2PL5A 1XRMA 5EIHA 5DNUA 4IO0A 2CZQA 4U2FA 2PBLA 2ZJ6A 2XMBA 4Y9SA 3TGLA 5IVIA 5CT9A 4G8CA 3IVMA 1Q0ZA 4YPVA 4X71A 4B80A 3ANTA 4AXBA 1ZJ5A 3O4HA 4Y2YA 3C5WP 1W1IA 1CUCA 1PFQA 4OYYA 3GZJA 3G0IA 2V9ZA 1E66A 3M83A 1BN6A 4LXIA 1GZ7A 2G63A 2Z3ZA 3STTA 5ALGA 3WZMA 4FLFA 3FYTA 4JH0A 1XZDA 4J0DA 4WCVA 5DWDA 3E3AA 2CB9A 3H2KA 2DQZA 1ZD5A 2X76A 5AKKA 1CUUA 3E1GA 1C7IA 3AINA 3QMWA 1XZJA 3NOXA 2H7YA 5ALTA 4AQDA 4BTVA 2H9YA 3I6ZA 5JALA 3TEJA 2EDAA 5AKHA 3H2JA 3HI4A 3IA2A 1DQZA 1CQZA 3WL5A 5LZ5A 5FRDA 5FPQA 4Y2JA 4N5IX 4EBBA 2BUBA 2RAUA 1HL7A 4DIUA 3BDIA 4UFPA 3D3NA 5JZSA 2RGUA 2LIPA 3K2IA 4QA9A 4K6HA 4RPCA 2OCIA 4QWWA 3DJYA 1EH5A 2JEYA 1VZ2A 2Z3WA 2JGIA 3EIOA 4ZREA 5CRIA 3WK4A 1QTIA 3QPAA 4Z49A 2HA2A 2GYUA 3HEAA 1A88A 2HL6A 3WKDA 3R3ZA 5C81A 3D2BA 4OU5A 5AK3A 5ESRA 3HJUA 1R50A 2OCLA 2IIVA 3KOOA 4I3FA 5HF5A 1X2EA 4FTWA 3AJAA 2ZSIA 4HXEB 4ZXFA 3OOSA 3WL6A 5LZ7A 2PPLA 2BUCA 2XQFA 3QPCA 1U8EA 2QOEA 5ALZA 3AIOA 2GZRA 4W1RA 1EVQA 1ODTC 4UBJA 4INZA 3IUNA 4BAZA 2PX6A 3PF8A 3ZI7A 4EZIA 4QDXA 4C88A 2YYSA 2W22A 2FX5A 5EFZA 1U2EA 1VLQA 4HZGA 1K4YA 4KAJA 5FOQA 1R88A 1YB7A 3CCBA 1ZGCA 4V2IA 4AX4A 1O6GA 4CG3A 1EA5A 2HIHA 4GWLA 1G4HA 4H7JA 1A8SA 5YASA 1T2NA 1DT3A 5E4JA 4ARBA 2BUAA 4BCDA 2XQKA 2WIJA 4BAGA 2XMQA 2WHPB 4K2AA 3FYUB 4B84A 3H19A 1JJFA 1G66A 4JYMA 5AI5A 4ZRDA 3WA7A 3IIIA 5DTIA 4KE7A 5AK5A 3WMRA 5AM5A 3O4GA 3MVEA 1ZJ4A 2WFZA 2OPHA 1DWQA 4MWTA 1EI9A 2HRRA 4QNNA 3GA7A 5CT4A 5ALRA 4YK7A 5EIEA 4BC0A 4E15A 2PU5A 3UUEA 1Y7IA 1CLEA 1FSSA 3BDVA 5FP0A 5LZ2A 2YH2A 5AKXA 1WB5A 1DT5A 1P0QA 2GBCA 4X85A 3VJKA 1VXRA 2BAGA 3F67A 1XZKA 4G8DA 5CH5A 3EF3A 4PSCA 3EBLA 4N8SA 3I2KA 4X95A 4Q34A 4XIIA 3VJLA 4BTLA 2OCGA 5LZ9A 3I2FA 3UMJA 3PI6A 1WHTA 2FJPA 5IH7A 2YASA 1CUZA 5CXXA 3WKBA 5HQ3A 1QO7A 1BCRA 3C6ZA 1IUOA 4CCYB 2OG1A 3O0DA 1EDBA 4HXGA 3ZLVA 2I3ZA 4H7DA 5AK4A 4BVKA 2VEOA 2XUFA 5KWIA 2WKWA 2JGMA 1XZMA 5ALWA 5LP1A 5HF6A 1VOTA 2HA3A 2WUGA 4PW0A 3QITA 3UUFA 5ALVA 3DEAA 1SCIA 1MX1A 1XZEA 4P9NA 1XKLA 4X91A 2B61A 2QJWA 1VE6A 1TKRA 5ALXA 2XMZA 5K3FB 1XLWA 2WQZA 2XUIA 3WWDA 3JYHA 1XZIA 4XVCA 4AZ3A 5HCUA 5IVKA 3K6KA 1UZAA 3Q8WA 1MU0A 2PU7A 1O6FA 1LPMA 4N8DA 4BZWA 4AN0A 1SOMA 2IX9A 2WSLA 1HPLA 1N8SA 4BRZA 3BJMA 1UOQA 5AK6A 1HDEA 1XZGA 4GI1A 1MN6A 4X97A 4UHEA 1BROA 1EHYA 2QUBA 2WTNA 5AIAA 3QZUA 3AZPA 2FUKA 6YASA 1U4NA 4CFSA 3LS2A 5ALOA 2QZPA 1AUOA 4KR0A 4GW3A 3ZPXA 1UWCA 1QOZA 5ALSA 4MYSA 2JF0A 3RLIA 1ZIYA 1QTRA 1FFBA 3ESDA 4J7AA 4IHAA 3STXA 2BGNA 3H18A 5CTAA 2WJ4A 5AM2A 3AIKA 4HVTA 5AKYA 1EVEA 2VT6A 5JD4A 3STVA 5AKGA 2XB6A 1N5MA 4Y2XA 1UFOA 4KE9A 3ILSA 2C4HA 5FV4A 4KE6A 4ROTA 3V48A 5JIBA 3WKAA 3DKRA 4QE3A 4ZGBA 2HU5A 5J3JA 1EK2A 2WHQA 2XUAA 1CVLA 2ONCA 3BL8A 1XZBA 3OTQA 4BB0A 3BE8A 3H2GA 3T4UA 4EY5A 3IUJA 4G4GA 1JMYA 4DMCA 1BEEA 2VJDA 2XUOA 4EY7A 1IZ8A 1QIKA 3OC0A 1AZWA 1ZOIA 3BJRA 5K3AA 1UKBA 3V1MA 4EHBA 2XQJA 3RM3A 3HACA 4TVKA 4FFWA 4I19A 4C6HA 1EDEA 1A7UA 1D07A 4YASA 4H0CA 5JAHA 2WILA 5LIPA 3BXPA 2XE4A 4CIBA 2I78A 1U65A 3OPMA 5JYCA 1MX9A 1EB8A 3PFCA 1ZD2P 2Z5GA 2WHRA 1LZLA 4B83A 3U1TA 1JT2A 4UBLA 2HA7A 4EY6A 1ZICA 1VJ5A 5KREA 2DQYA 3WYDA 1MNQA 3STUA 3I6YA 5CT6A 5CXUA 1GT6A 4UUQA 2HU8A 5BOVA 3K9BA 1TAHA 2XUPA 3O9VA 2QJRA 5I7UA 3SC2A 2G4LA 2GBFA 4X6YA 1G42A 4KRYA 3DDUA 1CUXA 4WFJA 5C7YA 5AO9A 4KE8A 1MTZA 1E8DA 1IUPA 2WIFA 3QVMA 5HFAA 1J06A 5IVHA 2K2QB 1CUDA 4UFOA 4ZV9A 2BFNA 3PUIA 5JANA 3WQHA 3H1AA 4ETWA 1OCEA 1YAJA 1VE7A 4EY8A 2QUAA 1F0NA 5HFNA 1RWQA 3STWA 4HRYA 3VVLA 3IDAA 4BVJA 3C87A 1XRLA 1HLGA 1JJIA 4WFKA 5T4HA 2WM2A 2O2GA 3A6ZA 4WY5A 1WB4A 3VJMA 1YB6A 4BATA 3PUHA 1ZD3A 3AFIA 5JAOA 3RARA 4ITVA 5AOCA 1NU6A 1LPSA 1L7RA 1QFSA 1QFMA 2VA9A 4G1FA 3AZOA 1AQLA 3R0VA 3WI7A 5JD6A 1DQYA 4B0PA 1EK1A 2ZJ7A 2WIGA 1ODSA 1K63A 3R3XA 3W06A 1C7JA 1FFDA 3CN9A 2RONA 3ESCA 3KDAA 1XLUA 4X92A 1YS1X 5T4FA 5K5EA 2AXEA 2JIDA 2HRQA 3H1BA 4G4IA 3ANSA 2Y1KA 3I2HA 5D6OA 5A71A 1UKCA 2OGSA 3PE6A 3KWJA 5AKZA 5LKRA 3H04A 3HZOA 4KJXA 3JWEA 3EQ9A 1Q0RA 2B9VA 4HXFB 3TJMA 3A2NA 3M3DA 2Y6VA 5CT5A 3U0VA 1ZI8A 3SK0A 3KXPA 3A70A 1MO2A 2WLSA 4U2EA 4E11A 4OB6A 3N2ZB 1TRHA 5DLPA 3WL7A 5AI0A 4DTCA 2BCEA 2XUHA 3GUUA 4J0HA 1ODCA 1RP1A 1UXOA 4E14A 1QIDA 3F9CA 4GEGA 1GPKA 3I2IA 2BJHA 4OB7A 2VQ6A 1SCKA 3BIWA 4Q3OA 3JW8A 4AB1A 4J0IA 5AM3A 3WK5A 2ZYRA 4DYHA 1F0PA 1P0MA 4TGLA 2ZSHA 2OGTA 3I1YA 1GQSA 2DCMA 4QDTA 2WFMA 1TK3A 5DYTA 2CUTA 3G0BA 4WDRA 1A8QA 3DCNA 4UHFA 4BC1A 5CBKA 4FHZA 4C4XA 4EA6A 2WUEA 4J03A 1R4ZA 4MJ3A 3DL7A 4MEAA 3NWOA 2HU7A 3WJ2A 3MGAA 4AMYA 2WFLB 4H7FA 3O4JA 3WWCA 1SCQA 1IVYA 1XRQA 1W4LA 4W63A 5E4YA 2VSQA 4AMZA 1Y7HA 1CR6A 4ZI5A 4CG2A 3B3QA 3G0GA 1CUYA 5ALFA 1NU8A 5A7FA 5HZGA 4DMFA 2XMSA 1WM1A 1R3DA 1F8UA 1MNAA 1YR2A 5D7BA 1LNSA 2EEPA 3KWFA 2XDWA 1XRNA 4XJVA 3VVMA 4KACA 4K6GA 4DSZA 3PDCA 3O4IA 1VZ3A 3R3YA 4NS4A 2VAVA 7YASA 4HTAA 1UK7A 1E8NA 3F8SA 1KU0A 2PSFA 4UHDA 1CUBA 2ZYSA 1B6GA 5AKLA 1QIJA 5HKBA 3V1LA 4AZ0A 2QM0A 2HADA 4ZV7A 1AX9A 2JGLA 4DGQA 3S8YA 1QIHA 4LXGA 4RE5A 3DL4A 2PVSA 3SX4A 2I3DA 5AM4A 5D3KA 4FMPA 1DTEA 1XFDA 1QIIA 2C5GA 3EQ8A 4KYVA 4AO8A 4WFIA 5K3CA 2VAXA 4U2GA 1Q83A 4N8EA 3FVRA 4FLMA 3FNBA 4QZVA 4MQLA 5FLKA 2XI4A 2YXPX 3DD5A 1CFJA 3HRHA 4A23A 4LXHA 1LLFA 2HA0A 4PO3X 2OAEA 4DM7A 1S8OA 4BCCA 2DHDA 4XX1A 4RE6A 3D59A 1P0IA 2G5TA 4S0XA 2C0QA 2RHWA 5ALLA 1WPRA 1VXOA 2Z8XA 1DU4A 5A62A 3FLEA 2VTVA 4QDZA 2QXUA 3O95A 2WU3A 5ALHA 4G8BA 1AC5A 1ORWA 3HLKA 5AKJA 1QONA 1JU3A 5AICA 1ZGBA 1G5FA 3DOIA 2PKYX 2GBGA 3R40A 2WJ3A 3DOHA 3IUMA 3TRDA 4TPKA 1KU6A 4IH4A 1ISPA 5K3EA 1F6WA 2ACKA 2QR5A 1UK6A 5AIBA 1PJAA 3W9BA 3IURA 2J3QA 1HKHA 4Q05A 5CH8A 4GDMA 4O08A 4AN1A 3G9TA 1IZ7A 1SFRA 5JAUA 3QPDA 3ESAA 5ALPA 5FDFA 1TCCA 1CUJA 1LZKA 5FKJA 5JZ9A 2XMDA 1HBJA 4G9GA 5CW2A 1Q84A 5ALMA 2H7XA 2P8SA 3QMMA 4OSEA 2IITA 3C8HA 2JGEA 1BRTA 1QIMA 4GECA 4B82A 1J2EA 5C8XA 2XMGA 1BEZA 1MT3A 2W6CX 2X8BA 4X00A 3NGMA 5E2IA 1AURA 4FOLA 2VF2A 4MQMA 1XZLA 4H7HA 4F0JA 3WWPA 3YASA 3IBTA 3WL8A 4BVLA 1CUFA 3WK6A 4FWBA 3HXKA 1CUGA 4Q3LA 3IB3A 1EX9A 2WUFA 1OXMA 3HABA 1BE0A 5FPPA 5T4BA 2HM7A 1YAHA 3I2JA 1ZD4A 2HFJA 1Y37A 4CIAA 1GPNA 2ZYIA 4OUKX 1FFEA 4X6UA 3ZLUA 2J4CA 4BZZA 4IH1A 1PV1A 2BGRA 2QTBA 5DNWA 4F21A 4PF1A 3WA6A 1R9MA 4BE9A 4H77A 4UBOA 1UOPA 2HDWA 2Y6UA 4UHBA 1LPPA 3PICA 4AO6A 1YSCA 3G8YA 2X5XA 1JJBA 2CJPA 4Y7DA 1CUIA 3G0CA 3OM8A 5JASA 2WJ6A 3BF7A 2VJCA 5ALIA 3WK9A 3OURA 3FAKA 4LYDA 5EHXA 4Q1VA 4DNOA 1YA4A 5EHQA 1WCYA 3LLCA 3IUQA 3NUZA 1TIBA 1UK8A 2WHPA 3FYUA 5FXMA 2AJLI 3WJ1A 3QM1A 3ESBA 1XROA 1MAAA 4QLAA 2QRUA 4PV7A 5A2GA 1K5PA 3C6XA 1H23A 4Y2SA 3FLAA 2ZVDA 5LZ8A 3V9AA 4EY4A 2PUJA 2DHEA 2DFPA 5JADA 1QE3A 2PM8A 5A6VA 4MEBA 5FUMA 2C58A 1WB6A 2JGKA 3DQZA 3F98A 4PQEA 5HKAA 2QMQA 2CKMA 3ZLTA 3BF8A 5K3BA 3L1JA 1L7AA 3FSGA 2UZ0A 1ACJA 4JNCA 3T52A 3A2LA 3H0CA 3V1NA 1XQXA 1XLVA 4Y2VA 3I1IA 4F5ZA 1GXSA 4C4ZA 5DNVA 1C4XA 5AOAA 2O2IA 5I9IA 3GBSA 4UHHA 5EHNA 1LBTA 3WYNA 2HFKA 3KSRA 4LYEA 4HRXA 4FNMA 2GBIA 4JUIA 1WPXA 3M82A 4B6GA 4D9JA 1H22A 5ALYA 4CCYA 2DHCA 3AIMA 4OB8A 5HQ3B 1JKMA 4BP8A 4AO7A 4W9RA 4B9AA 3LP5A 5AKEA 1K6EA 1FFAA 4B7ZA 4LHEA 4H7IA 1YA8A 5AH0A 2OQIA 2AJ8A 4M0EA 5K3FA 3D0KA 1QIFA 1XZFA 4UHCA 1J07A 1W76A 4KAAA 4C87A 1E89A 3H17A 3RK4A 2B4KA 3DYVA 4BYMA 1CPYA 3DKKA 3FYUC 5ALDA 2O2HA 2V97A 2EDCA 5JAPA 1H2XA 4NMWA 4OCZA 3IULA 1QLWA 3N0TA 3S2ZA 3G7NA 4GXNA 3WLAA 4WDQA 4EUSA 5EHZA 4FFVA 5JARA 5CT8A 3L1IA 1W52X 3ED1A 3R3WA 4UBNA 1OILA 3X3HA 1THGA 2CBGA 3FLBA 1ZI9A 3A2MA 4W1QA 1IUNA 4G9EA 2ORYA 5HF9A 2OLEA 5AI4A 4BRSA 2BKLA 2PSHA 4XWGA 1E5TA 3OG9A 3H2IA 2ES4A 2Q0XA 1TQHA 1ETHA 1LBSA 4QDUA 2C7BA 1BCSA 4QEKA 3W9UA 1CIJA 1YS2X 2ROQA 3SWWA 4GHWA 1X2BA 3ICVA 3QMVA 1LGYA 1WOMA 2B20A 5K3DA 2I03A 2VATA 4W1SA 3L1HA 4J3JA 1B41A 2OCKA 1ZI6A 5ALUA 4CI9A 1L7QA 1GPLA 3BIXA 4H7KA 1DX4A 4HS9A 1XQWA 1A8UA 1I6WA 3W2TA 2J3DA 3G9XA 4X6XA 1EB9A 3FVTA 2AJDA 2PSEA 2QXTA 1HQDA 3G0DA 1JFRA 2WIDA 2V96A 4OPMA 1DINA 4B85A 1N5RA 4C01A 4NVRA 5D3ZA 1EDDA 3DS8A 2WG1A 3GELA 1E3QA 2AJBA 1XKTA 1W6RA 2XUDA 3MUOA 4B0OA 4N5HX 5LKAA 1BU8A 1JMKC 4M0FA 4W1PA 3WK8A 4BBZA 1SC9A 4QLOA 3I6MA 4M0MA 2XMCA 5HF8A 2VJBA 4KRXA 4UPDA 1LPNA 5SYMA 3AILA 1IMJA 4HAIA 1TCAA 3R3VA 5ALQA 4NZZA 5CMLA 1ACLA 1RYYA 4GLBA 4FNGA 3MUNA 1M33A 3HSSA 5T4EA 4DSAA 2XUKA 3LCRA
chains in the Genus database with same CATH superfamily
3AV0B 4HUQB 1V35A 4H08A 4HYQA 2FPOA 4X1KB 3T5AA 3O90A 3FTNA 4CT5A 4MW7A 1VBNA 1K7XB 1P1BA 2CUZA 1PX2A 1T15A 1TK2A 3DYIA 1UL1X 2WWGA 1T2FA 1LRJA 1W4CA 3JQ8B 1SU4A 4K3UA 1ECCA 5TF0A 5AVSA 4MLDA 3JD4A 1Z82A 3N8HA 4Z7QB 2GBLC 5BUQA 3CXUA 1VPWA 3OPYI 4MB0A 3ZTTA 3ZBPA 1F0YA 4OI1A 1WUHS 2J4FA 1S4MA 3ZTYA 2NO0A 2AB0A 2C3UA 4EH1A 2IH2A 1HMYA 2FSSA 1OU4A 2IEIA 2G09A 2XT0A 3EFEA 3F96A 4O33A 3K6SA 4HYEA 2JANA 2G25A 2JGDA 2O4CA 3O8RA 4UM9D 3TZKA 1FTYA 4RHXA 2IYRA 1HSZA 1W75A 4GP7A 4GAEA 1BN7A 1U3WA 4X7RA 3UMYA 3DDNA 1VG9B 1J1IA 5KOIA 2WB2A 1EZZA 1U8AA 2JB9A 1SXJC 1GN8A 1G21A 4BNTA 4JU8A 5EWMA 5EIAA 4YX9A 3ZW7A 4U6QA 2QT9A 3NC4A 4LV8B 3GJRA 4TROA 3K53A 2JIMA 3L5KA 2FOXA 4C7KA 4DJFC 1VKHA 4IDCA 1FTGA 1UMBB 2GN2A 3LWBA 1E5DA 3F1LA 1SBTA 3AO0B 3MMPA 4XR9A 1DC6A 3R7DA 3T5BA 5JC1A 4CN8A 5JQGF 3WIEA 3CUVA 3QUTA 1EK6A 5F98A 3C7KA 1CHNA 2O0KA 1QV9A 4DT1B 1UBJS 1XMVA 2IOFK 3OU6A 5IZCA 4CF5A 1JI3A 4RFLA 1VB5A 2C3YA 1CUEA 2ZVJA 1F7VA 2OP1A 5F4ZA 4Y2PA 3FWNA 4JQYA 3LXMA 4IJMA 4R8KA 4YWJA 3K09A 2O7RA 4M76B 2N3ZA 3BD8A 5JTTA 3K9QO 3CUWA 4CTOA 1NJ2A 4WGFA 1UMDA 3C6YA 3KX2A 1ZGHA 5DT9A 5EKSA 1U7OA 2H4WA 4RD4A 4ZU1X 5KVQA 3VPBA 2ZUWA 4JYPA 2O3QA 3VKUA 1UJ6A 2IX3A 1NJFA 5CLGA 4U2DA 1M7GA 2WWIA 2KS6A 3II6X 3IOBA 1PJ2A 3LGSA 4HG2A 421PA 3ND5A 3VR4A 3PHIA 5F1OA 5IMBA 3PR3A 1P0PA 4O29A 4YDRA 2IY9A 4URWR 1YHNA 3IP3A 2CL5A 1WQ3A 3H84A 3WSVA 4DM3A 1NDQA 5K8VA 1XZAA 3PI7A 4MQFB 5EIXA 2RBEA 2SHKA 3OQIB 5CFPA 1WJGA 1F48A 5E0KB 3M1AA 3F3KA 3CO0S 3ITKA 4KPEC 2QGFA 2X5NA 2XV1A 4YJ3F 5EPEA 1MLDA 4M8SA 4F2WA 2VT3A 2NVOA 5FTLA 4ENQA 1YL7A 3L8FA 2GNOA 3THYA 4X1YA 4RY0A 4I2NA 3U4QA 2VNHA 2ILTA 4JT4A 3LHFA 2B34A 3X1JA 1JHMA 1SVWA 4XSGA 1COZA 3OOEA 1W47A 3O1HB 1CZUA 1L8AA 3KXIA 3OO0A 1Z17A 4CKWA 1FBNA 5JPDA 1CYEA 4PLPA 2QTMA 1ZJJA 3L4BC 1V26A 1X7GA 5BMVA 2I33A 4KAFA 4FNOA 2XB2A 5EVJA 3ADDA 1V4VA 2Z98A 2EJWA 3PYMA 4I5GA 3BQNB 2NOAA 1CEQA 5AHXA 1PJQA 2R8BA 2QPTA 5LUBA 3R3UA 2Q3BA 4KJZA 4QYIA 5KTKA 5SYNA 2PSJA 3GMSA 4J0QA 3B8HA 4H7PA 2YTZA 5BWBA 5ITSA 5F35A 4UD6A 1PS9A 3MT8A 1YQGA 3UCEA 2WDPA 2VJNA 3DP7A 4AMGA 5HJ7A 3KPWA 3M1LA 4D97A 1WW3A 1FFCA 2WTAA 2JEZA 4P58A 2AYXA 2GM5A 3PJEA 3C45A 2GJSA 3KALA 1M6NA 4RJKA 4UQPA 2BWJA 4KIJA 2GCGA 4KN5A 3MWYW 1P77A 2TMDA 1N2IA 3QLEA 3VNVA 5KNLA 1O3YA 1XXHA 2GZSA 3PXDA 4M1OA 3V4RA 2I6XA 4G0UA 1Z0JA 2I22A 2Q8PA 3WR5A 4C76A 3PEEA 1D4OA 1EE1A 1JKIA 2OG2A 5GGXA 5H3LA 1L5NA 4ZZIA 3DVAB 1XRJA 4I1UA 3FYSA 1SVMA 4HLUA 5HRCA 3C8DA 4C0LA 1F2UA 1OOEA 2DFDA 1JU4A 1FDTA 3QOWA 3U3ZA 1ABFA 5FWYA 1SC6A 1VIVA 3QIVA 3RT9A 5F73A 3EVFA 3A6KA 5J4YA 3BKWA 1GU1A 2IYZA 2PKXA 2YOHA 3O03A 4F85A 1II8B 5GWXA 2P9GA 2C2YA 3F5SA 4Y1GA 1QRRA 2RHOA 1TUGA 4NE2A 1FFXA 5K2MA 1Q57A 1RM4A 2FSUA 3OP4A 4ZMBA 1HLFA 1M2VA 3RC1A 4FYHA 3DV2A 4UNSA 3PUZA 5A4FS 5B30A 3QTLA 5TJ9A 4HDRB 1CF9A 1GKLA 3QV2A 3CPSA 3EZ7A 3B1VA 3ZWMA 1BMTA 4BO3A 1CEXA 4LF7B 3GLUA 2NW6A 1WBJB 4AJ4A 3RS9A 3OEED 3U3XA 1P81A 1H8HD 4H18A 4O1MA 1KSHA 4X93A 3H4IA 3BX1A 4CMKA 1IN4A 4JVSB 4PGFA 2J31A 2I4TA 4QM7A 1SAYA 4ARZA 1YA6A 1A9QA 2QYHA 4LCBA 5AUNB 1Q0UA 2GWRA 2D5IA 1E6KA 1QPBA 2HJWA 4JEIA 3R9KA 1VSVA 2GEFA 2TS1A 2OQVA 3QVSA 1MW9X 4R16A 1P6XA 4MYCA 2G0TA 2OHOA 3RB8A 1TUIA 2IHNA 5U4QA 4C0AC 4RULA 1ZXBA 2JBWA 1UK9A 2Q3HA 3AEKA 3MA0A 4HAVA 4Y0VA 4EY3A 2HR1A 3VDXA 4L8GA 1LDMA 4AAYA 1OIXA 4GFDA 4EFDA 1WCXA 3H2HA 2C2MA 4JJAA 4XVRA 2NIPA 3IPLA 3R7AA 1HT3A 2C7VA 5GZ3A 1COWD 4QPZA 1CNEA 3WWEA 5JD5A 1E3WA 2PGNA 3DDSA 2VTEA 1PTJA 2FXIA 4DRXA 4TM8A 3D2AA 2JIZD 4KQIA 1UAYA 4MV0A 3U1BA 2ZM5A 1CUWA 3QHAA 4RIGA 3VC3A 1JR3A 3G1WA 3LW7A 2NMVA 5EWLA 3TIIA 4D8VA 1JBQA 1NSTA 3GFFA 1Z07A 3VR5H 2TMYA 1W93A 1JSZA 3L0SA 3F7NA 4YYZA 2WI8A 1LI7A 2FJ0A 3PXBA 5EJ5A 1DEAA 3F97A 1GZ4A 1NW3A 1SZCA 2C2GA 3O3CA 2L19A 4IQ4A 4WBXC 3WGYA 5LLDA 4R7ZA 4ND8B 5B12A 4KH0A 5AVKA 3MW8A 3GPDG 1BXKA 2XOKA 2X42A 3IAS6 2UV8A 2EBFX 2NXWA 1OGYA 4JASB 4EOGA 2FPIB 3L8HA 4LKOA 1O87A 2IHYA 1JQEA 2C5FA 3DNMA 5H68A 1NF8A 3L06A 3K4QA 3HBNA 4LRYA 4RW0A 3RR2A 2Y2VA 5HGXA 4HNVA 1A69A 1A8PA 2AG5A 4EMUA 1Q6YA 2R60A 2QAJA 1I1QB 5EI5A 1R5BA 3H11B 2ZYHA 5IS2A 9MHTA 1AV6A 1KH2A 1P31A 1X14A 4XDYA 2CVQA 3I28A 4DMKA 2D74A 2RIPA 2C82A 2A0FA 3OIFA 3NT5A 1LJ8A 3PFNA 4IWYA 4P1ZA 4MQEB 1GQRA 1QP8A 2A0XA 2VJMB 1V5IA 2WD8A 4KQ6A 4OREX 3PVZA 4F2PA 1WWKA 3IQXA 4L8YA 2G3YA 4ZT7A 4MVJF 4YC7A 2X5KO 3F8TA 4Z9YA 5B2ZA 2FFJA 4BBPA 1PZEA 4D3SA 3L7CA 4EEZA 4M7WA 4TZ0A 4X3CA 4Z3OA 2P3OA 3RVSA 5M29A 1YIDA 2H8GA 1KVSA 2ZWMA 3CWCA 4MNTA 4R8VA 1I6LA 1K9SA 2J3IA 1BS9A 2AJCA 3I9LA 3K2EA 5LLSA 2EAUA 4GX5A 4OYLA 3EVBA 4R81A 1TW2A 2Q1SA 4PFJA 4C0KA 5LQCA 3GT0A 1SOVA 1ISJA 4DR3B 1G16A 2V98A 5CFZA 1TYBE 1FCJA 3F7TA 3GUCA 4KLZA 4LS3A 5JTUA 1RRGA 1GILA 1W9HA 5E8JA 2WU4A 2F6RA 5JDCC 2HRDA 4F8JA 2DLNA 2YV1A 2FB9A 3D3WB 4URHA 1PLJA 3CUUA 3UAOA 4AJIA 4DLNA 4KDFA 5ALJA 2A84A 2BP7A 2LCFA 1VE5A 2R11A 3U2QA 3GP8A 3VTKA 4HS4A 1KXZA 2N1BA 4XUGB 4CCSA 3GLGB 3UKDA 4D8YA 1WXGA 1BZYA 3FBWA 2D7JA 2P9HA 3C97A 4OX9Y 1VA5A 2I2AA 4PGGA 4F9GA 1CJTC 3PFKA 1ZFNA 1WVMA 1ENZA 1XALA 2GZAA 1S0UA 2W4IA 2QL9A 4NYJQ 1ENPA 1TQ4A 3MMNA 1LW6E 2Q2QA 2C96A 1LPOA 1U98A 2Z8ZA 3L82B 3M81A 1QJ4A 1JECA 1HE4A 1Y4UA 5E9WA 5F77A 1BOOA 4Q1CA 3KL2A 4JYBA 3NG1A 2YCLA 3BD6A 3I53A 4HEHA 5DX1A 2JGFA 4GM4A 2GEJA 2AC2A 2WG2A 1WW8A 3FUVA 2PUHA 1B8PA 1Q0HA 3MAAC 4HF7A 4HMOA 1MJ5A 3WL7A 1QB7A 1YRAA 4L3WA 4TXNA 5EL0A 3ZQUA 3NBXX 1Z5UA 4LZPA 1MO5A 4MRSA 5CM9C 5I47A 4MCJA 4CLOA 5AW7A 4AZVA 2D5LA 5FEMA 4L4YA 3BSWA 2PS3A 1XC7A 2GK3A 2YC4C 3KZVA 1W8IA 2SBTA 3KEOA 4JJ7A 4ICIA 4Q4DA 4QRHA 4ETIA 1X7DA 3WGQA 5DM4A 1MPTA 4HGZA 4BDSA 3VA7A 3D7KA 2GZDA 4ESEA 5A7HA 8OHMA 2ZUFA 3FSGD 5EJ9A 2VHXA 2QG6A 4XX0A 5I3CA 2XKAA 3QGMA 1UBGA 2QSJA 4G4JA 5TB5A 3W79A 3GARA 1FW6A 2XCSB 2ZRCA 4M8NE 4XTRA 1K6MA 1VB3A 2QPAA 2BIFA 2BDTA 3PCRB 2GPJA 1LV8A 2AG0A 3KEMA 4LYAA 1CUVA 2E2WA 5LYYA 4PG6A 4F1KA 5E38A 1Y8CA 4FYMA 1Z8DA 3UT5B 3V8BA 2Z9CA 2AG8A 4GF5A 4P4TA 3T1QA 4ALKA 1SUEA 2NACA 3CR3C 3FOBA 5GONB 4ZVOA 3W8RA 3KLNA 3LF2A 4W6ZA 5B1HA 1ONPA 5CD1A 2GD2A 4WZAA 4CCWA 1DNPA 3CN7A 4DR2B 3H5LA 4YI3A 1Y4DE 1MJNA 3UB4A 3VYTB 5DV9A 4L74A 4PQGA 4HVCA 3COJA 2ZVQX 3OQHA 3GNLA 5EQDA 2QL5A 2VYCA 4YT5A 1UEIA 1UC9A 3NHJA 4KLRA 4M1WA 5I01A 3ZIDA 4ZN6A 2HH9A 2HF8A 3ZIAA 2ZUSA 5BNTA 4Q24A 5AT1A 4EPTA 1CUHA 2RI6A 3GC6A 4PLYA 2FVXA 2ZULA 2DF8A 1SIUA 2WJAA 1X70A 1T0BA 5CA1A 1NA5A 1E4EA 1CK4A 4Y2QA 4UNQA 3LL7A 5HMMA 5J2UF 1QZZA 5EJ4A 1AKEA 2YHUA 3M4ZA 4J0JA 3HYSA 2NXJA 4DIKA 3IPXA 4IRXA 1UXGA 1IZ9A 1L1FA 4XD2A 1Y7PA 3CPJB 2PZLA 5EIHA 4BGEA 3L7AA 1NNLA 2CZQA 4U2FA 2FY8A 4WH0A 3TLZA 2AH5A 4B1FA 4IZHA 1N8NA 3PJGA 3QE4A 5ICGA 3UK1A 5JBQA 2B9EA 4YLYA 1DRVA 1U2TA 1IM5A 5JVDB 3I4FA 5BPHA 1GLVA 3WE7A 1I01A 4HX5A 4AWAA 3A4VA 3QSYA 3IVMA 4ENTA 2ZRHA 4LOLA 1GAWA 3A04A 2JATA 2PFSA 1BRMA 1G21E 4MINA 1QM5A 4OBWA 5D51S 4BWGA 3I6QA 2OEPA 1TVKA 2OWDA 1E9AA 3ADBA 3ANTA 1BXGB 4EFKA 4AJOA 1Q6ZA 2FQXA 2G08A 5T41A 1G64A 1K0FA 1NXSA 3C6KA 3FROA 3R7LA 5CGQB 4LNAA 2MT9A 3KKKA 4DG5A 1JQ3A 1QK5A 2UUPA 1DXQA 4OYYA 4K2HA 1P7YA 1Y89A 2ZE5A 2G9QA 2IXDA 3W2IA 1JQJC 2YWEA 5TF4A 3FSJX 4DLPA 2PBRA 1KJQA 1KHHA 1RRCA 4XDHA 3V2UA 3OIUA 3WGHA 2Y93A 1BOFA 4LSZA 1U5BB 4W5QA 4C22A 3DAYA 3W5VA 3N2KB 2HJSA 2XVYA 5TJHA 3EZFA 4PG8A 2V6MA 5HKLA 4YO8A 4PHGA 1URPA 3EH2A 1TYAE 3QFRA 3THSA 3D1VA 2G36A 3MTIA 2NWQA 4WCVA 4PZPA 3FTQA 4IIVA 3E3AA 5HR5A 3ANXA 2FWBA 2XT6A 4V38A 4D6XA 5IBCA 5IZ4A 2WKRA 3H2KA 2PUGA 1JXOA 4DJEC 1Z45A 3GQBA 1G5RA 3E1GA 3WQBA 3BA6A 4JR1A 3SQNA 4YV1A 4FWTA 3P9NA 3T0GA 3DNPA 3IT3A 3TEFA 4DIOA 4MW1A 3PQCA 3AB7A 3GEBA 3KLMX 4FE4A 2OFFA 2EV9A 2H7YA 3JQEA 1G5HA 5FWAA 3L3BA 4AQDA 3K20A 1X1QA 2V5VA 2Z1NA 3I6ZA 1H05A 3H5TA 4MDYA 4RFSB 3SZMA 1ADBA 1ZM3A 3CVJA 4N7BA 4UZFA 3R8FA 3H2JA 2OV3A 1N0HA 1QZUA 2QUIA 3NBMA 3AF0A 1D7OA 4ZVKA 2X40A 5K01A 3IA2A 3CLSC 1NPTO 2IXTA 2X6QA 2CMGA 3BB3A 1I2ZA 1VCMA 1GAEO 4MR8B 1N6IA 3ZE9A 1UF9A 2WV7A 4LVCA 1JRLA 3PC3A 5FRDA 4M1TA 1LSUA 3E7WA 4MVJI 5DOZA 4EPYA 2V7UA 4DM4A 1IY1A 1D4AA 2V54A 4ZYWA 3NDPA 5IPFA 1VI2A 1JX6A 2RK6A 2VP0A 1QTNA 3KTOA 3QOXA 4NY1A 4EBBA 2RAUA 3I9FA 2Y1OA 1KOLA 1OTHA 2RGNA 1HL7A 1BWRA 3C98A 4ZYUA 1N6PA 2OFOA 5KCZA 1IUKA 1SQ5A 2RGXA 1JQBA 2P2LA 3CG4A 4X7MA 4HNSA 3ACDA 3ID6C 1XKXA 2YIJA 5TIIA 5LL6P 3RVRA 2O2CA 3D3NA 1OSNA 4UAJA 1NZJA 2BGJA 3HDTA 2QM8A 3MUEA 4YB8A 1QRTA 5G1PA 1Q0SA 2FEKA 2ZJ8A 1XPJA 5FQNA 5KMGB 4C04A 1IU9A 1S3FA 4KPUB 4XVHA 2CV1A 4BLSA 3KTAA 3WAKA 2OM6A 1EH5A 1JI0A 3FDZA 2AF4C 2Z3WA 3PQFA 1R4NA 1EQ2A 3JQPA 1EQUA 1PVDA 4KGDA 1NASA 3B7WA 4JDUA 1DTWB 1J39A 3OWOA 3UJ8A 4RZXA 4Q3NA 5HKOA 2AI2A 3TQHA 4PYIA 3BBLA 5IASA 3IMEA 1ZH6A 3FWKA 2KE5A 1O94D 4MTLA 4N03A 3RF6A 2AVDA 4LOIA 1FRZA 2PMDA 4HGQA 3TIGA 2VLBA 1PZNA 3I01A 1X1CA 3VOBA 5K6AA 4EZEA 1LRLA 3HEAA 2QDKA 3OQBA 4D26A 3O8NA 3NHSA 3U7QA 4TLBA 3CZPA 1A88A 5LMNB 1Z4KA 2J6IA 2FWIA 2PXXA 3M33A 2OCAA 3ZWPA 1I1NA 3OJOA 3P52A 4OU5A 3ZCTA 5AK3A 3WJAA 2OQ2A 4LI0A 4FI3C 1ZJ6A 4D41A 1IVSA 4NBVA 4GVXA 1OR8A 3UK7A 4LF6B 1U63A 3U31A 1J21A 1R50A 2GH1A 2IZ5A 3LQRA 3NWBA 3BMCA 1WS6A 4LY9A 4CN9A 1T9CA 2Q8QA 1X1TA 5B1SA 1J9ZA 3H87A 3KOOA 3JASB 3OFVA 5IAJA 1X2EA 1RWOA 1ZESA 3SJAA 2ZSIA 3QW4B 1TZBA 3QLJA 1AVTA 3KE9A 3KJNA 1FP6A 3WL6A 1Q2UA 2IOQA 3MHTA 3S4YA 1ZISA 2NPIA 4QVIA 2B37A 2A9OA 1CF4A 2HU2A 3ZZNA 4ID9A 2PPLA 4MVJA 4OHKA 2VPWA 4YT2A 5HIKA 4PBTA 3BFPA 4XQGA 1U8EA 3OCWA 4HH3C 2YX1A 4RUKA 5FJIA 4QLBA 2XMPA 3CM0A 4BKQA 1OKKD 1E9BA 1GHTA 1ODTC 3NHUA 4MHOA 3VR1A 4FN4A 4QFMA 4S1NA 1B14A 1HC7A 2V6JA 4DCTA 3SI7A 2LDXA 4C0HA 3VSBA 3JQAA 5JOQA 3WBBA 3NHKA 2C8JA 1GSHA 2ORIA 2P4HX 1JAIA 2QV0A 4R1LA 5IP5A 3OFJA 1NE7A 4CRWB 4KPYA 2YYSA 1U5CA 2KI5A 1Q92A 2AEFA 4WOJA 2J08A 5EFZA 2P35A 3MJSA 3SKVA 1U2EA 4JYZA 1BGXT 4GXQA 1Q7GA 1W4ZA 2OYSA 3TRHA 1X39A 3PEFA 1RWNA 1LFDB 4CV0A 4PYLA 5FBWB 4QFCA 4ND7A 3CCBA 1PZXA 3LRPA 1C0LA 2HB6A 5CJPA 4D4JA 1QS0B 1V16A 1T43A 3TN7A 1RS0A 1YS9A 3OT5A 1GV0A 3QJGA 2BKUA 4PICA 2VH2A 3R5JA 4KFRA 1H8EA 3G6KA 2ZSEA 1G4HA 4H4CA 4H7JA 2R7KA 4KGXA 3EIQA 2IUTA 4LSMA 1SO8A 3EEYA 3ES9A 4GYWA 4ND3A 4BFVA 3D54D 4E07A 1HMPA 3ABRB 3LUPA 3MT0A 3WLTA 4HI0E 3TCXB 1P45A 4O02B 3AJRA 3M6WA 2XZLA 2PWAA 3AC0A 3M5CA 3FYCA 1P1JA 3GY0A 2IZ7A 1TYZA 4JSRA 2XMQA 2HD4A 4UOEA 3NNSA 1FDUA 1XNJA 3AHEA 5FHQA 3UICA 1W35A 4B84A 4D79A 1XZQA 1JFFA 1G66A 4BPRA 4XQEA 3WA7A 1JHOA 3WQRA 3IIIA 1FJXA 3PUWA 3ZWCA 3B7PA 1RIFA 4MPJA 4PONA 4WKPA 1G3IA 5KNCH 1NBMD 4DMLA 3F3YA 4ALIA 2YHIA 3K3PA 3LC1O 4JWTA 4UHJA 2JLXA 5K4GA 3OCJA 4TSFD 1ZMTA 1ZU5A 3P9RA 2Y1DA 4L73A 3TIVA 2Z6AA 1IN5A 2WFZA 1TGYA 1JILA 4PZEA 3V97A 4HK4A 4W6QA 4MGYR 4PNPA 2WJHA 3IRUA 3JQ7B 2FHPA 3SHQA 3OO1A 4JV5B 3BPSA 3HKEB 4PNHA 3LUFA 4Q6BA 3GA7A 2LD4A 4ZOLA 1KERA 1KVRA 2POQX 3B8EA 9ABPA 1OLXA 2E4ZA 4FYYA 4EPVA 2D3TA 1SZPA 5F52A 3LBIA 1DELA 3NRBA 3RVPA 2J3EA 5I9NA 3U7HB 1SB9A 3RYIA 1SEPA 3R0QA 1W2HA 4QRIA 4GPEA 4QVKA 1NKVA 5AKXA 3EOAI 3CLHA 1DT5A 1T9ZA 3CIOA 2XAAA 5CHYA 1WDWB 4I6EA 4OHVA 4KO2S 3L4JA 3KELA 3DDZX 1TUBB 1Y4SA 1L4MA 2Z30A 1Y6RA 1S1MA 1DEOA 6REQB 5J2UA 4Y67A 2F43A 1VMKA 4Z4CA 1JHQA 1RWPA 2IPNA 4M1EA 4AMBA 3VPAA 2BEUA 1JQAA 2FHSA 2IK8A 3LZDA 4R8MA 3X1ZA 3EBLA 1WXEA 4ZHQF 1AXEA 3I2KA 4P54A 4QUIA 2C42A 4XIIA 4H9GA 2V9CA 3JTEA 1A9PA 3K1ZA 2NU7B 2G07A 3KB8A 3SQXA 2NUPB 2QTHA 3AB8A 1PDWA 2H57A 5C34B 1I4EB 4RLHA 5JAIA 3X2EA 3ZCVA 5DYGA 1R8XA 2X1MA 3DWGA 4PHFA 1HDRA 4QOHA 4JI3B 3ROXA 2QYOA 2IPLA 4RTMA 1CUZA 2QM3A 3WKBA 3O83A 4JGBA 1PR1A 4EMBA 4JI0B 2PZAA 1YB5A 2JAWA 3OF2A 3M9LA 3SZUA 4AY4A 2BKXA 1QYVA 2JVKA 2PMEA 3VZDA 1QHEA 2R6DA 3A3KA 3NWJA 2BFDA 3NTLA 1EDZA 3KP1A 1JDJA 1G2OA 1GEEA 1SMKA 2X0RA 2RB4A 1QCZA 4NNPA 1U2GC 2VOEA 2R6HA 4V0MA 2W6OA 3EVDA 1IUOA 2ODAA 4U6SA 2HK7A 1R9JA 2R44A 1C1HA 2X7XA 4RF4A 3T5GA 2GPYA 5DTRA 5BVHB 3DMNA 2I3ZA 4H7DA 2Y99A 2W7TA 3MWEA 3FGZA 5AK4A 4O2BF 5CLIA 4ZEOA 3TR5A 1Z74A 2XUFA 3E7PA 3Q2IA 5KWIA 1RQLA 5JXGA 1ZL2A 1PJZA 3FE2A 1JALA 3QPWA 2GLTA 1RRPA 1VOTA 2V7PA 3EVNA 3SBOA 2ZZNA 2HCBA 1PJ8A 2QZZA 5KQRA 3B53X 1XWWA 2YMQA 4WZAE 2RKOA 3WY9A 2P9FA 3F9RA 3OIGA 4BMDA 5ALVA 1D6JA 1GVHA 1IY8A 1SCIA 3K0CA 5EWJA 2OHGA 4DYDA 2EXXA 3GRFA 3WYCA 4W8HA 4Z0HO 5C1DA 3L02A 3NC1C 4ZTZB 3IQWA 2QJWA 1H6BA 3Q7IA 1VE6A 5FOWA 2YV4A 4AJJA 3IVRA 4P0PB 4UE3S 3DB2A 3SDZA 3WXMA 5K9ZA 1H4QA 2XUIA 2KX7A 2ADOA 3S2UA 1L5HA 1E2FA 3ZU6A 4U1RA 1KSGA 2OYRA 4PZAA 4NV1A 3SCZA 1SUWA 1FXSA 1T8RA 3K1TA 3K6KA 4MUGA 1F2VA 2IXBA 4GR4A 1SELA 3Q8WA 3FOWA 1KOFA 4HDNA 3WOHA 4RMNA 5JZMA 5KOJB 1LNZA 3KETA 3F2IA 3UA3A 2CLKB 1TLLA 4QXMA 4BVBA 2J4DA 1H2RS 1W2WB 1LNQA 3HB7A 3Q88A 3ZVKA 4BNXA 5KU1A 1YE3A 1FY2A 1US8B 1SQFA 4Z9XA 4ZHSA 3OHPA 10MHA 1SOMA 2W6PA 5GV7A 5KYUA 1NF9A 3V8NA 3G2LA 1N8SA 3CLRD 4BRZA 3QUCA 5IAKA 3BJMA 3ASZA 2J87A 3WMGA 1KWKA 4BFWA 1RIIA 2P75A 1MN6A 3U39A 4X97A 1BDHA 1EGVB 2O6LA 4JBNA 3CLTC 4EKYA 4RKFA 2QUBA 2HPVA 2XNKA 4OJYA 2WTNA 4LRUA 3W3AD 4CMBA 1A2KC 1T5BA 3QZUA 3JQGB 1ZDMA 4LX0A 1XG5A 3D31A 1FYDA 2FUKA 4KQKA 4KQ2A 5G0VA 1Q21A 4CFSA 4KO3S 4AULA 1DLIA 5ALOA 2BELA 2HPHA 4GW3A 4D44A 2FWRA 4F4DA 1QDUA 2BW0A 2VPPA 3GRCA 3LCVB 4JVOA 1RP7A 3PTAA 1Y5MA 3P2YA 3IDQA 4ECAA 4KHPB 1P44A 3RLIA 1AKQA 1DAHA 3ZI4A 4AZWA 5FAKA 1JYEA 3RYFA 3ESDA 4D3DA 3IMCA 5KI6A 2VJOA 1X42A 2D1TA 4HL6A 2GSDA 3LY8A 2DKOA 3LFHA 4JD5A 3WDLA 2R2GA 1Z4IA 2WJ4A 1TAQA 2LUOA 4XIGS 1YGYA 2A6PA 3GR6A 3EULA 4YH1A 4LKRA 4LA4A 4UMVA 1S2MA 3VV2A 1KMIY 3BSYA 2H51A 4MDFA 2NQTA 2O1SA 1EVEA 1SXJB 1C5KA 1JAYA 5TVKA 2IV7A 1NPYA 5EMHA 2QL7A 4KO4S 3STVA 5AKGA 4Y6GB 4MWBA 4ZU6X 4E4TA 2XB6A 3WIDA 2FYTA 3PPXA 4EMTA 3B2NA 2OWEA 3V3TA 5E2AA 1S96A 5LJIA 3IIJA 4PAGA 1G2QA 1BCSB 1QVWA 2AOTB 1W19A 2R3SA 3FNFA 1CB7A 3MLEA 3VUEA 3ZK8A 1U3VA 2CLSA 5FO1A 2ISSD 3DZBA 2PS1A 3QRWA 1QE5A 1FLNA 2OHFA 5FV4A 4LPSA 4DWWA 4RMGA 3RO7A 5DTEA 4IHJB 1FYFA 4CNQA 1A2OA 1LTKA 5BOSA 2SCUB 4QBFA 3UJ3X 3EW9A 2XGGA 3THOA 1C2YA 1J23A 1OBVA 3P2EA 4UVIA 3A3OA 2CFIA 4E5NA 5LQJA 4QE3A 1OB5A 3BULA 2C29D 4B2YA 1J4AA 2FRDA 3G3EA 2I7CA 5JWRA 2QX8A 4PTLA 1FUKA 4BFXA 3ZGYA 2WHQA 3O75A 1FDRA 3R8CA 1JBEA 1OI2A 2ACWA 1Q7BA 3QKWA 2R97A 4Q4HA 4IFIA 2PL3A 3A0RB 1V9CA 3EIWA 3MAGA 3NOQA 3UK6A 3GU3A 3PYLA 5IU6A 3T9AA 2PT9A 1L7VC 1C2TA 2QW8A 2XE8A 1D9XA 3TD2A 5EUMA 2ACVA 3EW7A 3E9YA 2R65A 3WLEA 1GAXA 2BSAA 4LCEA 4TUYF 2YJ6A 3R2JA 1XZ8A 4H60A 2HQRA 4NQRA 5HKKD 3BE8A 3IT1A 3AU9A 4OHXA 1G4UR 3T7DA 1WEKA 2Z1DA 3AETA 3WYEA 1AUXA 1FW8A 1I7LA 1A9OA 1S3GA 1U0FA 2R5NA 4LCJA 3X43A 4DMCA 3Q9NA 3I58A 3E53A 4EYGA 5JE8A 3NBQA 3T95A 3JQDA 3L6OO 2XUOA 4Q9DA 3OJWA 3PHBE 1SOUA 2QN8A 1T0JB 2SICE 1DLJA 3AY0A 4TWRA 5TGZA 1N34B 1MO4A 2ZREA 1GNPA 5EJIA 4YQYA 3V42A 2J0SA 3DVSX 1UDWA 3BJZA 5I51A 2VPZA 1IB6A 3WAJA 1QKKA 3UA4A 1SPBS 4BNDA 1UQUA 3U4MA 5K3AA 3U6KA 1JXQA 1KI2A 1QHHB 2COEA 1MCZA 4DQXA 2VQEB 1FVHA 3LXRA 1N2SA 1UKBA 4L9WA 1HI9A 1ODIA 2XQJA 3ONEA 2DHRA 3V4PB 5C7IO 1CR1A 2ZQ5A 4PYNA 2ODWA 3VQTA 2VF7A 4F3KA 4AK9A 4IXTA 2MYUA 4IIFA 4QQKA 2C5SA 4KLNA 2ZRNA 3BWYA 5EJFA 3DWEX 2O4UX 2GNAA 2OCDA 1IK4A 1D07A 3COYA 1ECPA 1USIA 4IUBS 1ZAKA 2PZGA 4JFRA 1UXJA 1NXWA 4P98A 2WILA 3D6TB 3TOXA 4JVNA 3GL9A 3CEHA 2XE4A 1KYVA 4JBHA 2RKWA 1NOJA 1EE2A 4BO8A 3WMWA 1K4MA 2VHVA 3ZBTA 1XTBA 1EB8A 5KWVA 3JAWB 2ECPA 1AQJA 2GXAA 2LPMA 4PG7A 3G17A 2Z5GA 3RUHA 3DO8A 4BFUA 4EENA 2DJIA 4TRRA 3LF1A 5CBPB 3Q3IA 1CJMA 1GIAA 3ZU2A 3PDIA 1L2TA 5HX7A 2L0XA 3CVYA 1E1YA 2HA7A 4L0MA 2J46A 4LWZA 2DB3A 2AYZA 4D3FA 3SOZA 2GZ2A 1ZICA 1ZK0A 2ZSDA 3IOCA 4B5KA 1VJ5A 1YJQA 5KREA 3T15A 2DQYA 3VZBA 2CNDA 4MPPA 1XHLA 2BHLA 4R5HA 1ZYUA 3LX6A 2ZQYA 4YLEA 3W5DA 5KYWB 3M6XA 3C6MA 5KHLB 4KQCA 2P2YA 3KL4A 4P36A 3G2JA 4FZRA 1FL9A 4D02A 3UGJA 2QX9A 5IK2A 1AZTA 5CXUA 4PRYA 3R24A 4BTEA 4ZZ1A 2H0QA 4WX2B 4LY3A 2JFVA 4J4TA 4UTVA 3E81A 2HRCA 4EIWA 4MICA 3WTBA 3NEAA 3CX7A 5A3JA 1J0BA 2G4LA 3SC2A 4QYMA 3NEYA 3OI7A 1ZHOA 4G89A 4WFJA 3CNHA 3D6UA 2IHKA 4Q3DA 3EOBI 4WBNB 3ANYB 1MTZA 1E8DA 4MR9B 5DRYA 2A9QA 3KOUA 1D8TA 2IE8A 1CJVC 2YNMD 4E94A 2IUSA 5IVHA 1EUQA 1U7UA 2K2QB 3MS4A 3PEUA 4UFOA 4ZV9A 1IEVA 4CYMA 1FXUA 4JJIA 1OCEA 1TU4A 1YH3A 3C3EA 1OXSC 3Q6IA 3W78A 2ETVA 2CF6A 3CGGA 4D5GA 2PZ8A 2QUAA 5HFNA 3DEYX 3DBRB 5MFPA 4MPRA 3N7UA 3IDAA 2FLWA 1WB9A 721PA 1IBKB 3VNUA 3EJ6A 1XRLA 3A9RA 4I5DA 1OYOA 3TPFA 4UTNA 1UQRA 5ICEA 1CY7A 4B09A 4B3XA 2IXGA 3EXG2 1JJIA 4NYMR 2XCIA 2DUNA 4KR9A 2ZJ3A 4WEOA 1J99A 1AGNA 2X8JB 1N9ZA 2YRXA 3O3MB 1EUDA 3Q7QA 4FR0A 5EQTA 3OJLA 1DCKA 4UPVA 2BGTA 1QYRA 1QDLB 2EX4A 2Y0DA 3IPYA 5P8WA 1YB6A 2OGUA 2Q5FA 4IDBA 4O4LA 4R4JA 3VX3A 3RDPA 4CNBA 5K05A 1U3CA 1S3IA 2QPLA 4JHXA 5LQNA 1NUAA 1VHWA 3PU6A 3RRYA 5L3VA 4PPNA 1JL3A 5B4UA 2Y1CA 1MFZA 4O2BA 1DI0A 2DAPA 2H2FA 1GZVA 1KPHA 2MMGA 5EY5B 3RARA 4CDNA 5FYDA 4LHSA 4ITVA 4MS3A 1BQ3A 3K0AA 4EATA 2FR1A 1U0BB 1MB2A 3SSMA 3IPCA 3I1FA 3SEQA 2P7HA 7MHTA 1QFSA 1YZTA 4REQB 1XJQA 3ADOA 3RE1A 1AQLA 3WI7A 3FKQA 2JGAA 5EERA 5JD6A 2QDXA 3SF8A 3AF2A 3LLUA 4ZIRB 2M2IA 2P3QA 3TQRA 3N9IA 1EK1A 5K0TA 2P5TB 3B20A 3TS1A 4E6EA 2CXQA 2C1ZA 4OKIA 3F1KA 4LQ4A 1Z25A 1FP4A 1NVGA 3M6VA 3B48A 5CLQA 1VSTA 1V4NA 3H8JA 4QJBA 2FEWB 3ESCA 3MJ4A 3Q3VA 4YFYA 5L51A 5HOEA 5K4HA 2CSUA 1OBHA 2REXB 2ZBUA 2ZI5A 3O26A 2AXEA 5BT9A 5EXPA 3RIHA 2C5LA 3ICPA 6ADHA 3PXXA 4B8WA 3H1BA 4P7BA 4B3HA 1GPDG 2WQ6A 2O5EA 3A4YA 1WA5A 4K1LA 5C4GB 3PE6A 1R6AA 1MGOA 3NYWA 4EK9A 4MI1A 2YYAA 2P1RA 2ZWOA 2GPTA 3C3YA 3IBYA 3L7JA 2C83A 1UWVA 4GR5A 1M9NA 4G07A 3T9BA 4EB6B 4FYJA 1TC2A 1W4RA 4NJMB 5JLJA 3I73A 2P91A 5CX1A 2Z4SA 3RCBA 1MDFA 4LW8A 4DIMA 3GAAA 4HNAB 1P62B 3EQ9A 4Q5IA 3CH4B 2ZT8A 1DAGA 4K86A 1Q0RA 2F67A 4ZQHA 3R7SA 3UK0A 3FA2A 4N39A 3ONWA 4PAWA 2ZITA 1QH0A 1V4BA 2CZGA 1C0KA 4N6OA 3FZGA 3K35A 5IVPA 1NXTA 1H2HA 3DL0A 4I55B 4LWQA 4LOHA 1ZI8A 1IN6A 4DEXA 4LECA 2VHQA 2PUEA 3SK0A 3OP1A 1B2LA 3M5DA 4MV6A 3A70A 1FRFS 2J41A 3GPCA 2BD0A 4BHTA 3OZBA 5EUQB 1WMAA 3OQMA 1TRHA 3VR6D 4M6WB 3NPAA 2ID7A 2IEGA 1V43A 2Y76A 1OFUA 2VSOA 3HR7A 3L79A 2AHRA 3HXLA 4LYFA 1QR6A 2YY6A 3DONA 4Q9AA 1P6UA 4US1R 1VGVA 1QV7A 5AI0A 2X9LA 5C1IA 2BCEA 2D3WA 3DUWA 1FX0B 3TW0A 4KFUA 5CDGA 2LTAA 4PN3A 5F9MA 1PFGA 2E1RA 2Q5LA 3G59A 1EPUA 3BC1A 1JIKA 4M0DA 3OLVA 3R6LA 2VIIA 3HDGA 1KMCA 5DGIA 4E14A 2GEKA 1SVIA 3GLQA 4NI5A 3UATA 2EJBA 4YJ2B 3CX6A 4G5OA 4FP9A 4RABA 1RPJA 2CHFA 1Y1LA 3CRRA 4GEGA 4BY9E 3CSDA 4KVFA 1XT6A 3X44A 4F84A 3O8DA 1SWWA 5CW1A 1MHPA 3KDPA 4MUBA 1JWBB 4J0IA 4OFWA 3THXA 3ADPA 4XYEA 5SY4A 2O6HA 3FUXA 1G4AE 4CBVA 2PUDA 4R9VA 2NU9B 1M5RA 4G2TA 4GT1A 5DGHA 5AXAA 1Y6JA 1Z0FA 1XD8A 3GJXC 2HMYB 4IOKA 3PEWA 1F0PA 4EUNA 2QB5A 4OGKA 2O8VA 1J2YA 5D3MA 1BGWA 2VTKA 2CVOA 5FNVB 4BFSA 3A31A 4UNPA 3UMBA 1QAMA 3PQ2A 3O93A 4HAZA 1P18A 5IC6A 2FE4A 3I1YA 3WNVA 3PNBA 5L3QB 2WHXA 4CV2A 5C1OA 2F8SA 1DIBA 2PH7A 2WAMA 5GM2A 1SRRA 2O0HA 2QX7A 3HL0A 4RPHA 5KINB 4P33A 2W71A 2QTGA 4WDRA 4AC9A 1B0AA 3W3AH 3DCNA 1UBNA 3MJRA 3JYQA 3W5AA 3EA4A 4F9TA 3AL2A 4B7CA 1ZZEA 5KOHB 3HB4X 5H4HA 5A03A 1O94A 4LRXA 4DLVA 4QYWA 3X1MA 3DAGA 3CBQA 3CBGA 5C31A 4CKXA 2IW1A 5HP4A 4C4XA 4EA6A 2BTEA 2WUEA 1RJFA 3K8OE 1S9HA 3UKJA 4WCDA 3DWFA 5ITWA 5I7RA 4C20A 5LP6F 1EBFA 1TO2E 1EE9A 3C4VA 2QTFA 1CYDA 4WZBA 4ZK2A 3WICA 3VR3A 1XPUA 3NHPA 3AEUB 4UUPA 3EWSA 3FDFA 5CDUA 3CFYA 4RK7A 2PY6A 2UKDA 2IBTA 1WULS 4YRGA 3NATA 3S1SA 1O9HA 3ZE0B 4NYIQ 1PNTA 2C8LA 1QFZA 2B99A 3NHBA 3GMTA 2YY7A 3SN6A 5IT5A 1KL7A 4BLOA 2JH3A 4WD3A 4A15A 3IUSA 1HKUA 1TYCA 1F7UA 5HRUA 1IVYA 2E82A 3AU8A 1S6YA 1XRQA 3IMKA 4A4DA 4RF3A 3LC7O 3WXBA 5JV5A 1RZRD 1KMHB 2GHRA 1I2CA 1P8JA 5LMCA 4E30A 2O5CA 4PR0A 3PWZA 1CR6A 5LQSA 4ZI5A 4CG2A 5CB4F 3KYCB 5H9WA 1V8DA 1RCTE 4QKQA 3PC8A 1FS5A 1NU8A 1X1BA 3UMCA 5A3RA 1SRQA 3HYRA 4CTNA 3IIMA 5A06A 1NVXQ 3BREA 4O2RA 4ZEVA 1FU7A 2OZPA 3K2QA 4DMFA 1ZXXA 2HBZA 4DSNA 4B2PA 2XMSA 3JQFA 1A9XB 1EFUA 2NO5A 5EYPA 1R3DA 2CJWB 4QYSA 1GYRA 4HP8A 5D7BA 1K6IA 2BZ1A 1LNSA 2HF7A 3QENA 4NIMA 2YVUA 1UBOS 2EEPA 2XDWA 3U17A 3LT4A 1SVUA 5FOTA 1XCOA 2DUJA 5ESDA 3SQWA 1ZNYA 2VJYA 4IDHA 1T8TA 3DE1X 3E8SA 1H2EA 3PDCA 5JSZA 1J6UA 1VZ3A 2ZROA 3R3YA 2AF3C 5G4LA 2JJ1D 3IDFA 2CLHB 2XD9A 4HQLA 4HTAA 4N5NA 4UATA 3T94A 5IF3A 5IM4F 2V7QA 4GMHA 1Z34A 4A8JA 4KB5A 4EEXA 3HA7A 1KU0A 1X86B 1CUBA 5B55A 1B6GA 4GLOA 4EB8A 1DFGA 5I48A 1C41A 2M98A 3CEMA 2CF5A 5AKLA 1WY7A 4ND5A 2HLNA 2P3LA 4O25A 5LNK6 4M9RA 2QM0A 2M6KA 3AXTA 1D2HA 3I83A 4OLHA 4ZV7A 4RTPA 1A9SA 1OX4A 3V1YA 3A28A 2VYFA 2VWQA 3OLWA 4S12A 2WV9A 5EUCA 3KZCA 3G7UA 1E62A 1AX9A 1F06A 1YQ9A 3DTNA 3KKPA 3JYLA 3EHEA 3R75A 4AM8A 5HYVA 1KQFA 2YJ3A 2JRCA 1P4SA 2P2SA 4B40A 3DL4A 2PVSA 3RHFA 1RBZA 3FKJA 2LCIA 3IIKA 3WNQA 4ZAGA 4OP1A 4I9UA 1Y9AA 1E9VA 1XFDA 5HKKA 4YHBA 1UFVA 1QIIA 3HP7A 1QYWA 4J49A 3ZXSA 1GUAA 1JEDA 1EVLA 2PKCA 4WFIA 5EZYB 5K3CA 5KCMA 4B4DA 2VAXA 5AJZA 1K89A 3QIAA 1H85A 1HDGO 1YI1A 3IJPA 4RJIA 4DVJA 2A78A 1Q83A 1DG3A 3HWSA 4LZAA 4QUBA 5EESA 3UJPA 4EP1A 3WYAA 3M3PA 1J8QA 2DKNA 4DLRA 3FNBA 3ZVMA 3ZQ4A 4IIEA 3SKXA 1SHZA 3T0FA 3ZWBA 3A1WA 5J63A 4KOEC 2XI4A 1NXQA 1NR5A 3LQ1A 4QJ4A 2AV6A 1CFJA 4W9NA 5FQOA 3DV9A 1WHSB 3OSUA 4IXDA 4PCLA 3EDRA 3P4YA 1OWOA 4B73A 4HH0A 3O8OA 2NZ8A 2ZE7A 4JOSA 2K5UA 5EJGA 5LU9A 1Z63A 1YI0A 4DNXA 1EYZA 1NVVR 1PJ4A 3BCUA 1X13A 5CVDA 5JSKA 2ZRJA 1B42A 2IWHA 3LX4A 2YS7A 4C6RA 4IFEA 1OT3A 1HETA 3DZIA 2Q7XA 1J8MF 3GNSA 4C1BA 2PN1A 3E15A 1DIAA 2HMTA 3BTOA 4HAYA 2ERYA 5TMDA 5AVRA 1U6JA 3GXOA 3ZG6A 3ZXYA 3R9WA 3HJGA 1C3EA 3NJ8A 1P8AA 1Y1PA 3SMQA 2AMJA 3I9NA 5JNLA 1XMQB 3HK2A 5D6NA 1PAUA 2ATIA 2YZKA 2FPPA 3GNQA 5DYIA 3K94A 2Z8XA 1YF3A 1WV1A 3V4SA 1PD1A 4X60A 5A9RA 5JQWA 3AVPA 1U9CA 2UAGA 1E4OA 1WPGA 3QW2A 3IR5A 4I4NA 4QDZA 1O95A 5GJVC 4AJ2A 4JIMA 4ARIA 1IE3A 2WU3A 2HCRA 3O95A 1JE0A 4MIYA 3GEGA 2VDUE 4EI7A 1ORWA 2OGWA 5H3CA 1UC4B 5LBTA 5JY6A 1AQYA 5JNWA 4G3XA 4BIMA 4DEYA 2QQFA 3FDJA 3KOYA 3MHPA 1I0IA 3O3OB 4OM7A 3PSAA 3VDRA 1G63A 4J3FA 5DXFA 1KQGA 1ZGBA 3UQYS 1ESNA 4DMRA 1D2MA 3CWQA 1A5AB 3UW3A 4ZDKA 4AT1A 4PZDA 3AW9A 4NOKA 2E48A 1GLGA 2EBWA 2WYWA 4L78A 4HWTA 2ZBVA 2W6NA 1XTTA 2OMEA 2WWWA 1NQTA 1N2CA 4ISBA 4IH4A 2O8BB 4M60A 2BGIA 3DR5A 1F6WA 4IL5A 4RZUA 3QLUC 2RI0A 2ZJAA 3HL4A 4A0HA 2ACKA 5AVXA 1DGQA 1QOQB 1UK6A 4J4HA 4KFSA 3IQHX 4PYQA 3TYXA 4D0RA 1DXHA 1OXBB 5AIBA 3ANMA 3W9BA 3L05A 3Q15C 4Q05A 3W6OA 1FVXA 2ZU0C 4GDMA 4O08A 4ZOQI 2WIAA 3REFA 3P27A 3ACBA 4E32A 1KEVA 2DBVO 3CZ4A 5JDIA 3RTEA 4I4TA 5TQ0B 5SV2A 2PR2A 3ZCXA 4AIIA 1THMA 5JAUA 3D2LA 4N0DA 3D6MA 2XIJA 4ER5A 5PNTA 4RYDA 4LJAA 2VUHB 3RV3A 1TK9A 3K72B 1CUJA 1RAAA 5EIFA 5FKJA 2ONYA 1OPXA 2XMDA 5AK0A 2M1XA 5DZSA 4GBJA 1TM2A 3FB4A 3MIZA 4A92A 4C0BA 3T1TA 2PZFA 1N6HA 3OZGA 4PIMA 2XX3A 4RJTA 4FHCA 5G1OA 4EBFA 2B1RA 1SIBE 4IPTA 3KPYA 3GK3A 3LWDA 4Q9JA 3QEMA 3DH0A 1NVWQ 1DOHA 1OZAA 1XGKA 3DOEA 3ZHOA 3NVKI 1R4MA 1NVBA 1ECFA 4BMNA 4FUTA 3DQPA 1LCIA 4MKIA 2Z58A 4PX3A 3UMVA 2JGEA 2QLFA 1BRTA 4J7CA 1QIMA 3NWEA 1ZVKA 3FVQA 4GECA 1MENA 1EHCA 5CUQA 4B82A 1J2EA 1B93A 2JCVA 4BKOA 2GVNA 4OUDB 5IUNC 4R2KA 1GCAA 4HKTA 5DHSA 4HPWA 2OVBA 3BGIA 1EVZA 1FXWF 5JPCA 2XMGA 3AP2A 1YDMA 3AESA 4HNRA 1NHWA 2RBGA 1BEZA 4M7OA 4EW2A 3QFHA 1EFTA 2CLDX 2RHHA 1XEWX 3KAQA 4K3VA 3NWPA 1EEXB 3WIUA 4G0WA 2O8EA 2E7ZA 5IMSA 5FUVA 5E2IA 4NE7A 1EJ6A 3AVYA 5JXHA 3R44A 2D00A 1IXKA 3PTLA 3OY7A 4LDRA 4H7HA 2YZ2A 5G02A 2ZPTX 4F0JA 4L22A 1DBWA 4G6ZA 3IBTA 4I9HA 4U7JA 3VR6H 4BVLA 2KLBA 2PANA 2A9FA 4HH4A 3WK6A 2YN2A 4Y9RA 4CF7A 1PFVA 5JUWA 1EM6A 1JXAA 4BO7A 1ZRNA 4Q3LA 3Q1LA 4RC9A 5EKDA 3U9SA 1EX9A 1ORRA 1AN0A 3LQQA 2OXFA 1I5EA 1QVVA 4UCQA 2HM7A 3B13B 2Y8EA 2IRWA 5LP6A 1KI3A 1V1MA 1P91A 1Y3FE 1Y37A 4BO0A 2AXQA 3AM3A 4NDNE 2EKDA 5A0VA 4YQEA 3DVRX 1Z7BA 2FF5A 3PVCA 3ZOKA 1G8FA 3DW3X 1EFRD 2X1LA 2ZBFA 1CTQA 5B58C 4OK5A 4IINA 2X3UA 4MRAA 3NHRA 4PTZA 2NV2B 3FRHA 2J4CA 4BZZA 2Y1LA 4TZKA 5L4LA 2QE6A 2B3DA 2QTBA 4R9NA 3K8QA 4EX7A 1P7WA 4RGVA 3L18A 3K4HA 5DNWA 4DREA 3OX1A 3A2KA 1PJLA 4CMIA 1IQPA 4ITRC 2P79A 3UBTA 3HP1A 2J9YB 4HDMB 5CLHA 4KQFA 1UOPA 3H8WA 3K0CC 2HDWA 4Y1FA 4JC8A 5LBIA 1JG7A 5JNUA 4Z6KA 3Q5DA 2DT8A 1CQIA 1ZVQA 4JBWA 3PX3A 2WUWE 5TPWB 2OXCA 5D85A 4DCSA 4BZXA 1DJNA 3WB9A 2JJQA 1PF7E 3HA3A 1Q11A 1UM8A 3E2PA 1E3LA 2XR1A 2Z57A 3BFJA 3Q7EA 4PYRA 4Q7EA 4XPIA 2QIOA 5CIWA 4WLOA 3VC1A 5K2OA 1Z6PA 2BMDA 2VBGA 3G8YA 3HDJA 4PG5A 4YIKA 4KXNA 2M6SA 3KQPA 3L0PA 4Z4EA 1RRFA 5BR1A 1FNDA 3DXZA 3ZEAA 2VKTA 1EUCB 1GVNB 4GM0A 4PGMA 3GUVA 3CZAA 3FMPB 4JB3A 5LXTB 4LZLA 1ORIA 3T12A 4RSHA 2P4EA 4LYDA 2Z4TA 1B8VA 4G24A 5DTQA 1U7HA 4GUDA 3IKLA 1I7SB 1YA4A 5FADA 3QLTA 1XHFA 3EG9A 4GOXA 2BR4A 4JT8A 4ZYZA 5I45A 3T7EA 1MAVA 1WCIA 3ZHYA 1WCYA 2JS7A 1HFWA 2X15A 3IUQA 3NUZA 1KRWA 2WSSD 1JPNA 4EQ6B 5KX5F 3HCAA 1O4WA 1UMCA 4BWVA 3B2EA 1DE0A 3EMBA 3NKVA 4OBBA 3WV5A 2FMUA 3N70A 5HTKA 5KVCA 1EGMB 1B0PA 1AF7A 4KO8A 4TMXA 2HHLA 2PPVA 4C7MA 4DY6A 1ISSA 1ZNWA 1L9KA 4O1IA 2EQBA 5ANRB 5FUXA 3VFDA 4REOA 3LLSA 3QM1A 3WVNA 4A6PA 3ESBA 1XROA 4ASUA 4XGIA 1K9VF 4IGEA 3HN7A 3E23A 3FRJA 4ZYTA 1G3RA 1PGOA 4QNRA 4MRRA 1V8OA 2A1IA 5TQ2B 5KVSA 4JQCA 2HAEA 3C6XA 4PYMA 5KKNB 1H23A 2FAXA 3QVOA 1S4QA 2ZAOA 3FLAA 4G85A 1E2MA 2YWDA 3HMKA 1SUCA 5EAIA 3KT8A 4EY4A 3IO3A 1XD9A 3K6SB 3CEJA 1PG5A 2DFPA 1QE3A 2PM8A 3AIIA 5FNZA 2W4MA 4MEBA 3OKPA 2AFIB 1HEIA 1KJZA 1LVGA 1F4VA 3D7SA 3LKDA 3HR4A 3R7WB 1KO8A 3H4VA 2VAMA 2Q4EA 2NP6A 2JCYA 2XNHA 5HKAA 1P3Y1 1Z0DA 4AY2A 1XEAA 5K8UA 1TKBA 1PT8A 2SKDA 3MELA 5K3BA 2C59A 3ZLTA 3L1JA 2OCXA 1R10A 1B0ZA 2WU0A 3H2YA 1WAMA 3HMQA 1GDDA 2AEMA 4CM8B 2JPDA 2NG1A 3AOGA 1FDVA 1R66A 1NI5A 5EE9A 1M2KA 2F4VB 2B0CA 4FMCB 4FS8A 3WTCA 1L7XA 3IE1A 2P6MA 1O1YA 3G49A 2PLWA 4FFBA 4G01B 3I0MA 1FNMA 1CE8B 4P32A 1MEOA 1PZGA 3A2LA 3H0CA 4ML3A 1SQ6A 3OMWA 1FTSA 2Y9PB 3QTTA 4WMLA 1TA0A 2XODA 4F5ZA 1FS4A 2WK1A 3MWFA 1IHPA 1WLYA 4BN5A 5SZIA 4WXEA 2R6CA 2YWJA 3BCSA 5AOAA 4Z3DA 2YFHA 1R0CA 3EUAA 4YAKA 2A9VA 2HK9A 3H1FA 2DJ5A 1DUSA 3SSOA 3GRAA 2FPGA 5EHNA 3V4VB 2COKA 3WYNA 3T7SA 1GZ3A 5EMJA 1K06A 3N6RA 1ATIA 3OUTA 5A9SA 3ASVA 1HZZA 3PJRA 1Y34E 2C07A 3CMCO 5LYJA 3UXMA 4EWLA 2AFIE 1JHVA 2CVZA 2IEAA 2WKQA 3JYNA 1ONOA 3OZFA 2Z6QA 2VF4X 3JAKA 5G4KA 2VHUA 2WF5A 1UBUS 2Q6TA 3KZMA 1XAHA 2P9YA 3NHLA 1G3MA 4QQ8A 1BIFA 3M82A 1DRJA 3DVQX 3GAZA 4XFJA 5GY7A 4JUCA 2FWPA 4B6GA 2CXXA 4C5BA 4D9JA 1R6VA 3EOZA 4ER0A 4L27A 1R0LA 2QQ0A 3JQQA 3KLBA 1OLUA 2ZBRA 4HH1A 3EPHA 1P1FA 1BVRA 1N6LA 2RIRA 5ALYA 1I4TD 4IMIB 1JEQB 2DHCA 5EUBA 5HQ3B 5ERYA 4KFCA 4EYEA 1ULTA 3P9ZA 4QVGA 4UOZA 4YJHA 3GGDA 3OPYB 4BKMA 1BCRB 2IODA 5B4VA 1Z39A 4BP8A 1YZGA 1C3OA 2RHJA 4QODA 4RENA 2Y27A 4TS9A 3JPWA 1TC1A 5TE9A 1B6TA 1YJ5A 4GC5A 4QJ5A 1AS0A 4BO6A 3AB3A 4EO9A 3GGCA 3DGEC 1X8KA 4ZFNA 1E64A 1I3MA 1WXXA 3ENNA 3DT6A 3GAFA 1DC3A 1XWFA 5E0OA 1LS6A 2XAUA 4TVOA 3FBGA 3N8DA 4B8ZA 4MMZB 5BR8B 1BW9B 4ZT4A 4URUR 2VPQA 3EUEA 5HBRA 4BB9A 4EECA 5C8YF 1GKUB 1HK7A 2O8DB 1JV2B 3TR0A 5DU2A 5GMOA 3R4CA 5IBRA 1G8KA 1HDXA 1YA8A 3CNQS 3O1LA 2LDBA 5DK4A 2OQIA 2NZVG 1RMYA 3LK7A 3VKVA 1F38A 3A3YA 2QMEA 2R9VA 3IP7A 4FFPA 4KN6A 4X63A 4G81A 4W9MC 1SBCA 5HRAA 4Q4AA 3RFFA 4HGNA 3TE7A 3CGWA 2VKQA 1G8YA 1ODLA 3ILXA 3P8ZA 4UEWA 4B6JA 5IEJA 1GU7A 1ZC4A 5J23A 4R1MA 1NN0A 1FS6A 1E89A 3H17A 3VMMA 2C9OA 1KR2A 5BSUA 5CNKA 1DAKA 1QDEA 3PCTA 2A5JA 2YZNA 4P3PA 5KYVA 4DOMA 5JS8A 1UBCA 4IJKA 2P2DA 4MA5A 2CXSA 2RGWA 1SBHA 3WYGA 1N77A 1XO1A 1KS2A 3DKKA 4LJ8A 2Z0MA 3FYUC 3CX4A 2AGVA 5I4KA 2JAQA 2NUBA 1SVSA 3M2TA 4GI3A 4WLFA 5ALDA 1V45E 4RPGA 4RESA 3VO1A 4AZ3B 3BH0A 4OQDA 4A0GA 1J7JA 5HUQA 1HQCA 1EIWA 1KO5A 4YR7A 3P94A 4TV8B 2EFDB 3M6AA 1NOIA 3KSMA 2I91A 1VIYA 3A1SA 3F5DA 1M6EX 4E2FA 2ZUUA 3DZ8A 4CQJA 1VI6A 3WHPA 3RAFC 3KQTA 3CH5A 4LE2A 5EHZA 1YUBA 3ST7A 1L5ZA 2V7EA 4GBED 2PZMA 4P3KA 5U1PA 2XVMA 1S8AA 3QVWA 3I3SR 3TGPA 2DT5A 1ZHHA 3D43A 2BEWB 1THGA 2A0UA 2C2BA 2DWOA 3B7GA 2EF1A 2GRUA 2I4MA 1CEEA 2EG5A 2V0CA 3DDCA 4U7TB 4ZVVA 3NAGA 3FZNA 4W1QA 1KQ3A 5JYBA 3GT7A 4OHCA 3VPHA 3UWDA 1NMZA 2VYQA 4G9EA 4M36A 1R8YA 2ORYA 1YHZA 2FPMA 4RK5A 4LF4B 4JBXA 2HXYA 3G2NA 3CF2A 1PK9A 2PGXA 2C9CA 4NZ9A 5HS6A 2JFBA 3W1EA 3MQFA 2QENA 1E5TA 4KRGA 2WF9A 4IS2A 4DJTA 3H2IA 3CRQA 1AQUA 1LBSA 3OKCA 5LLTA 3RT7A 1RYKA 2HIMA 2WB4A 3A1CA 3EIXA 3BRCA 4UNRA 3OECA 4QPJC 1MD9A 4RPLA 4QAJA 1NDHA 2DQKA 4HUTA 3SY8A 3AF1A 1EFHA 4LC0A 2H8KA 2C7BA 3G23A 2I87A 1FTQA 4QEKA 4DRXB 4M37A 4HDOB 3NV9A 1YS2X 4Q7MB 1HE1C 2J9RA 4I9NA 2NSJA 5LR6A 1KYYA 4LQCA 2PKEA 4MK4A 4WW0A 4GHWA 4YPFA 4BFTA 1RW4A 4MS1B 5JWHA 3GMDA 1YQQA 2I03A 1QBGA 2IHJA 2DBYA 4WQMA 3PXCX 1BFKA 1TLTA 3ZIUA 3NHFA 5EMKA 2IPMA 2NNWB 1ZKDA 2X41A 3P4UA 4NU5A 4YRLA 5WRFA 1TL7C 3W0LB 4EABA 5AVYA 5ERXA 4F7WA 3IKMB 4DR5B 4KLAA 5DTMA 4CI9A 4MVXA 1T3TA 2R2AA 2XNSA 3PDUA 3ABZA 3DT9A 4AJPA 3OJCA 1AXGA 3R9XA 3FRIA 3IMGA 3UMFA 1HLPA 1CNMA 1T24A 4ZQEA 2C99A 1G3QA 2GCPA 4WN9A 1J9EA 3M5PA 5EG5A 3VR2A 2J3DA 5E6SB 2I6TA 7REQB 3BZWA 4TMWA 5A05A 5A4DA 2AJDA 4PCUA 4FHGA 2ZJ1A 2VYVD 1UJ4A 1HQDA 3G2KA 3TQOA 4JY7A 1SKBA 1P9WA 1SUIA 3EDOA 3EEIA 4OPMA 1L9XA 3B85A 4F4JA 5I7FA 3NRCA 4F1JA 1TD9A 4M53A 1GAQA 4OHUA 2CK3D 1Z5NA 3MCAA 2UYHA 1R5NA 3RRXA 4XFDA 1OVMA 1PCXA 3KXKA 1BKSB 2Z43A 2H4JA 4I50B 4NVRA 3VO2A 4D3XA 1YB1A 4HAWA 5ECWA 4RZ3A 2AJBA 2JD2A 4LGMA 1YHYA 4QOIA 4CDMA 4C0WA 1Z28A 4I1RA 3EDYA 3F4BA 5AXCA 4LYHA 4NICA 3QTBA 5DXJA 5FUYA 5IJXA 2DY0A 4B0OA 1T6NA 3ZY2A 4E3ZA 4N5HX 3GN2A 3RYCA 5THQA 3M9XA 1B7GO 1JIIA 2UZIR 1MP0A 4M0FA 3MJEA 1QH1A 2QX6A 2ZAGA 1J90A 1SC9A 4KDCA 3C3KA 1DL5A 4P3NA 4YRDA 2R1TA 3I6MA 5FBZA 5E8RA 4CUJA 1DHRA 1RSZA 3OFNA 4RQAA 3VNQA 3OOYA 1Z4LA 5G0WA 3AILA 4C6SA 5J47A 3GT3A 5DX8A 5KX5A 3PDJA 2RDMA 1WMBA 3JVUA 4IXMA 3EDCA 1KTVA 4LJ9A 4BO2A 1E32A 3QPVA 4YRBA 4KITB 2DLCX 4I08A 4M8KA 4PBRA 4D74A 2Q9AA 4KN9S 4CLDA 1W48A 4D9HA 1WABA 1ACLA 1RYYA 2KYRA 3HM2A 4RZQA 2GF9A 1NY6A 4INOA 2FP4A 3OZXA 2PKQO 4GLBA 4OMUA 5JSUA 1M34A 2Q99A 2RG7A 3NB0A 3Q9UA 1WXFA 3JATA 4HYYA 4QUDA 3TGWA 4CL8A 5BN3A 4FGUA 2PLAA 5EP3A 5FTKA 3AEQB 2OXRA 4DSAA 2KLHA 1Y5NA 4HY3A 3LCRA 3VBCA 2IGTA 4F3RA 1U8UA 5KYXA 3OPVA 5TXGA 1KPIA 2CCKA 3ZY3A 5KYNA 1Z2CA 2K7ZA 4R05A 3LNTA 4YRCA 3U6BA 3PPWA 2BCGY 2FN3A 1BDJA 4J2TA