The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
67
|
sequence length |
236
|
structure length |
232
|
Chain Sequence |
NDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of an intrinsically active cholera toxin mutant yield
insight into the toxin activation mechanism
pubmed doi rcsb |
| molecule keywords |
Cholera enterotoxin, A chain precursor
|
| molecule tags |
Transferase,toxin
|
| source organism |
Vibrio cholerae
|
| total genus |
67
|
| structure length |
232
|
| sequence length |
236
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.4.2.36: NAD(+)--diphthamide ADP-ribosyltransferase. |
| pdb deposition date | 2004-01-20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Heat-Labile Enterotoxin; Chain A | Heat-Labile Enterotoxin, subunit A |
#chains in the Genus database with same CATH superfamily 1S5B A; 2VSA A; 2CB4 A; 1PRT A; 2A5F B; 1S5C A; 1LTI A; 1S5E A; 2A5D B; 1S5D A; 1LTT A; 1BCP A; 2VSE A; 2CB6 A; 1LTB A; 4K6L G; 1LTS A; 1XTC A; 1S5F A; 1LT4 A; 2A5G B; 1LTG A; 1HTL A; 1TII A; 1PTO A; 1LT3 A; 1LTA A; 4Z9C A; #chains in the Genus database with same CATH topology 1S5B A; 2VSA A; 2CB4 A; 1PRT A; 2A5F B; 1S5C A; 1LTI A; 1S5E A; 2A5D B; 1S5D A; 1LTT A; 1BCP A; 2VSE A; 2CB6 A; 1LTB A; 4K6L G; 1LTS A; 1XTC A; 1S5F A; 1LT4 A; 2A5G B; 1LTG A; 1HTL A; 1TII A; 1PTO A; 1LT3 A; 1LTA A; 4Z9C A; #chains in the Genus database with same CATH homology 1S5B A; 2VSA A; 2CB4 A; 1PRT A; 2A5F B; 1S5C A; 1LTI A; 1S5E A; 2A5D B; 1S5D A; 1LTT A; 1BCP A; 2VSE A; 2CB6 A; 1LTB A; 4K6L G; 1LTS A; 1XTC A; 1S5F A; 1LT4 A; 2A5G B; 1LTG A; 1HTL A; 1TII A; 1PTO A; 1LT3 A; 1LTA A; 4Z9C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...